Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54811.1
JCVISYN3A_0453
DNA topoisomerase IV subunit A.
M. mycoides homolog: Q6MT97.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 73
Unique PROST Go: 5
Unique BLAST Go: 25
Unique Foldseek Go: 0
Total Homologs: 203
Unique PROST Homologs: 45
Unique BLAST Homologs: 20
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9Z8R4
(DNA gyrase subunit A) with a FATCAT P-Value: 0 and RMSD of 2.42 angstrom. The sequence alignment identity is 32.6%.
Structural alignment shown in left. Query protein AVX54811.1 colored as red in alignment, homolog Q9Z8R4 colored as blue.
Query protein AVX54811.1 is also shown in right top, homolog Q9Z8R4 showed in right bottom. They are colored based on secondary structures.
AVX54811.1 MSDKSEIILYP--LEELLGNRFSRYAKYIIQERALPDVRDGLKPVQRRILYAMNQLNLTFDKP---YKKSARVVGEVIGKYHPHGDSSIYDAMVRMSQWW 95 Q9Z8R4 MFNKDEIIV-PKNLEEEMKESYLRYSMSVIISRALPDIRDGLKPSQRRVLYAMKQLSLS---PGAKHRKCAKICGDTSGDYHPHGESVIYPTLVRMAQNW 96 AVX54811.1 KVNIPLVDMQGNNGSIDGDSAAAMRYTEARLTKISNLLLEDLEKNTVIFSPNFDDSETEPTVLPSYFPNILVNGATGIAAGYATNMPPHNLSEIIDASIS 195 Q9Z8R4 AMRYPLVDGQGNFGSIDGDPPAAMRYTEARLTHSAMYLMEDLDKDTVDIVPNYDETKHEPVVFPSKFPNLLCNGSSGIAVGMATNIPPHNLGELIEATLL 196 AVX54811.1 IIKNPNITIDQILKIVKGPDFPTGAIIQNKQGIREAFLTGKGKVIISSKWHQEKN------NIVVDEIPYEVVKQDLVKKIGDVIDNNPNL-GIKEIRDE 288 Q9Z8R4 LLANPQASVDEILQVMPGPDFPTGGIICGSEGIRSTYTTGRGKIKVRARLHVEENEDKHRESIIITEMPYNVNKSRLIEQIANLV-NEKTLAGISDVRDE 295 AVX54811.1 TDRKGLRIVIELNEKANLETVRKFLFKSTWLSVSYNYNNIIIVDKQ-PKQLGLIDIIKAYISHYKEVFIKRTEFNLNKANLRLEIVNGLIKALSILDEVI 387 Q9Z8R4 SDKDGIRVVLEIKKGESSEIIINRLYKFTDVQVTFG-ANMLALDKNLPRTMSIHRMISAWIRHRKEVIRRRTRYELNKAETRAHVLEGYLKALSCLDALV 394 AVX54811.1 KVIRKSENRIDAINNLVKTFNFTTNQSTAIVDMRLYRLTSTDVNKLLLEKTELIDKIKKYQEILNN-NLVLDNEII-SRLEEVKKQFGIKRKSQVE-DLV 484 Q9Z8R4 KTIRESGNKEHAKERIIESFGFTEPQALAILELRLYQLTGLEAEKIQKEYEELLNKIAYYKQVLSDEGLVKD--IIRNELQDLLKHHKVARRTTIEFD-A 491 AVX54811.1 EDL-DVDQKEVIIEKEINLWISKDGYIKVIDNNILNKNELSSFGKKPNDMWISQG------VCSNL--DHLILVSDQANYYSIPLYKIANSKWKDQG--V 573 Q9Z8R4 DDIRDIE--DIITNESVIITISGDDYVKRMPVKVFKEQRRGGHGVTGFDM--KKGAGFLKAVYSAFTKDYLLIFTNFGQCYWLKVWQLPEGERRAKGKPI 587 AVX54811.1 HINSVATTQPNE---TIINAFIIKEFINSTQHLLLVSKNGLIKRTQISDLETKIF-N---KSFKIMKISDDDSLVYA-DLISS--KTSYCCIITKNGYAV 663 Q9Z8R4 -INFLEGIRPGEELAAILN---IKNFDNA-GFLFLATKRGVVKK--VS-LDA--FSNPRKKGIRALEIDEGDELIAACHIVSDEEKV---MLFTHLGMAV 674 AVX54811.1 RYNIEDI-PVQSTISKGVKAANLK--DDYIISALSLDNNKDVLIFTNKNNYKR-L--D---QNLIPIYIRPKKGIR-ILV-EKKKNKEQVIFG-FAINDQ 751 Q9Z8R4 RFPHEKVRPMGRT-ARGVRGVSLKNEEDKVVSCQIVTENQSVLIVCDQGFGKRSLVEDFRETN------RGGVGVRSILINERNGN----VLGAIPVTDH 763 AVX54811.1 MSISILDTNDQITDINVSDLKHTNLEQNSIS-TNI---DEISYVSIKQLIRSIAFDQPALANNFNDQDTNDQIEAKPKFNKLVSERIVVSKDTKNKAINN 847 Q9Z8R4 DSILLMSSQGQAIRINMQDVRVMGRSTQGVRLVHLKEGDAL--VSMEKL-SSNENDDEVLSG--SEEECSDTVSLR------------------------ 834 AVX54811.1 ANQVHGSDLSSYLDDISSLLSKVSQNKKDKKTKQLDFEDYFSDDDQNQDDN 898 Q9Z8R4 --------------------------------------------------- 834
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006261 | DNA-dependent DNA replication |
| 1. PBF | GO:0003677 | DNA binding |
| 1. PBF | GO:0034335 | DNA negative supercoiling activity |
| 1. PBF | GO:0003918 | DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity |
| 1. PBF | GO:0019897 | extrinsic component of plasma membrane |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0005694 | chromosome |
| 1. PBF | GO:0046677 | response to antibiotic |
| 1. PBF | GO:0006265 | DNA topological change |
| 1. PBF | GO:0009340 | DNA topoisomerase IV complex |
| 1. PBF | GO:0007059 | chromosome segregation |
| 1. PBF | GO:0009330 | DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex |
| 2. PF | GO:0005737 | cytoplasm |
| 3. BF | GO:0034506 | chromosome, centromeric core domain |
| 3. BF | GO:0016539 | intein-mediated protein splicing |
| 3. BF | GO:0000793 | condensed chromosome |
| 3. BF | GO:0020023 | kinetoplast |
| 3. BF | GO:0000019 | regulation of mitotic recombination |
| 3. BF | GO:1905463 | negative regulation of DNA duplex unwinding |
| 3. BF | GO:1990904 | ribonucleoprotein complex |
| 3. BF | GO:0035327 | |
| 3. BF | GO:0006266 | DNA ligation |
| 3. BF | GO:0009303 | rRNA transcription |
| 3. BF | GO:0097046 | replication fork progression beyond termination site |
| 3. BF | GO:0003916 | DNA topoisomerase activity |
| 3. BF | GO:0045870 | positive regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. BF | GO:0000795 | synaptonemal complex |
| 3. BF | GO:0006271 | DNA strand elongation involved in DNA replication |
| 3. BF | GO:0008301 | DNA binding, bending |
| 3. BF | GO:0007076 | mitotic chromosome condensation |
| 3. BF | GO:0042752 | regulation of circadian rhythm |
| 3. BF | GO:0000819 | sister chromatid segregation |
| 3. BF | GO:0031055 | chromatin remodeling at centromere |
| 3. BF | GO:0000712 | resolution of meiotic recombination intermediates |
| 3. BF | GO:0030263 | apoptotic chromosome condensation |
| 3. BF | GO:0097047 | DNA replication termination region |
| 3. BF | GO:0048511 | rhythmic process |
| 3. BF | GO:0040016 | embryonic cleavage |
| 3. BF | GO:0004519 | endonuclease activity |
| 3. BF | GO:0006333 | chromatin assembly or disassembly |
| 3. BF | GO:0051306 | mitotic sister chromatid separation |
| 4. PB | GO:0030541 | plasmid partitioning |
| 5. P | GO:0008270 | zinc ion binding |
| 5. P | GO:0006419 | alanyl-tRNA aminoacylation |
| 5. P | GO:0004813 | alanine-tRNA ligase activity |
| 5. P | GO:0005634 | nucleus |
| 5. P | GO:0000049 | tRNA binding |
| 7. B | GO:0008094 | ATP-dependent activity, acting on DNA |
| 7. B | GO:0003682 | chromatin binding |
| 7. B | GO:0000228 | nuclear chromosome |
| 7. B | GO:0019899 | enzyme binding |
| 7. B | GO:0000182 | rDNA binding |
| 7. B | GO:0006974 | cellular response to DNA damage stimulus |
| 7. B | GO:0042826 | histone deacetylase binding |
| 7. B | GO:0043130 | ubiquitin binding |
| 7. B | GO:0046982 | protein heterodimerization activity |
| 7. B | GO:0043065 | positive regulation of apoptotic process |
| 7. B | GO:0071107 | response to parathyroid hormone |
| 7. B | GO:0007143 | female meiotic nuclear division |
| 7. B | GO:0021707 | cerebellar granule cell differentiation |
| 7. B | GO:0008623 | CHRAC |
| 7. B | GO:0000070 | mitotic sister chromatid segregation |
| 7. B | GO:0000775 | chromosome, centromeric region |
| 7. B | GO:0005080 | protein kinase C binding |
| 7. B | GO:0051309 | female meiosis chromosome separation |
| 7. B | GO:0007060 | male meiosis chromosome segregation |
| 7. B | GO:0003696 | satellite DNA binding |
| 7. B | GO:0005730 | nucleolus |
| 7. B | GO:0006314 | intron homing |
| 7. B | GO:0008022 | protein C-terminus binding |
| 7. B | GO:0002244 | hematopoietic progenitor cell differentiation |
| 7. B | GO:0030900 | forebrain development |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003677 | DNA binding |
| GO:0003918 | DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity |
| GO:0019897 | extrinsic component of plasma membrane |
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
| GO:0016853 | isomerase activity |
| GO:0005524 | ATP binding |
| GO:0005694 | chromosome |
| GO:0006265 | DNA topological change |
| GO:0006259 | DNA metabolic process |
| GO:0003916 | DNA topoisomerase activity |
| GO:0007059 | chromosome segregation |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P05653 | DNA gyrase subunit A | 0.00e+00 | 2.10e-41 | 1.54e-165 | 0.6539 |
| 1. PBF | Q92JH0 | DNA topoisomerase 4 subunit A | 0.00e+00 | 3.86e-37 | 1.31e-118 | 0.8043 |
| 1. PBF | Q5HK04 | DNA gyrase subunit A | 0.00e+00 | 3.11e-69 | 1.95e-163 | 0.6128 |
| 1. PBF | Q932M0 | DNA gyrase subunit A | 0.00e+00 | 1.21e-69 | 1.49e-153 | 0.6056 |
| 1. PBF | D8K235 | DNA gyrase subunit A | 0.00e+00 | 3.50e-45 | 4.16e-155 | 0.6833 |
| 1. PBF | Q1RID9 | DNA gyrase subunit A | 0.00e+00 | 2.20e-44 | 3.31e-136 | 0.5346 |
| 1. PBF | Q9PKK4 | DNA gyrase subunit A | 0.00e+00 | 3.70e-44 | 5.30e-170 | 0.6458 |
| 1. PBF | P47719 | DNA gyrase subunit A | 0.00e+00 | 2.52e-57 | 7.36e-136 | 0.6101 |
| 1. PBF | P72524 | DNA gyrase subunit A | 0.00e+00 | 3.42e-43 | 1.03e-169 | 0.6627 |
| 1. PBF | P0C1U9 | DNA topoisomerase 4 subunit A | 0.00e+00 | 5.83e-49 | 0.0 | 0.8305 |
| 1. PBF | Q8K9W2 | DNA gyrase subunit A | 0.00e+00 | 6.70e-42 | 8.72e-142 | 0.6212 |
| 1. PBF | Q6GKT9 | DNA gyrase subunit A | 0.00e+00 | 5.76e-70 | 4.94e-154 | 0.6098 |
| 1. PBF | Q9PR63 | DNA gyrase subunit A | 0.00e+00 | 6.89e-43 | 1.10e-147 | 0.6222 |
| 1. PBF | P43702 | DNA topoisomerase 4 subunit A | 0.00e+00 | 5.05e-33 | 1.44e-113 | 0.7179 |
| 1. PBF | Q931S2 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.68e-50 | 0.0 | 0.7931 |
| 1. PBF | Q9ZE79 | DNA topoisomerase 4 subunit A | 0.00e+00 | 3.61e-33 | 7.17e-107 | 0.8141 |
| 1. PBF | O51396 | DNA gyrase subunit A | 0.00e+00 | 3.80e-44 | 3.55e-146 | 0.5877 |
| 1. PBF | Q5HPI5 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.03e-50 | 0.0 | 0.6938 |
| 1. PBF | O33926 | DNA gyrase subunit A | 0.00e+00 | 1.00e-42 | 1.51e-156 | 0.6905 |
| 1. PBF | C1CVF4 | DNA gyrase subunit A | 0.00e+00 | 4.23e-39 | 2.34e-146 | 0.6602 |
| 1. PBF | Q5XCJ9 | DNA topoisomerase 4 subunit A | 0.00e+00 | 6.68e-61 | 0.0 | 0.7957 |
| 1. PBF | P48354 | DNA gyrase subunit A | 0.00e+00 | 1.09e-48 | 2.27e-137 | 0.6903 |
| 1. PBF | Q8P1B3 | DNA topoisomerase 4 subunit A | 0.00e+00 | 6.67e-60 | 0.0 | 0.8169 |
| 1. PBF | Q59556 | DNA gyrase subunit A | 0.00e+00 | 6.29e-51 | 1.16e-133 | 0.5848 |
| 1. PBF | P35885 | DNA gyrase subunit A | 0.00e+00 | 1.34e-55 | 1.93e-134 | 0.6612 |
| 1. PBF | Q5XC58 | DNA gyrase subunit A | 0.00e+00 | 1.09e-46 | 1.19e-162 | 0.6938 |
| 1. PBF | P47446 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.68e-50 | 4.63e-171 | 0.8634 |
| 1. PBF | Q5YLB5 | DNA gyrase subunit A, chloroplastic/mitochondrial | 0.00e+00 | 9.17e-19 | 6.09e-148 | 0.5817 |
| 1. PBF | P21557 | DNA gyrase subunit A | 0.00e+00 | 1.14e-54 | 2.83e-133 | 0.6133 |
| 1. PBF | P9WG46 | DNA gyrase subunit A | 0.00e+00 | 2.93e-49 | 2.24e-138 | 0.7361 |
| 1. PBF | Q9L7Q5 | DNA gyrase subunit A | 0.00e+00 | 1.00e-46 | 2.62e-162 | 0.6766 |
| 1. PBF | Q99XG5 | DNA gyrase subunit A | 0.00e+00 | 5.19e-71 | 8.61e-155 | 0.6018 |
| 1. PBF | O84192 | DNA gyrase subunit A | 0.00e+00 | 4.93e-50 | 3.79e-167 | 0.6024 |
| 1. PBF | P0AFI3 | DNA topoisomerase 4 subunit A | 0.00e+00 | 4.66e-40 | 3.84e-110 | 0.7175 |
| 1. PBF | Q9ZLD9 | DNA gyrase subunit A | 0.00e+00 | 1.57e-47 | 5.44e-161 | 0.6653 |
| 1. PBF | C5CHA8 | DNA gyrase subunit A | 0.00e+00 | 1.15e-46 | 5.39e-160 | 0.6965 |
| 1. PBF | P48369 | DNA gyrase subunit A | 0.00e+00 | 5.71e-56 | 1.64e-137 | 0.6002 |
| 1. PBF | P41513 | DNA gyrase subunit A | 0.00e+00 | 6.18e-48 | 2.08e-148 | 0.5818 |
| 1. PBF | Q0BST5 | DNA gyrase subunit A | 0.00e+00 | 1.85e-53 | 6.86e-140 | 0.6831 |
| 1. PBF | Q6GD84 | DNA gyrase subunit A | 0.00e+00 | 3.82e-71 | 4.44e-155 | 0.6159 |
| 1. PBF | P48371 | DNA gyrase subunit A | 0.00e+00 | 3.61e-51 | 2.04e-141 | 0.5579 |
| 1. PBF | P41080 | DNA gyrase subunit A | 0.00e+00 | 6.24e-45 | 1.43e-138 | 0.5776 |
| 1. PBF | Q2FKQ0 | DNA gyrase subunit A | 0.00e+00 | 1.64e-69 | 5.73e-153 | 0.6078 |
| 1. PBF | P0AFI4 | DNA topoisomerase 4 subunit A | 0.00e+00 | 4.66e-40 | 3.84e-110 | 0.7421 |
| 1. PBF | Q93KF4 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.95e-50 | 0.0 | 0.8416 |
| 1. PBF | Q8P116 | DNA gyrase subunit A | 0.00e+00 | 7.58e-47 | 1.85e-161 | 0.6885 |
| 1. PBF | P48372 | DNA gyrase subunit A | 0.00e+00 | 1.64e-51 | 1.40e-136 | 0.6413 |
| 1. PBF | Q5HG64 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.50e-50 | 0.0 | 0.8086 |
| 1. PBF | P94605 | DNA gyrase subunit A | 0.00e+00 | 7.49e-51 | 6.27e-161 | 0.6643 |
| 1. PBF | Q59749 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.94e-26 | 1.29e-108 | 0.7413 |
| 1. PBF | C0R046 | DNA gyrase subunit A | 0.00e+00 | 1.78e-28 | 1.34e-152 | 0.6743 |
| 1. PBF | P0DG03 | DNA gyrase subunit A | 0.00e+00 | 8.01e-47 | 1.17e-162 | 0.6805 |
| 1. PBF | Q68XG2 | DNA gyrase subunit A | 0.00e+00 | 1.13e-45 | 1.03e-140 | 0.6493 |
| 1. PBF | P57277 | DNA gyrase subunit A | 0.00e+00 | 1.24e-44 | 1.60e-149 | 0.6189 |
| 1. PBF | P26973 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.87e-40 | 5.20e-107 | 0.6703 |
| 1. PBF | Q9L7Q4 | DNA topoisomerase 4 subunit A | 0.00e+00 | 4.29e-61 | 0.0 | 0.8175 |
| 1. PBF | O50628 | DNA gyrase subunit A | 0.00e+00 | 5.44e-51 | 1.54e-166 | 0.6473 |
| 1. PBF | P14829 | DNA gyrase subunit A | 0.00e+00 | 5.07e-53 | 7.24e-142 | 0.5761 |
| 1. PBF | Q1RGX8 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.39e-36 | 2.43e-121 | 0.8104 |
| 1. PBF | Q6GH50 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.52e-49 | 0.0 | 0.807 |
| 1. PBF | B2S0D7 | DNA gyrase subunit A | 0.00e+00 | 1.53e-45 | 8.87e-146 | 0.5812 |
| 1. PBF | Q9Z8R4 | DNA gyrase subunit A | 0.00e+00 | 1.04e-45 | 4.62e-162 | 0.5664 |
| 1. PBF | Q8NWU8 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.84e-50 | 0.0 | 0.8247 |
| 1. PBF | A0QPN1 | Topoisomerase subunit TopoM | 0.00e+00 | 1.87e-24 | 1.15e-74 | 0.6373 |
| 1. PBF | P47235 | DNA gyrase subunit A | 0.00e+00 | 2.20e-47 | 9.43e-151 | 0.5781 |
| 1. PBF | P0DG07 | DNA topoisomerase 4 subunit A | 0.00e+00 | 6.26e-60 | 0.0 | 0.8271 |
| 1. PBF | P0AES5 | DNA gyrase subunit A | 0.00e+00 | 1.99e-48 | 1.33e-149 | 0.6961 |
| 1. PBF | Q1MQ89 | DNA gyrase subunit A | 0.00e+00 | 3.06e-44 | 1.66e-151 | 0.729 |
| 1. PBF | Q4UKM1 | DNA gyrase subunit A | 0.00e+00 | 8.60e-44 | 3.13e-141 | 0.5926 |
| 1. PBF | C5C7X9 | DNA gyrase subunit A | 0.00e+00 | 2.89e-45 | 1.59e-117 | 0.5835 |
| 1. PBF | Q4UNA0 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.37e-37 | 1.81e-119 | 0.8217 |
| 1. PBF | Q5SIL4 | DNA gyrase subunit A | 0.00e+00 | 5.43e-41 | 4.82e-156 | 0.6843 |
| 1. PBF | Q8CSN8 | DNA topoisomerase 4 subunit A | 0.00e+00 | 5.60e-51 | 0.0 | 0.8 |
| 1. PBF | P0C0R0 | DNA gyrase subunit A | 0.00e+00 | 1.72e-68 | 2.47e-163 | 0.6178 |
| 1. PBF | P37411 | DNA gyrase subunit A | 0.00e+00 | 8.41e-51 | 2.91e-146 | 0.5804 |
| 1. PBF | Q03470 | DNA gyrase subunit A | 0.00e+00 | 1.10e-52 | 1.32e-147 | 0.6024 |
| 1. PBF | P35810 | DNA gyrase subunit A | 0.00e+00 | 4.35e-58 | 2.14e-140 | 0.629 |
| 1. PBF | P48374 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.07e-31 | 2.86e-93 | 0.6786 |
| 1. PBF | Q45066 | DNA topoisomerase 4 subunit A | 0.00e+00 | 9.03e-50 | 0.0 | 0.8793 |
| 1. PBF | O83051 | DNA gyrase subunit A | 0.00e+00 | 5.56e-32 | 2.22e-150 | 0.7409 |
| 1. PBF | P20831 | DNA gyrase subunit A | 0.00e+00 | 1.52e-71 | 9.88e-155 | 0.611 |
| 1. PBF | D5ECW5 | DNA gyrase subunit A | 0.00e+00 | 1.16e-40 | 8.50e-162 | 0.6931 |
| 1. PBF | Q89AS3 | DNA gyrase subunit A | 0.00e+00 | 1.46e-44 | 4.95e-133 | 0.6325 |
| 1. PBF | Q5HJZ0 | DNA gyrase subunit A | 0.00e+00 | 3.34e-71 | 3.25e-154 | 0.6131 |
| 1. PBF | P0DG06 | DNA topoisomerase 4 subunit A | 0.00e+00 | 9.76e-61 | 0.0 | 0.819 |
| 1. PBF | P72525 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.33e-59 | 0.0 | 0.7911 |
| 1. PBF | Q9HUK1 | DNA topoisomerase 4 subunit A | 0.00e+00 | 4.31e-40 | 9.99e-106 | 0.7488 |
| 1. PBF | O51066 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.78e-11 | 2.56e-42 | 0.7873 |
| 1. PBF | P48370 | DNA gyrase subunit A | 0.00e+00 | 1.25e-47 | 1.07e-162 | 0.6522 |
| 1. PBF | Q8DPM2 | DNA gyrase subunit A | 0.00e+00 | 2.54e-43 | 1.40e-169 | 0.6519 |
| 1. PBF | P0DG02 | DNA gyrase subunit A | 0.00e+00 | 8.01e-47 | 1.17e-162 | 0.6981 |
| 1. PBF | B0S912 | DNA gyrase subunit A | 0.00e+00 | 1.56e-34 | 3.22e-164 | 0.6318 |
| 1. PBF | P22446 | DNA gyrase subunit A | 0.00e+00 | 1.15e-53 | 1.11e-145 | 0.6216 |
| 1. PBF | A1SCM2 | DNA gyrase subunit A | 0.00e+00 | 2.14e-53 | 2.80e-134 | 0.5849 |
| 1. PBF | P47250 | DNA gyrase subunit A | 0.00e+00 | 1.10e-52 | 9.90e-146 | 0.614 |
| 1. PBF | P43700 | DNA gyrase subunit A | 0.00e+00 | 6.01e-48 | 4.74e-133 | 0.6065 |
| 1. PBF | Q68XU1 | DNA topoisomerase 4 subunit A | 0.00e+00 | 9.45e-36 | 7.42e-111 | 0.8085 |
| 1. PBF | Q92IZ6 | DNA gyrase subunit A | 0.00e+00 | 2.07e-45 | 9.08e-144 | 0.6551 |
| 1. PBF | A0A0G2Q9F8 | DNA gyrase subunit A | 0.00e+00 | 2.85e-49 | 3.17e-138 | 0.6932 |
| 1. PBF | Q18GY3 | DNA gyrase subunit A | 0.00e+00 | 9.21e-49 | 3.29e-134 | 0.645 |
| 1. PBF | P75352 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.46e-47 | 3.03e-178 | 0.8121 |
| 1. PBF | O54478 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.71e-35 | 2.32e-117 | 0.7746 |
| 1. PBF | Q8NKW8 | DNA gyrase subunit A | 0.00e+00 | 3.82e-71 | 4.44e-155 | 0.606 |
| 1. PBF | P73077 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.39e-39 | 3.36e-111 | 0.5702 |
| 1. PBF | Q6G9K4 | DNA topoisomerase 4 subunit A | 0.00e+00 | 2.20e-51 | 0.0 | 0.7036 |
| 1. PBF | O67108 | Type 2 topoisomerase subunit A | 0.00e+00 | 2.73e-39 | 6.75e-159 | 0.6142 |
| 1. PBF | B3PN30 | DNA gyrase subunit A | 0.00e+00 | 1.37e-26 | 2.06e-162 | 0.6374 |
| 1. PBF | Q55738 | DNA gyrase subunit A | 0.00e+00 | 2.84e-47 | 5.31e-146 | 0.6105 |
| 3. BF | Q49608 | DNA gyrase subunit A (Fragment) | 2.98e-01 | NA | 2.83e-15 | 0.201 |
| 3. BF | Q64399 | DNA topoisomerase 2-beta | 3.15e-05 | NA | 2.91e-14 | 0.6827 |
| 3. BF | O93794 | DNA topoisomerase 2 | 3.52e-05 | NA | 3.24e-14 | 0.624 |
| 3. BF | P12531 | DNA topoisomerase 2 | 4.37e-07 | NA | 3.89e-11 | 0.7983 |
| 3. BF | P87078 | DNA topoisomerase 2 | 3.48e-07 | NA | 2.04e-13 | 0.6134 |
| 3. BF | P72065 | DNA gyrase subunit A (Fragment) | 4.17e-01 | NA | 1.90e-17 | 0.3884 |
| 3. BF | P41515 | DNA topoisomerase 2-alpha | 7.58e-05 | NA | 1.04e-13 | 0.7356 |
| 3. BF | O42131 | DNA topoisomerase 2-beta | 3.68e-07 | NA | 1.74e-15 | 0.7056 |
| 3. BF | Q49166 | DNA gyrase subunit A (Fragment) | 2.27e-01 | NA | 1.74e-16 | 0.2019 |
| 3. BF | O46374 | DNA topoisomerase 2-alpha | 3.72e-06 | NA | 1.26e-12 | 0.7115 |
| 3. BF | P27570 | DNA topoisomerase 2 | 2.48e-08 | NA | 1.94e-12 | 0.7962 |
| 3. BF | Q49467 | DNA gyrase subunit A (Fragment) | 1.35e-01 | NA | 1.48e-16 | 0.171 |
| 3. BF | Q9Y8G8 | DNA topoisomerase 2 | 3.01e-07 | NA | 3.74e-15 | 0.7214 |
| 3. BF | P30190 | DNA topoisomerase 2 | 6.03e-07 | NA | 7.31e-11 | 0.7921 |
| 3. BF | O16140 | DNA topoisomerase 2 | 6.25e-05 | NA | 2.59e-10 | 0.6662 |
| 3. BF | P0C0Q9 | DNA gyrase subunit A (Fragment) | 2.24e-04 | NA | 4.89e-30 | 0.9119 |
| 3. BF | P34030 | DNA gyrase subunit A (Fragment) | 0.00e+00 | NA | 9.63e-85 | 0.9886 |
| 3. BF | Q57532 | DNA gyrase subunit A | 6.64e-09 | NA | 7.09e-83 | 0.6791 |
| 3. BF | P41001 | DNA topoisomerase 2 | 2.25e-04 | NA | 2.08e-16 | 0.7424 |
| 3. BF | O24308 | DNA topoisomerase 2 | 1.66e-06 | NA | 7.75e-07 | 0.6898 |
| 3. BF | O68891 | DNA topoisomerase 4 subunit A (Fragment) | 2.56e-08 | NA | 9.72e-37 | 0.9666 |
| 3. BF | O42130 | DNA topoisomerase 2-alpha | 3.36e-06 | NA | 1.35e-12 | 0.7424 |
| 3. BF | Q01879 | DNA topoisomerase 2 | 3.04e-07 | NA | 2.12e-13 | 0.6359 |
| 4. PB | Q2G2Q0 | DNA gyrase subunit A | 0.00e+00 | 3.82e-71 | 4.44e-155 | NA |
| 4. PB | P0AFI2 | DNA topoisomerase 4 subunit A | 0.00e+00 | 4.66e-40 | 3.84e-110 | NA |
| 4. PB | Q2FYS4 | DNA topoisomerase 4 subunit A | 0.00e+00 | 1.50e-50 | 0.0 | NA |
| 4. PB | P0AES4 | DNA gyrase subunit A | 0.00e+00 | 1.99e-48 | 1.33e-149 | NA |
| 4. PB | Q9CAF6 | DNA gyrase subunit A, chloroplastic/mitochondrial | 0.00e+00 | 2.65e-17 | 3.88e-142 | NA |
| 4. PB | P9WG47 | DNA gyrase subunit A | 0.00e+00 | 1.85e-49 | 2.10e-138 | NA |
| 4. PB | Q7XZF7 | Probable DNA gyrase subunit A, chloroplastic/mitochondrial | 0.00e+00 | 2.03e-25 | 1.14e-142 | NA |
| 5. P | Q0AQY6 | Alanine--tRNA ligase | 4.40e-01 | 1.99e-02 | NA | NA |
| 5. P | A9WCR2 | Alanine--tRNA ligase | 4.87e-01 | 3.30e-02 | NA | NA |
| 5. P | A5UY81 | Alanine--tRNA ligase | 3.73e-01 | 4.03e-02 | NA | NA |
| 5. P | P27866 | Alanine--tRNA ligase | 3.26e-01 | 3.33e-02 | NA | NA |
| 5. P | A7IMR0 | Alanine--tRNA ligase | 2.95e-01 | 3.65e-02 | NA | NA |
| 5. P | Q48G25 | Alanine--tRNA ligase | 4.24e-01 | 3.40e-02 | NA | NA |
| 5. P | A0L3J9 | Alanine--tRNA ligase | 4.99e-01 | 2.05e-02 | NA | NA |
| 5. P | A4YXQ6 | Alanine--tRNA ligase | 2.47e-01 | 1.23e-02 | NA | NA |
| 5. P | Q98NQ5 | Alanine--tRNA ligase | 3.05e-01 | 7.76e-03 | NA | NA |
| 5. P | Q8UE87 | Alanine--tRNA ligase | 3.68e-01 | 6.15e-03 | NA | NA |
| 5. P | Q2ITM9 | Alanine--tRNA ligase | 2.94e-01 | 2.07e-02 | NA | NA |
| 5. P | Q3J0R1 | Alanine--tRNA ligase | 3.36e-01 | 4.87e-02 | NA | NA |
| 5. P | P67008 | Alanine--tRNA ligase | 3.07e-01 | 3.65e-03 | NA | NA |
| 5. P | B1M0N0 | Alanine--tRNA ligase | 3.04e-01 | 4.24e-02 | NA | NA |
| 5. P | Q13AB9 | Alanine--tRNA ligase | 2.75e-01 | 2.46e-02 | NA | NA |
| 5. P | P61706 | Alanine--tRNA ligase | 2.73e-01 | 4.50e-02 | NA | NA |
| 5. P | A7NQA5 | Alanine--tRNA ligase | 5.45e-01 | 6.91e-03 | NA | NA |
| 5. P | A5FXC2 | Alanine--tRNA ligase | 2.96e-01 | 2.62e-02 | NA | NA |
| 5. P | Q218Q3 | Alanine--tRNA ligase | 3.31e-01 | 6.02e-03 | NA | NA |
| 5. P | A5VQX4 | Alanine--tRNA ligase | 3.06e-01 | 2.94e-03 | NA | NA |
| 5. P | Q2N9K5 | Alanine--tRNA ligase | 3.36e-01 | 3.99e-02 | NA | NA |
| 5. P | Q57CU0 | Alanine--tRNA ligase | 3.08e-01 | 3.65e-03 | NA | NA |
| 5. P | A6X0E9 | Alanine--tRNA ligase | 3.10e-01 | 7.13e-03 | NA | NA |
| 5. P | Q1MFZ9 | Alanine--tRNA ligase | 6.11e-01 | 2.46e-02 | NA | NA |
| 5. P | Q56273 | Alanine--tRNA ligase | 3.80e-01 | 1.65e-02 | NA | NA |
| 5. P | Q2RQI0 | Alanine--tRNA ligase | 2.70e-01 | 2.03e-02 | NA | NA |
| 5. P | Q1QMV7 | Alanine--tRNA ligase | 2.80e-01 | 2.51e-02 | NA | NA |
| 5. P | Q2W1D9 | Alanine--tRNA ligase | 3.60e-01 | 2.54e-02 | NA | NA |
| 5. P | Q0BYM3 | Alanine--tRNA ligase | 4.15e-01 | 2.98e-02 | NA | NA |
| 5. P | A5N7T5 | Alanine--tRNA ligase | 3.85e-01 | 3.50e-02 | NA | NA |
| 5. P | Q07R87 | Alanine--tRNA ligase | 3.26e-01 | 1.05e-02 | NA | NA |
| 5. P | A6U9N4 | Alanine--tRNA ligase | 3.07e-01 | 2.56e-02 | NA | NA |
| 5. P | P67009 | Alanine--tRNA ligase | 3.07e-01 | 3.65e-03 | NA | NA |
| 5. P | P61701 | Alanine--tRNA ligase | 5.23e-01 | 2.41e-02 | NA | NA |
| 5. P | B0CGZ9 | Alanine--tRNA ligase | 3.31e-01 | 3.65e-03 | NA | NA |
| 5. P | A9FRF5 | Alanine--tRNA ligase | 4.27e-01 | 2.25e-02 | NA | NA |
| 5. P | A8ICW8 | Alanine--tRNA ligase | 3.87e-01 | 1.76e-02 | NA | NA |
| 5. P | Q0BSD5 | Alanine--tRNA ligase | 3.14e-01 | 9.17e-03 | NA | NA |
| 5. P | Q3ST43 | Alanine--tRNA ligase | 3.23e-01 | 1.80e-02 | NA | NA |
| 5. P | Q2YRU8 | Alanine--tRNA ligase | 3.79e-01 | 3.65e-03 | NA | NA |
| 5. P | A4WV47 | Alanine--tRNA ligase | 3.56e-01 | 4.54e-02 | NA | NA |
| 5. P | A9M5L7 | Alanine--tRNA ligase | 3.04e-01 | 3.65e-03 | NA | NA |
| 5. P | Q89I89 | Alanine--tRNA ligase | 3.20e-01 | 3.43e-02 | NA | NA |
| 5. P | A5EML9 | Alanine--tRNA ligase | 3.05e-01 | 1.36e-02 | NA | NA |
| 5. P | Q11IW3 | Alanine--tRNA ligase | 2.73e-01 | 3.87e-02 | NA | NA |
| 7. B | P34534 | Putative DNA topoisomerase 2, mitochondrial | 8.23e-12 | NA | 8.25e-13 | NA |
| 7. B | Q9QSK1 | DNA topoisomerase 2 | NA | NA | 1.19e-12 | NA |
| 7. B | P08096 | DNA topoisomerase 2 | 2.41e-04 | NA | 2.04e-11 | NA |
| 7. B | Q64511 | DNA topoisomerase 2-beta | 7.39e-06 | NA | 1.14e-14 | NA |
| 7. B | P07065 | DNA topoisomerase medium subunit | NA | NA | 2.12e-27 | NA |
| 7. B | P15348 | DNA topoisomerase 2 | 3.20e-06 | NA | 2.53e-10 | NA |
| 7. B | P41516 | DNA topoisomerase 2-alpha | 1.92e-07 | NA | 1.91e-13 | NA |
| 7. B | Q23670 | DNA topoisomerase 2 top-2 | 7.58e-06 | NA | 1.20e-12 | NA |
| 7. B | O33149 | DNA gyrase subunit A (Fragment) | 3.97e-01 | NA | 1.00e-09 | NA |
| 7. B | Q01320 | DNA topoisomerase 2-alpha | 4.65e-06 | NA | 1.55e-13 | NA |
| 7. B | P11388 | DNA topoisomerase 2-alpha | 8.30e-04 | NA | 2.95e-13 | NA |
| 7. B | O61078 | DNA topoisomerase 2 | NA | NA | 4.27e-12 | NA |
| 7. B | Q02880 | DNA topoisomerase 2-beta | 2.62e-07 | NA | 2.85e-14 | NA |
| 7. B | G5ECQ8 | DNA topoisomerase-like protein cin-4 | 2.07e-07 | NA | 7.15e-11 | NA |
| 7. B | P06786 | DNA topoisomerase 2 | 2.07e-07 | NA | 1.70e-14 | NA |
| 7. B | Q55BP5 | Probable DNA topoisomerase 2 | 1.15e-05 | NA | 2.77e-12 | NA |
| 7. B | Q5UQE6 | DNA topoisomerase 2 | NA | NA | 9.25e-12 | NA |
| 7. B | P30182 | DNA topoisomerase 2 | 5.34e-06 | NA | 8.06e-16 | NA |
| 7. B | Q196X4 | DNA topoisomerase 2 | NA | NA | 8.23e-08 | NA |
| 7. B | P90520 | DNA topoisomerase 2, mitochondrial | 2.83e-07 | NA | 2.31e-12 | NA |