Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54808.1

JCVISYN3A_0448

Uncharacterized rRNA methyltransferase.
M. mycoides homolog: Q6MTA0.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 41
Unique PROST Go: 7
Unique BLAST Go: 3
Unique Foldseek Go: 2

Total Homologs: 228
Unique PROST Homologs: 37
Unique BLAST Homologs: 6
Unique Foldseek Homologs: 68

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: spoU/trmH rRNA methyltransferase
Zhang et al. [4]: GO:0070039|rRNA (guanosine-2'-O-)-methylt ransferase activity
Bianchi et al. [5]: rRNA methyltransferase TrmH family

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P18644 (23S rRNA (adenosine(1067)-2'-O)-methyltransferase) with a FATCAT P-Value: 0 and RMSD of 2.96 angstrom. The sequence alignment identity is 21.0%.
Structural alignment shown in left. Query protein AVX54808.1 colored as red in alignment, homolog P18644 colored as blue. Query protein AVX54808.1 is also shown in right top, homolog P18644 showed in right bottom. They are colored based on secondary structures.

  AVX54808.1 MEVISSVSNPKIKEILKLKD--RKHRNKQKLFIVEGFHMIMEAYNDQIIKTLLGTSKALEIL-KDEIPNIEQVIEI--SENVAKKISD-TVTSQ------ 88
      P18644 MTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHS-----IAA--GV-EFIEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGER 92

  AVX54808.1 --QIFAICSMPENTKI-DFEN---NILLLDQIQDPGNLGTLIRSAASFNFKTVIASPNSV-NFHNQKVLRSTQGNLFQVNLV---NEYLVTVINQLHDNN 178
      P18644 KAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVVLSGREEAIAFI---RDSG 189

  AVX54808.1 YIIIGTSL-HD-D-S-KPLSKVKFDSDDKYALIIGNEGKGISPELLDLID----LNINIEMAEDVDSINAAVA-GSIIMY-QIN-NAK--- 255
      P18644 MQLM-T-LKADGDISVKELG----DNPDRLALLFGSE-KG-GPS--DLFEEASSASVSIPMMSQTESLNVSVSLG-IALHERIDRNLAANR 269

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
1. PBF	GO:0006396	RNA processing
1. PBF	GO:0008175	tRNA methyltransferase activity
1. PBF	GO:0001510	RNA methylation
1. PBF	GO:0000453	enzyme-directed rRNA 2'-O-methylation
1. PBF	GO:0070039	rRNA (guanosine-2'-O-)-methyltransferase activity
1. PBF	GO:0030743	rRNA (adenosine-2'-O-)-methyltransferase activity
1. PBF	GO:0006364	rRNA processing
1. PBF	GO:0046677	response to antibiotic
1. PBF	GO:0008173	RNA methyltransferase activity
2. PF	GO:0070475	rRNA base methylation
2. PF	GO:0005737	cytoplasm
2. PF	GO:0070042	rRNA (uridine-N3-)-methyltransferase activity
2. PF	GO:0008168	methyltransferase activity
2. PF	GO:0032259	methylation
3. BF	GO:0052666	tRNA (cytosine-2'-O-)-methyltransferase activity
3. BF	GO:0002938	tRNA guanine ribose methylation
3. BF	GO:0002132	wobble position uridine ribose methylation
3. BF	GO:0052665	tRNA (uracil-2'-O-)-methyltransferase activity
3. BF	GO:0002131	wobble position cytosine ribose methylation
3. BF	GO:0005829	cytosol
3. BF	GO:0009020	tRNA (guanosine-2'-O-)-methyltransferase activity
4. PB	GO:0008989	rRNA (guanine-N1-)-methyltransferase activity
4. PB	GO:0000451	rRNA 2'-O-methylation
4. PB	GO:0005739	mitochondrion
4. PB	GO:0000963	mitochondrial RNA processing
4. PB	GO:0005759	mitochondrial matrix
4. PB	GO:0031167	rRNA methylation
5. P	GO:0005880	nuclear microtubule
5. P	GO:0017126	nucleologenesis
5. P	GO:0070037	rRNA (pseudouridine) methyltransferase activity
5. P	GO:0032040	small-subunit processome
5. P	GO:0001824	blastocyst development
5. P	GO:0019843	rRNA binding
5. P	GO:0005730	nucleolus
6. F	GO:0008033	tRNA processing
6. F	GO:0002128	tRNA nucleoside ribose methylation
7. B	GO:0000049	tRNA binding
7. B	GO:0016423	tRNA (guanine) methyltransferase activity
7. B	GO:0030488	tRNA methylation

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0003723	RNA binding
GO:0006396	RNA processing
GO:0001510	RNA methylation
GO:0005737	cytoplasm
GO:0008168	methyltransferase activity
GO:0008173	RNA methyltransferase activity
GO:0032259	methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q9CCW4	Uncharacterized tRNA/rRNA methyltransferase ML0324	6.44e-10	8.53e-14	2.46e-11	0.6922
1. PBF	Q6D127	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	7.66e-15	3.57e-47	2.10e-07	0.7169
1. PBF	P74261	Uncharacterized tRNA/rRNA methyltransferase slr1673	0.00e+00	1.13e-45	3.94e-19	0.9108
1. PBF	Q7WKX5	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.60e-14	9.17e-50	2.75e-10	0.6929
1. PBF	Q9RED7	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.77e-15	7.38e-45	4.76e-04	0.7231
1. PBF	Q7W7I7	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.44e-13	9.17e-50	2.75e-10	0.6734
1. PBF	A1TG08	Uncharacterized tRNA/rRNA methyltransferase Mvan_5337	5.94e-10	2.06e-09	2.38e-09	0.6762
1. PBF	Q87VK2	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	5.55e-15	2.33e-45	2.47e-05	0.688
1. PBF	A0R557	Uncharacterized tRNA/rRNA methyltransferase MSMEG_6073/MSMEI_5913	5.44e-10	4.46e-10	1.42e-07	0.6827
1. PBF	Q6LM40	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	5.55e-16	1.35e-47	6.93e-05	0.7487
1. PBF	P94538	Uncharacterized tRNA/rRNA methyltransferase YsgA	0.00e+00	3.26e-74	7.46e-45	0.9058
1. PBF	Q5HIE3	Putative TrmH family tRNA/rRNA methyltransferase	2.10e-13	1.71e-40	1.38e-15	0.5915
1. PBF	Q8EAG8	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	5.22e-15	5.96e-50	4.26e-07	0.7345
1. PBF	Q7MYU6	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.33e-15	1.92e-48	1.80e-06	0.7498
1. PBF	Q82XD1	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.24e-14	1.84e-39	5.92e-06	0.6124
1. PBF	Q8PAG5	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.64e-12	1.01e-47	2.27e-04	0.6162
1. PBF	Q8ZKA2	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.22e-15	1.57e-49	8.60e-09	0.7486
1. PBF	Q7A1Q9	Putative TrmH family tRNA/rRNA methyltransferase	1.04e-13	1.23e-41	1.13e-15	0.5813
1. PBF	Q7TW55	Uncharacterized tRNA/rRNA methyltransferase Mb3610c	9.18e-10	2.69e-14	1.95e-08	0.707
1. PBF	P63178	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.98e-13	3.14e-49	9.19e-09	0.6656
1. PBF	P52393	23S rRNA (adenosine(1067)-2'-O)-methyltransferase	1.11e-16	3.82e-52	9.56e-07	0.7976
1. PBF	Q7VTK4	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.48e-13	9.17e-50	2.75e-10	0.6505
1. PBF	Q743W2	Uncharacterized tRNA/rRNA methyltransferase MAP_0479	4.60e-10	5.35e-11	1.62e-09	0.6884
1. PBF	Q83CW6	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	8.88e-16	3.66e-43	4.23e-10	0.7416
1. PBF	P44906	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.44e-16	8.52e-46	4.10e-05	0.7591
1. PBF	Q9CJP3	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.44e-16	1.01e-41	3.68e-05	0.7594
1. PBF	Q88DE7	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.38e-14	4.28e-44	2.79e-06	0.6811
1. PBF	Q6GJD7	Putative TrmH family tRNA/rRNA methyltransferase	8.48e-14	1.23e-41	1.13e-15	0.5794
1. PBF	Q87D65	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	7.77e-13	1.32e-45	4.27e-07	0.6665
1. PBF	P63179	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.34e-14	3.14e-49	9.19e-09	0.7131
1. PBF	A4T5L0	Uncharacterized tRNA/rRNA methyltransferase Mflv_1447	6.36e-10	8.16e-10	9.98e-08	0.6884
1. PBF	A0PV26	Uncharacterized tRNA/rRNA methyltransferase MUL_4155	4.90e-10	3.54e-11	1.64e-09	0.6824
1. PBF	Q7A794	Putative TrmH family tRNA/rRNA methyltransferase	9.65e-14	1.23e-41	1.13e-15	0.5743
1. PBF	Q8DCT8	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	9.10e-15	2.61e-47	2.21e-06	0.713
1. PBF	B8ZUB0	Uncharacterized tRNA/rRNA methyltransferase MLBr00324	5.07e-10	8.53e-14	2.46e-11	0.6939
1. PBF	P18644	23S rRNA (adenosine(1067)-2'-O)-methyltransferase	0.00e+00	7.58e-52	7.00e-04	0.7994
1. PBF	Q5HRM1	Putative TrmH family tRNA/rRNA methyltransferase	6.47e-14	8.28e-44	6.14e-15	0.5774
1. PBF	Q9JUU8	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	7.53e-14	1.54e-41	2.42e-08	0.5902
1. PBF	Q8Z182	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	2.22e-15	2.60e-49	8.35e-09	0.7596
1. PBF	Q7VQP0	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	0.00e+00	2.85e-40	9.15e-05	0.7562
1. PBF	P59968	Uncharacterized tRNA/rRNA methyltransferase Mb0905	0.00e+00	2.46e-39	4.21e-11	0.8509
1. PBF	A1KPR5	Uncharacterized tRNA/rRNA methyltransferase BCG_3644c	7.17e-10	2.16e-14	1.10e-08	0.6973
1. PBF	Q99W72	Putative TrmH family tRNA/rRNA methyltransferase	1.14e-13	1.23e-41	1.13e-15	0.5786
1. PBF	P52391	23S rRNA (adenosine(1067)-2'-O)-methyltransferase	0.00e+00	3.31e-51	2.12e-06	0.8274
1. PBF	Q9AGT0	Putative TrmH family tRNA/rRNA methyltransferase	1.96e-13	1.71e-40	1.38e-15	0.5819
1. PBF	Q8PM64	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	2.13e-13	2.67e-47	0.007	0.602
1. PBF	Q8CTT9	Putative TrmH family tRNA/rRNA methyltransferase	1.70e-13	8.28e-44	6.14e-15	0.5733
1. PBF	Q7MH13	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	6.66e-16	2.61e-47	2.21e-06	0.7538
1. PBF	P63180	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	9.03e-14	3.14e-49	9.19e-09	0.685
1. PBF	Q9JZR3	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	9.87e-14	4.23e-41	5.10e-08	0.5855
1. PBF	P9WFY2	Uncharacterized tRNA/rRNA methyltransferase MT0904	0.00e+00	2.46e-39	4.21e-11	0.861
1. PBF	Q9PC00	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	5.43e-13	1.89e-46	5.01e-08	0.6634
1. PBF	A0QAB6	Uncharacterized tRNA/rRNA methyltransferase MAV_0574	7.15e-10	9.05e-11	7.05e-10	0.6973
1. PBF	O30272	Uncharacterized tRNA/rRNA methyltransferase AF_2399	0.00e+00	5.67e-33	2.36e-07	0.7639
1. PBF	Q9F5K6	23S rRNA (uridine(2479)-2'-O)-methyltransferase	0.00e+00	1.20e-41	4.13e-11	0.8691
1. PBF	Q9KNY2	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.55e-15	1.90e-47	5.15e-05	0.7059
1. PBF	Q8Y016	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.74e-14	5.34e-43	2.45e-08	0.6923
1. PBF	P75424	Uncharacterized tRNA/rRNA methyltransferase MG252 homolog	0.00e+00	1.87e-52	9.86e-14	0.7802
1. PBF	A4QNL8	rRNA methyltransferase 3, mitochondrial	2.23e-14	4.90e-03	9.23e-12	0.7934
1. PBF	P47494	Uncharacterized tRNA/rRNA methyltransferase MG252	0.00e+00	2.52e-51	7.39e-12	0.7923
1. PBF	Q6GBV6	Putative TrmH family tRNA/rRNA methyltransferase	6.82e-14	1.23e-41	1.13e-15	0.5797
1. PBF	Q87L11	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	3.22e-15	1.39e-47	1.03e-05	0.7351
1. PBF	Q06753	Putative TrmH family tRNA/rRNA methyltransferase YacO	0.00e+00	5.95e-44	1.23e-11	0.7833
1. PBF	A5U8Q4	Uncharacterized tRNA/rRNA methyltransferase MRA_3618	9.44e-10	4.87e-14	5.42e-09	0.7047
1. PBF	B1MGY6	Uncharacterized tRNA/rRNA methyltransferase MAB_0572	3.42e-10	6.41e-09	1.97e-10	0.6917
1. PBF	Q9HUM8	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	1.44e-15	6.41e-46	1.27e-08	0.7231
1. PBF	O51468	Uncharacterized tRNA/rRNA methyltransferase BB_0516	6.66e-16	1.53e-27	1.67e-13	0.7394
1. PBF	P9WFY4	Uncharacterized tRNA/rRNA methyltransferase MT3685	1.11e-09	4.87e-14	5.42e-09	0.6961
1. PBF	Q4L3J1	Putative TrmH family tRNA/rRNA methyltransferase	9.93e-14	3.57e-43	4.58e-13	0.5885
1. PBF	Q7NYX3	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	5.06e-14	3.16e-44	1.18e-07	0.5997
1. PBF	Q7VP36	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.44e-16	1.04e-46	3.84e-05	0.7561
1. PBF	B2HJ20	Uncharacterized tRNA/rRNA methyltransferase MMAR_5079	3.64e-10	6.62e-11	1.74e-09	0.6818
1. PBF	Q8ZIV4	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	2.22e-15	2.10e-44	1.62e-08	0.7569
1. PBF	Q6GPJ4	rRNA methyltransferase 3, mitochondrial	2.91e-14	2.53e-03	4.50e-13	0.8066
1. PBF	Q6FF50	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	0.00e+00	5.35e-46	2.43e-09	0.7867
1. PBF	Q49V41	Putative TrmH family tRNA/rRNA methyltransferase	3.22e-15	3.47e-41	1.93e-15	0.707
2. PF	Q9ZKD2	Ribosomal RNA small subunit methyltransferase E	6.22e-04	1.70e-06	NA	0.4331
2. PF	P57488	Ribosomal RNA small subunit methyltransferase E	1.42e-03	3.90e-06	NA	0.4423
2. PF	P9WGX0	Ribosomal RNA small subunit methyltransferase E	1.78e-04	7.00e-03	NA	0.5213
2. PF	Q92J59	Ribosomal RNA small subunit methyltransferase E	5.87e-04	1.63e-05	NA	0.5063
2. PF	A3Q6V9	Uncharacterized tRNA/rRNA methyltransferase Mjls_5122	1.04e-09	4.98e-10	NA	0.6717
2. PF	P67203	Ribosomal RNA small subunit methyltransferase E	1.74e-04	7.00e-03	NA	0.5247
2. PF	O66552	Ribosomal RNA small subunit methyltransferase E	1.92e-03	3.29e-03	NA	0.435
2. PF	P44627	Ribosomal RNA small subunit methyltransferase E	4.63e-03	1.30e-02	NA	0.4631
2. PF	Q1B2P4	Uncharacterized tRNA/rRNA methyltransferase Mmcs_4736	7.50e-10	4.33e-10	NA	0.6687
2. PF	P0AGL8	Ribosomal RNA small subunit methyltransferase E	3.30e-04	6.16e-03	NA	0.4369
2. PF	A1UMF4	Uncharacterized tRNA/rRNA methyltransferase Mkms_4822	7.96e-10	4.33e-10	NA	0.6796
2. PF	P0AGL9	Ribosomal RNA small subunit methyltransferase E	4.02e-04	6.16e-03	NA	0.4708
2. PF	O25138	Ribosomal RNA small subunit methyltransferase E	6.63e-03	1.89e-06	NA	0.4401
2. PF	O83075	Ribosomal RNA small subunit methyltransferase E	3.00e-04	1.59e-05	NA	0.4513
2. PF	O50188	Ribosomal RNA small subunit methyltransferase E	7.44e-03	2.49e-02	NA	0.5198
2. PF	P54461	Ribosomal RNA small subunit methyltransferase E	1.31e-02	1.46e-02	NA	0.4136
2. PF	O51333	Ribosomal RNA small subunit methyltransferase E 2	3.92e-04	6.73e-04	NA	0.4738
2. PF	Q8K9E4	Ribosomal RNA small subunit methyltransferase E	1.31e-03	4.09e-07	NA	0.4627
2. PF	O51089	Ribosomal RNA small subunit methyltransferase E 1	2.15e-03	5.20e-05	NA	0.4535
2. PF	P37995	Ribosomal RNA small subunit methyltransferase E	4.73e-04	3.36e-03	NA	0.5273
3. BF	P74328	Uncharacterized tRNA/rRNA methyltransferase slr0955	4.01e-09	NA	3.96e-09	0.6069
3. BF	P0AGJ4	tRNA (guanosine(18)-2'-O)-methyltransferase	4.62e-10	NA	1.38e-05	0.8409
3. BF	P44703	Uncharacterized tRNA/rRNA methyltransferase HI_0424	1.83e-10	NA	1.76e-04	0.7216
3. BF	A0LHE3	Ribosomal RNA small subunit methyltransferase G 2	7.09e-12	NA	8.64e-05	0.7549
3. BF	O51081	tRNA (guanosine(18)-2'-O)-methyltransferase	1.74e-09	NA	2.91e-04	0.7796
3. BF	Q5SM16	tRNA (guanosine(18)-2'-O)-methyltransferase	1.34e-13	NA	4.10e-05	0.8823
3. BF	B2IBT9	tRNA (cytidine(34)-2'-O)-methyltransferase	3.47e-14	NA	1.30e-04	0.8658
3. BF	Q72GI1	tRNA (guanosine(18)-2'-O)-methyltransferase	4.07e-12	NA	4.10e-05	0.834
3. BF	P0AGJ3	tRNA (guanosine(18)-2'-O)-methyltransferase	3.52e-10	NA	1.38e-05	0.8434
3. BF	A0A0H2ZF87	tRNA (cytidine/uridine/adenosine-2'-O-)-methyltransferase TrmJ	3.85e-09	NA	0.031	0.6814
3. BF	O67577	tRNA (guanosine(18)-2'-O)-methyltransferase	2.34e-12	NA	5.56e-05	0.8407
4. PB	P9WFY5	Uncharacterized tRNA/rRNA methyltransferase Rv3579c	8.61e-10	4.87e-14	5.42e-09	NA
4. PB	Q9HC36	rRNA methyltransferase 3, mitochondrial	8.79e-14	3.46e-02	1.31e-17	NA
4. PB	P63177	23S rRNA (guanosine-2'-O-)-methyltransferase RlmB	4.77e-15	3.14e-49	9.19e-09	NA
4. PB	A1L2E4	rRNA methyltransferase 3B, mitochondrial	6.52e-12	1.24e-02	3.17e-14	NA
4. PB	Q5ND52	rRNA methyltransferase 3, mitochondrial	7.77e-15	3.12e-02	2.06e-17	NA
4. PB	Q6IN84	rRNA methyltransferase 1, mitochondrial	1.25e-09	3.90e-13	3.22e-07	NA
4. PB	P9WFY3	Uncharacterized tRNA/rRNA methyltransferase Rv0881	0.00e+00	7.91e-40	3.47e-11	NA
4. PB	Q566V3	rRNA methyltransferase 3A, mitochondrial	2.11e-14	2.38e-02	1.39e-12	NA
4. PB	O94631	rRNA methyltransferase 1, mitochondrial	1.35e-10	3.90e-26	7.04e-04	NA
4. PB	Q99J25	rRNA methyltransferase 1, mitochondrial	1.13e-10	3.58e-20	5.35e-06	NA
5. P	Q8ZW45	Ribosomal RNA small subunit methyltransferase Nep1	1.64e-02	1.24e-03	NA	NA
5. P	A0B5L3	Ribosomal RNA small subunit methyltransferase Nep1	3.37e-02	4.75e-05	NA	NA
5. P	Q5JI44	Ribosomal RNA small subunit methyltransferase Nep1	1.91e-02	1.15e-04	NA	NA
5. P	O29524	Ribosomal RNA small subunit methyltransferase Nep1	2.99e-02	1.80e-04	NA	NA
5. P	A1RVH0	Ribosomal RNA small subunit methyltransferase Nep1	1.87e-02	5.88e-05	NA	NA
5. P	P0AGL7	Ribosomal RNA small subunit methyltransferase E	3.48e-04	6.16e-03	NA	NA
5. P	O35130	Ribosomal RNA small subunit methyltransferase NEP1	2.24e-02	1.77e-02	NA	NA
5. P	A3MWJ1	Ribosomal RNA small subunit methyltransferase Nep1	2.29e-02	3.68e-05	NA	NA
5. P	Q9V0M0	Ribosomal RNA small subunit methyltransferase Nep1	2.16e-02	1.32e-06	NA	NA
5. P	A4WMI3	Ribosomal RNA small subunit methyltransferase Nep1	1.17e-02	1.90e-04	NA	NA
5. P	B6YTM6	Ribosomal RNA small subunit methyltransferase Nep1	2.08e-02	8.43e-06	NA	NA
5. P	Q9XX15	Ribosomal RNA small subunit methyltransferase nep-1	2.11e-02	2.59e-03	NA	NA
5. P	A3D5L9	Putative pseudouridine methyltransferase	6.79e-03	3.87e-02	NA	NA
5. P	A2STS4	tRNA (pseudouridine(54)-N(1))-methyltransferase	1.70e-02	4.83e-02	NA	NA
5. P	B6YVU7	tRNA (pseudouridine(54)-N(1))-methyltransferase	6.34e-03	9.99e-04	NA	NA
5. P	Q9V0N8	tRNA (pseudouridine(54)-N(1))-methyltransferase	7.88e-03	6.16e-03	NA	NA
5. P	Q06287	Ribosomal RNA small subunit methyltransferase NEP1	1.47e-02	1.64e-05	NA	NA
5. P	Q57977	Ribosomal RNA small subunit methyltransferase Nep1	3.64e-02	2.27e-03	NA	NA
5. P	B8E744	Putative pseudouridine methyltransferase	5.59e-03	3.87e-02	NA	NA
5. P	A3DNG9	Ribosomal RNA small subunit methyltransferase Nep1	2.20e-02	3.81e-04	NA	NA
5. P	Q97WJ0	Ribosomal RNA small subunit methyltransferase Nep1	1.84e-02	9.39e-04	NA	NA
5. P	Q12XH2	tRNA (pseudouridine(54)-N(1))-methyltransferase	4.18e-03	2.04e-02	NA	NA
5. P	A9L560	Putative pseudouridine methyltransferase	6.46e-03	3.87e-02	NA	NA
5. P	Q979E4	Ribosomal RNA small subunit methyltransferase Nep1	1.27e-02	7.20e-03	NA	NA
5. P	Q96YP4	Ribosomal RNA small subunit methyltransferase Nep1	1.40e-02	1.91e-06	NA	NA
5. P	Q9W4J5	Ribosomal RNA small subunit methyltransferase NEP1	4.69e-02	4.31e-03	NA	NA
5. P	Q9YES9	Ribosomal RNA small subunit methyltransferase Nep1	2.90e-02	1.06e-03	NA	NA
5. P	C6A116	Ribosomal RNA small subunit methyltransferase Nep1	2.06e-02	4.53e-03	NA	NA
5. P	Q9HJ48	Ribosomal RNA small subunit methyltransferase Nep1	1.45e-02	1.24e-02	NA	NA
5. P	Q9ZDZ5	Ribosomal RNA small subunit methyltransferase E	3.77e-03	4.17e-02	NA	NA
5. P	Q0VNR6	Putative pseudouridine methyltransferase	9.25e-03	2.22e-02	NA	NA
5. P	Q8U1E6	Ribosomal RNA small subunit methyltransferase Nep1	2.01e-02	1.13e-05	NA	NA
5. P	B1YD95	Ribosomal RNA small subunit methyltransferase Nep1	2.67e-02	1.48e-05	NA	NA
5. P	P9WGX1	Ribosomal RNA small subunit methyltransferase E	3.16e-03	7.00e-03	NA	NA
5. P	Q96UP2	Ribosomal RNA small subunit methyltransferase NEP1	2.38e-02	4.14e-07	NA	NA
5. P	O50087	Ribosomal RNA small subunit methyltransferase Nep1	2.14e-02	5.23e-07	NA	NA
5. P	A6WPD0	Putative pseudouridine methyltransferase	5.34e-03	4.25e-02	NA	NA
6. F	Q0TEV3	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.99e-09	NA	NA	0.6251
6. F	Q0W8P0	tRNA (cytidine(56)-2'-O)-methyltransferase	1.84e-07	NA	NA	0.559
6. F	A8AD50	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.74e-09	NA	NA	0.6247
6. F	P69001	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	5.86e-12	NA	NA	0.8337
6. F	Q1C5G8	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.53e-09	NA	NA	0.6429
6. F	Q2NF55	tRNA (cytidine(56)-2'-O)-methyltransferase	7.94e-08	NA	NA	0.6759
6. F	A1JKQ0	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.40e-09	NA	NA	0.6411
6. F	C7BSD3	tRNA (cytidine(34)-2'-O)-methyltransferase	1.09e-08	NA	NA	0.7271
6. F	Q5PNG3	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	4.98e-09	NA	NA	0.6266
6. F	P32813	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	3.68e-10	NA	NA	0.8053
6. F	P72667	Ribosomal RNA small subunit methyltransferase E	3.98e-03	NA	NA	0.5311
6. F	Q2NS29	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.64e-09	NA	NA	0.6543
6. F	Q6D257	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	8.22e-10	NA	NA	0.6632
6. F	C6X9I5	tRNA (cytidine(34)-2'-O)-methyltransferase	1.64e-10	NA	NA	0.7834
6. F	A9A624	tRNA (cytidine(56)-2'-O)-methyltransferase	5.20e-07	NA	NA	0.5555
6. F	A2RKW7	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	5.62e-10	NA	NA	0.8217
6. F	A1WBM9	tRNA (cytidine(34)-2'-O)-methyltransferase	4.08e-10	NA	NA	0.7598
6. F	A3NR15	tRNA (cytidine(34)-2'-O)-methyltransferase	1.41e-08	NA	NA	0.7714
6. F	Q8XA83	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.16e-09	NA	NA	0.626
6. F	A2SQM4	tRNA (cytidine(56)-2'-O)-methyltransferase	1.86e-07	NA	NA	0.5637
6. F	A0B9Q9	tRNA (cytidine(56)-2'-O)-methyltransferase	1.44e-07	NA	NA	0.6526
6. F	B8CHC9	tRNA (cytidine(34)-2'-O)-methyltransferase	7.19e-10	NA	NA	0.7806
6. F	P44676	Uncharacterized tRNA/rRNA methyltransferase HI_0380	1.79e-09	NA	NA	0.6632
6. F	A7MGX5	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	2.13e-09	NA	NA	0.6258
6. F	Q8TX72	tRNA (cytidine(56)-2'-O)-methyltransferase	1.21e-07	NA	NA	0.6037
6. F	A1RY31	tRNA (cytidine(56)-2'-O)-methyltransferase	2.41e-07	NA	NA	0.6092
6. F	Q2FT21	tRNA (cytidine(56)-2'-O)-methyltransferase	1.10e-07	NA	NA	0.6173
6. F	Q7CJN8	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.47e-09	NA	NA	0.6543
6. F	Q32D32	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	5.63e-09	NA	NA	0.6257
6. F	A6TCF3	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.49e-09	NA	NA	0.6811
6. F	P66974	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.76e-09	NA	NA	0.6255
6. F	O27185	tRNA (cytidine(56)-2'-O)-methyltransferase	2.47e-07	NA	NA	0.651
6. F	P74516	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	7.21e-14	NA	NA	0.8587
6. F	A5ULQ9	tRNA (cytidine(56)-2'-O)-methyltransferase	2.12e-07	NA	NA	0.6503
6. F	Q31XV8	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.10e-09	NA	NA	0.626
6. F	Q721N0	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	9.61e-12	NA	NA	0.833
6. F	Q3YZ20	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	5.94e-09	NA	NA	0.626
6. F	P0AGJ6	Uncharacterized tRNA/rRNA methyltransferase YfiF	3.02e-12	NA	NA	0.7807
6. F	Q1R8K0	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.61e-09	NA	NA	0.6373
6. F	P0AE03	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	5.59e-09	NA	NA	0.6263
6. F	Q12E50	tRNA (cytidine(34)-2'-O)-methyltransferase	7.30e-09	NA	NA	0.7374
6. F	Q6LXC7	tRNA (cytidine(56)-2'-O)-methyltransferase	4.45e-07	NA	NA	0.6007
6. F	Q21LN7	tRNA (cytidine(34)-2'-O)-methyltransferase	8.79e-09	NA	NA	0.7322
6. F	Q9YAD3	tRNA (cytidine(56)-2'-O)-methyltransferase	1.49e-07	NA	NA	0.618
6. F	Q57LG7	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.83e-09	NA	NA	0.6246
6. F	P75257	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	5.80e-12	NA	NA	0.8287
6. F	A7I7T4	tRNA (cytidine(56)-2'-O)-methyltransferase	2.48e-07	NA	NA	0.6226
6. F	P0AE02	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	5.86e-09	NA	NA	0.6261
6. F	A0KAS4	tRNA (cytidine(34)-2'-O)-methyltransferase	6.26e-09	NA	NA	0.7721
6. F	P44868	tRNA (cytidine(34)-2'-O)-methyltransferase	1.67e-09	NA	NA	0.7877
6. F	Q7N222	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.31e-09	NA	NA	0.6793
6. F	D7A3L6	tRNA (cytidine(34)-2'-O)-methyltransferase	3.00e-15	NA	NA	0.8772
6. F	A4TMV6	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.40e-09	NA	NA	0.6522
6. F	Q48V41	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	2.68e-10	NA	NA	0.7871
6. F	A6UWW4	tRNA (cytidine(56)-2'-O)-methyltransferase	2.00e-07	NA	NA	0.5982
6. F	Q667X9	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.36e-09	NA	NA	0.6649
6. F	Q74Y93	tRNA (cytidine(34)-2'-O)-methyltransferase	1.51e-08	NA	NA	0.7459
6. F	A1AE69	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	6.51e-09	NA	NA	0.6256
6. F	Q042B4	Putative RNA (cytidine(34)-2'-O)-methyltransferase	5.99e-11	NA	NA	0.843
6. F	Q1CKB1	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.40e-09	NA	NA	0.6432
6. F	Q9YAD8	Uncharacterized protein APE_2001.1	2.03e-06	NA	NA	0.6711
6. F	P66975	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	1.51e-09	NA	NA	0.6253
6. F	P47588	Putative tRNA (cytidine(34)-2'-O)-methyltransferase	4.29e-11	NA	NA	0.7899
6. F	A0KEQ6	tRNA (cytidine(34)-2'-O)-methyltransferase	1.39e-09	NA	NA	0.8123
6. F	A3CVQ1	tRNA (cytidine(56)-2'-O)-methyltransferase	1.51e-07	NA	NA	0.5961
6. F	Q4JB16	tRNA (cytidine-2'-O-)-methyltransferase TrmJ	7.68e-09	NA	NA	0.6769
6. F	Q0T1Y7	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ	5.79e-09	NA	NA	0.6255
6. F	Q0BBL1	tRNA (cytidine(34)-2'-O)-methyltransferase	5.28e-09	NA	NA	0.7756
7. B	Q9VW14	rRNA methyltransferase 3, mitochondrial	1.22e-15	NA	6.37e-13	NA
7. B	P0AGJ8	tRNA (cytidine(34)-2'-O)-methyltransferase	9.22e-09	NA	0.048	NA
7. B	Q76NT0	rRNA methyltransferase 1, mitochondrial	2.17e-09	NA	1.69e-08	NA
7. B	P0AGJ2	tRNA (guanosine(18)-2'-O)-methyltransferase	5.12e-10	NA	1.38e-05	NA
7. B	Q13395	Probable methyltransferase TARBP1	1.09e-01	NA	2.35e-04	NA
7. B	P0AGJ7	tRNA (cytidine(34)-2'-O)-methyltransferase	9.22e-09	NA	0.048	NA