Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54813.1
JCVISYN3A_0478
Uncharacterized protein.
M. mycoides homolog: Q6MT75.
TIGRfam Classification: 1=Unknown.
Category: Essential.
Statistics
Total GO Annotation: 102
Unique PROST Go: 102
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 131
Unique PROST Homologs: 131
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Literature
Danchin and Fang [1]: NA
Yang and Tsui [2]: Holliday junction ATP-dependent DNA helicase RuvA
Antczak et al. [3]: Transmembrane protein, likely a cation transporter from Major Facilitator Superfamily
Zhang et al. [4]: GO:0005886|plasma membrane
Bianchi et al. [5]: "Unclear, membrane ion transport?"
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
E7FDE0
(Transmembrane protein 138) with a FATCAT P-Value: 3.55e-10 and RMSD of 3.69 angstrom. The sequence alignment identity is 22.1%.
Structural alignment shown in left. Query protein AVX54813.1 colored as red in alignment, homolog E7FDE0 colored as blue.
Query protein AVX54813.1 is also shown in right top, homolog E7FDE0 showed in right bottom. They are colored based on secondary structures.
AVX54813.1 MENKINHKTYKSLKYLLTIS-SVILAICL-LLVFVQFTKAKPLFISLTPFISLLVILLILSFTCLLVYIIYRMKILKTSNYKYIKKEIIYLYTSFSLYIF 98 E7FDE0 --------------MLQTNNYSLVLLIQLALLTF-------DLFVN--SFSELLRSAPVIQ---LVLFIIQDIGIL--FNV------IIILLMMFNTYVF 66 AVX54813.1 SFILTVIYLIIALLIKNSESIRIM-----FYVVISIFFICIIL------SSIF---ETLSRL--KEQI--LLYKQQY-QSQQQLKLNKETDNKKQINKEV 179 E7FDE0 QVGL------VSLLL---ERFRAMLILSALYLTLSICFHCWVMNLRWMESNRFVWTDGLQVLFVFQRIAAVLYYYFYKRTTEYL-----GD--PRLYED- 149 AVX54813.1 TNNNNNQSKNPFIED------- 194 E7FDE0 ---------SPWLRDAFARARQ 162
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0044214 | spanning component of plasma membrane |
| 5. P | GO:0043020 | NADPH oxidase complex |
| 5. P | GO:0001938 | positive regulation of endothelial cell proliferation |
| 5. P | GO:0010923 | negative regulation of phosphatase activity |
| 5. P | GO:0001725 | stress fiber |
| 5. P | GO:1904385 | cellular response to angiotensin |
| 5. P | GO:0046530 | photoreceptor cell differentiation |
| 5. P | GO:0009055 | electron transfer activity |
| 5. P | GO:0015886 | heme transport |
| 5. P | GO:0001666 | response to hypoxia |
| 5. P | GO:0070821 | tertiary granule membrane |
| 5. P | GO:0045087 | innate immune response |
| 5. P | GO:0150007 | clathrin-dependent synaptic vesicle endocytosis |
| 5. P | GO:0033864 | positive regulation of NAD(P)H oxidase activity |
| 5. P | GO:0032760 | positive regulation of tumor necrosis factor production |
| 5. P | GO:0035212 | cell competition in a multicellular organism |
| 5. P | GO:1905702 | regulation of inhibitory synapse assembly |
| 5. P | GO:0014895 | smooth muscle hypertrophy |
| 5. P | GO:0005774 | vacuolar membrane |
| 5. P | GO:0060271 | cilium assembly |
| 5. P | GO:0071333 | cellular response to glucose stimulus |
| 5. P | GO:0048488 | synaptic vesicle endocytosis |
| 5. P | GO:1904845 | cellular response to L-glutamine |
| 5. P | GO:0032930 | positive regulation of superoxide anion generation |
| 5. P | GO:0005765 | lysosomal membrane |
| 5. P | GO:0048499 | synaptic vesicle membrane organization |
| 5. P | GO:0005262 | calcium channel activity |
| 5. P | GO:0045777 | positive regulation of blood pressure |
| 5. P | GO:0071310 | cellular response to organic substance |
| 5. P | GO:0030137 | COPI-coated vesicle |
| 5. P | GO:0005925 | focal adhesion |
| 5. P | GO:0006801 | superoxide metabolic process |
| 5. P | GO:0031594 | neuromuscular junction |
| 5. P | GO:0042802 | identical protein binding |
| 5. P | GO:0005794 | Golgi apparatus |
| 5. P | GO:0070555 | response to interleukin-1 |
| 5. P | GO:0016192 | vesicle-mediated transport |
| 5. P | GO:0042543 | protein N-linked glycosylation via arginine |
| 5. P | GO:0032755 | positive regulation of interleukin-6 production |
| 5. P | GO:0070257 | positive regulation of mucus secretion |
| 5. P | GO:0005783 | endoplasmic reticulum |
| 5. P | GO:0031667 | response to nutrient levels |
| 5. P | GO:0009808 | lignin metabolic process |
| 5. P | GO:0048038 | quinone binding |
| 5. P | GO:0017124 | SH3 domain binding |
| 5. P | GO:0043525 | positive regulation of neuron apoptotic process |
| 5. P | GO:0072593 | reactive oxygen species metabolic process |
| 5. P | GO:0017004 | cytochrome complex assembly |
| 5. P | GO:0034137 | positive regulation of toll-like receptor 2 signaling pathway |
| 5. P | GO:0050766 | positive regulation of phagocytosis |
| 5. P | GO:1900426 | positive regulation of defense response to bacterium |
| 5. P | GO:0050665 | hydrogen peroxide biosynthetic process |
| 5. P | GO:0070916 | inositol phosphoceramide synthase complex |
| 5. P | GO:0042554 | superoxide anion generation |
| 5. P | GO:0048661 | positive regulation of smooth muscle cell proliferation |
| 5. P | GO:0003106 | negative regulation of glomerular filtration by angiotensin |
| 5. P | GO:2000009 | negative regulation of protein localization to cell surface |
| 5. P | GO:0097112 | gamma-aminobutyric acid receptor clustering |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0007605 | sensory perception of sound |
| 5. P | GO:0016175 | superoxide-generating NAD(P)H oxidase activity |
| 5. P | GO:0097038 | perinuclear endoplasmic reticulum |
| 5. P | GO:0046982 | protein heterodimerization activity |
| 5. P | GO:0050811 | GABA receptor binding |
| 5. P | GO:0006624 | vacuolar protein processing |
| 5. P | GO:0030307 | positive regulation of cell growth |
| 5. P | GO:1904044 | response to aldosterone |
| 5. P | GO:0002080 | acrosomal membrane |
| 5. P | GO:0005768 | endosome |
| 5. P | GO:0015232 | heme transmembrane transporter activity |
| 5. P | GO:0071260 | cellular response to mechanical stimulus |
| 5. P | GO:0070917 | inositol phosphoceramide synthase regulator activity |
| 5. P | GO:0014823 | response to activity |
| 5. P | GO:0051279 | regulation of release of sequestered calcium ion into cytosol |
| 5. P | GO:0006673 | inositol phosphoceramide metabolic process |
| 5. P | GO:0030672 | synaptic vesicle membrane |
| 5. P | GO:0030285 | integral component of synaptic vesicle membrane |
| 5. P | GO:0005929 | cilium |
| 5. P | GO:0045055 | regulated exocytosis |
| 5. P | GO:0030425 | dendrite |
| 5. P | GO:0071356 | cellular response to tumor necrosis factor |
| 5. P | GO:0090114 | COPII-coated vesicle budding |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0034067 | protein localization to Golgi apparatus |
| 5. P | GO:0005773 | vacuole |
| 5. P | GO:0008137 | NADH dehydrogenase (ubiquinone) activity |
| 5. P | GO:0006865 | amino acid transport |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0071480 | cellular response to gamma radiation |
| 5. P | GO:1903428 | positive regulation of reactive oxygen species biosynthetic process |
| 5. P | GO:0004945 | angiotensin type II receptor activity |
| 5. P | GO:0042493 | |
| 5. P | GO:0099533 | positive regulation of presynaptic cytosolic calcium concentration |
| 5. P | GO:0071407 | cellular response to organic cyclic compound |
| 5. P | GO:0060077 | inhibitory synapse |
| 5. P | GO:0030173 | integral component of Golgi membrane |
| 5. P | GO:0006954 | inflammatory response |
| 5. P | GO:0045730 | respiratory burst |
| 5. P | GO:0032511 | late endosome to vacuole transport via multivesicular body sorting pathway |
| 5. P | GO:0150008 | bulk synaptic vesicle endocytosis |
| 5. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 5. P | GO:0020037 | heme binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | Q54T60 | Transmembrane protein 50 homolog | 4.02e-06 | 7.98e-05 | NA | NA |
| 5. P | Q1CHQ1 | NADH-quinone oxidoreductase subunit A | 7.74e-05 | 9.01e-04 | NA | NA |
| 5. P | Q5R703 | Synaptogyrin-1 | 9.67e-08 | 4.19e-02 | NA | NA |
| 5. P | P92536 | Uncharacterized mitochondrial protein AtMg01020 | 1.42e-04 | 7.96e-04 | NA | NA |
| 5. P | Q9N2H0 | Cytochrome b-245 light chain | 2.73e-03 | 2.14e-03 | NA | NA |
| 5. P | Q9P7H7 | Protein ilm1 | 3.20e-06 | 4.52e-06 | NA | NA |
| 5. P | D8ST13 | CASP-like protein 2U7 | 1.36e-08 | 2.39e-03 | NA | NA |
| 5. P | B2K821 | NADH-quinone oxidoreductase subunit A | 6.82e-05 | 8.27e-04 | NA | NA |
| 5. P | O64228 | Gene 34.1 protein | NA | 1.50e-03 | NA | NA |
| 5. P | P75083 | Uncharacterized protein MG028 homolog | 2.64e-07 | 5.40e-12 | NA | NA |
| 5. P | Q6L4D2 | Membrane protein PM19L | 8.68e-08 | 9.38e-05 | NA | NA |
| 5. P | O95214 | Leptin receptor overlapping transcript-like 1 | 4.28e-07 | 4.71e-02 | NA | NA |
| 5. P | P55909 | Uncharacterized protein YcgB | 3.53e-09 | 1.85e-03 | NA | NA |
| 5. P | B4MXW6 | Calcium channel flower | 7.05e-04 | 1.10e-03 | NA | NA |
| 5. P | Q920C4 | Membrane-spanning 4-domains subfamily A member 3 | 6.04e-07 | 5.51e-03 | NA | NA |
| 5. P | Q8IZ96 | CKLF-like MARVEL transmembrane domain-containing protein 1 | 4.93e-06 | 2.78e-03 | NA | NA |
| 5. P | P13498 | Cytochrome b-245 light chain | 4.83e-03 | 1.01e-02 | NA | NA |
| 5. P | B4GRI8 | Calcium channel flower | 6.24e-04 | 2.24e-03 | NA | NA |
| 5. P | A4IIU3 | Transmembrane protein 196 | 4.96e-09 | 7.42e-03 | NA | NA |
| 5. P | Q9Y826 | Meiotic expression up-regulated protein 31 | 2.71e-06 | 8.04e-03 | NA | NA |
| 5. P | Q62737 | Cytochrome b-245 light chain | 3.24e-03 | 6.07e-05 | NA | NA |
| 5. P | Q55827 | Uncharacterized protein sll0481 | 3.41e-06 | 2.10e-04 | NA | NA |
| 5. P | B3QY48 | NADH-quinone oxidoreductase subunit A 2 | 1.36e-04 | 3.84e-02 | NA | NA |
| 5. P | Q8CHQ6 | Transmembrane protein 125 | 1.95e-04 | 5.11e-05 | NA | NA |
| 5. P | Q9NPI0 | Transmembrane protein 138 | 3.90e-07 | 5.66e-07 | NA | NA |
| 5. P | Q63ZL3 | Heme transporter hrg1-A | 1.27e-06 | 1.90e-02 | NA | NA |
| 5. P | P75439 | Uncharacterized protein MG243 homolog | 5.60e-04 | 5.71e-03 | NA | NA |
| 5. P | P34282 | Uncharacterized protein C02F5.5 | 4.15e-05 | 6.68e-13 | NA | NA |
| 5. P | P0ADJ8 | Inner membrane protein YiaA | 2.87e-06 | 6.13e-08 | NA | NA |
| 5. P | P0ADJ9 | Inner membrane protein YiaA | 2.94e-06 | 6.13e-08 | NA | NA |
| 5. P | Q57769 | Uncharacterized protein MJ0321 | 4.11e-06 | 7.03e-04 | NA | NA |
| 5. P | Q55E69 | Protein SYS1 homolog | 7.19e-06 | 2.55e-02 | NA | NA |
| 5. P | A9R6M0 | NADH-quinone oxidoreductase subunit A | 7.58e-05 | 9.01e-04 | NA | NA |
| 5. P | Q32PD8 | Leptin receptor overlapping transcript-like 1 | 2.01e-07 | 2.50e-02 | NA | NA |
| 5. P | O31833 | Uncharacterized membrane protein YoaS | 2.24e-07 | 4.29e-02 | NA | NA |
| 5. P | O32202 | Protein LiaI | 1.57e-04 | 9.77e-05 | NA | NA |
| 5. P | Q295N5 | Protein KRTCAP2 homolog | 1.66e-05 | 1.68e-04 | NA | NA |
| 5. P | Q9D7S1 | Transmembrane protein 54 | 5.54e-06 | 7.38e-04 | NA | NA |
| 5. P | Q750M8 | Golgi apparatus membrane protein TVP18 | 2.75e-04 | 3.10e-02 | NA | NA |
| 5. P | O29727 | Uncharacterized protein AF_0523 | 1.63e-08 | 7.22e-08 | NA | NA |
| 5. P | P54946 | Uncharacterized protein YxeG | 3.70e-06 | 1.12e-06 | NA | NA |
| 5. P | Q04767 | Golgi apparatus membrane protein TVP18 | 2.12e-04 | 2.08e-05 | NA | NA |
| 5. P | Q2HJ59 | Transmembrane protein 125 | 1.66e-05 | 5.17e-04 | NA | NA |
| 5. P | Q66KF2 | Transmembrane protein 192 | 1.72e-09 | 6.25e-03 | NA | NA |
| 5. P | Q5J8X5 | Membrane-spanning 4-domains subfamily A member 13 | 5.08e-06 | 1.83e-03 | NA | NA |
| 5. P | B9GHX8 | CASP-like protein 2A2 | 3.36e-06 | 3.32e-05 | NA | NA |
| 5. P | B4LIH0 | Calcium channel flower | 7.30e-04 | 2.88e-03 | NA | NA |
| 5. P | Q9Z1L2 | Synaptogyrin-4 | 2.25e-06 | 8.49e-03 | NA | NA |
| 5. P | P9WLT4 | Uncharacterized protein MT1626 | 1.05e-04 | 1.68e-02 | NA | NA |
| 5. P | Q6GV27 | Transmembrane protein 225 | 1.98e-06 | 7.69e-03 | NA | NA |
| 5. P | P75213 | Uncharacterized protein MG384.1 homolog | 7.86e-06 | 1.79e-03 | NA | NA |
| 5. P | Q9D6G5 | Transmembrane protein 138 | 3.71e-07 | 1.17e-05 | NA | NA |
| 5. P | Q58404 | Uncharacterized protein MJ0998 | 1.31e-05 | 1.72e-02 | NA | NA |
| 5. P | B1WBM3 | Transmembrane protein 138 | 2.14e-06 | 5.83e-05 | NA | NA |
| 5. P | O46521 | Cytochrome b-245 light chain | 4.14e-03 | 8.41e-06 | NA | NA |
| 5. P | Q5RDE9 | Leptin receptor overlapping transcript-like 1 | 4.53e-07 | 4.71e-02 | NA | NA |
| 5. P | Q0WDX2 | NADH-quinone oxidoreductase subunit A | 6.99e-05 | 9.01e-04 | NA | NA |
| 5. P | Q54UB0 | Transmembrane protein 208 homolog | 3.69e-06 | 4.25e-05 | NA | NA |
| 5. P | Q8K071 | Transmembrane protein 221 | 7.22e-06 | 6.24e-06 | NA | NA |
| 5. P | Q5EB63 | Transmembrane protein 196 | 1.20e-07 | 8.59e-04 | NA | NA |
| 5. P | Q50325 | Uncharacterized protein MG406 homolog | 2.99e-05 | 2.51e-05 | NA | NA |
| 5. P | Q49431 | Uncharacterized protein MG406 | 1.30e-07 | 3.47e-04 | NA | NA |
| 5. P | C5Y7C7 | CASP-like protein 1U3 | 1.54e-05 | 1.85e-03 | NA | NA |
| 5. P | Q669A0 | NADH-quinone oxidoreductase subunit A | 7.38e-05 | 9.01e-04 | NA | NA |
| 5. P | Q2R0D2 | CASP-like protein 1U3 | 4.40e-06 | 4.01e-03 | NA | NA |
| 5. P | A7FGQ5 | NADH-quinone oxidoreductase subunit A | 7.04e-05 | 9.01e-04 | NA | NA |
| 5. P | B4PD01 | Calcium channel flower | 3.29e-04 | 3.53e-03 | NA | NA |
| 5. P | Q58514 | Uncharacterized protein MJ1114 | 6.28e-10 | 7.66e-07 | NA | NA |
| 5. P | Q5EAL6 | Transmembrane protein 192 | 2.60e-08 | 3.68e-02 | NA | NA |
| 5. P | P47485 | Uncharacterized protein MG243 | 5.13e-04 | 2.91e-03 | NA | NA |
| 5. P | P47155 | Protein ILM1 | 1.54e-04 | 3.46e-03 | NA | NA |
| 5. P | P47274 | Uncharacterized protein MG028 | 8.25e-07 | 5.47e-16 | NA | NA |
| 5. P | P34363 | Uncharacterized protein C48B4.9 | 3.65e-06 | 7.89e-04 | NA | NA |
| 5. P | O84009 | Uncharacterized protein CT_006 | 3.46e-04 | 7.38e-04 | NA | NA |
| 5. P | Q5HYL7 | Transmembrane protein 196 | 1.68e-08 | 5.26e-05 | NA | NA |
| 5. P | O14223 | Golgi apparatus membrane protein tvp15 | 4.87e-04 | 1.16e-05 | NA | NA |
| 5. P | A5PJY4 | Transmembrane protein 138 | 6.81e-10 | 3.12e-05 | NA | NA |
| 5. P | Q95T12 | Calcium channel flower | 3.85e-04 | 1.63e-02 | NA | NA |
| 5. P | Q7TSY2 | LHFPL tetraspan subfamily member 4 protein | 9.40e-07 | 3.30e-02 | NA | NA |
| 5. P | Q5U4E0 | LHFPL tetraspan subfamily member 4 protein | 4.98e-06 | 3.30e-02 | NA | NA |
| 5. P | O14193 | SRP-independent targeting protein 2 homolog | 2.15e-05 | 1.07e-03 | NA | NA |
| 5. P | Q92EU0 | Putative glycerol transporter Lin0368 | 6.95e-05 | 6.31e-03 | NA | NA |
| 5. P | B4HIJ8 | Calcium channel flower | 7.69e-04 | 1.91e-02 | NA | NA |
| 5. P | Q1E1E0 | Golgi apparatus membrane protein TVP18 | 6.27e-04 | 3.38e-02 | NA | NA |
| 5. P | B3NDM7 | Calcium channel flower | 4.88e-04 | 2.08e-03 | NA | NA |
| 5. P | O31923 | SPbeta prophage-derived uncharacterized protein YoqO | 3.12e-06 | 2.57e-02 | NA | NA |
| 5. P | Q61462 | Cytochrome b-245 light chain | 2.84e-03 | 3.68e-05 | NA | NA |
| 5. P | Q12346 | Uncharacterized membrane protein YPR071W | 4.67e-06 | 4.71e-02 | NA | NA |
| 5. P | A7TS55 | Golgi apparatus membrane protein TVP18 | 3.68e-04 | 2.90e-05 | NA | NA |
| 5. P | Q54GE8 | Putative uncharacterized transmembrane protein DDB_G0290203 | 7.12e-05 | 3.31e-06 | NA | NA |
| 5. P | Q95MN4 | Cytochrome b-245 light chain | 3.92e-03 | 1.95e-07 | NA | NA |
| 5. P | Q2GSS4 | Golgi apparatus membrane protein TVP18 | 9.94e-04 | 1.74e-02 | NA | NA |
| 5. P | Q54U35 | Uncharacterized transmembrane protein DDB_G0281339 | 1.55e-06 | 3.42e-06 | NA | NA |
| 5. P | Q5RCD5 | Transmembrane protein 196 | 2.98e-08 | 1.89e-04 | NA | NA |
| 5. P | O13994 | Inositol phosphorylceramide synthase regulatory subunit kei1 | 6.44e-06 | 1.14e-03 | NA | NA |
| 5. P | P0A5F4 | Uncharacterized protein Mb1617 | 5.23e-05 | 1.68e-02 | NA | NA |
| 5. P | P9WLT5 | Uncharacterized protein Rv1591 | 1.03e-04 | 1.68e-02 | NA | NA |
| 5. P | B4QLP9 | Calcium channel flower | 3.73e-04 | 2.42e-03 | NA | NA |
| 5. P | O95473 | Synaptogyrin-4 | 6.73e-07 | 3.30e-02 | NA | NA |
| 5. P | Q8INQ7 | Protein KRTCAP2 homolog | 1.84e-05 | 1.63e-04 | NA | NA |
| 5. P | Q5FWC3 | Membrane-spanning 4-domains subfamily A member 13 | 2.92e-08 | 1.11e-02 | NA | NA |
| 5. P | Q9Y876 | Secretory component protein psh3 | 1.27e-08 | 8.74e-10 | NA | NA |
| 5. P | P34395 | Uncharacterized protein F10E9.1 | 4.11e-06 | 9.67e-05 | NA | NA |
| 5. P | Q02774 | Secretory component protein SHR3 | 6.17e-10 | 1.80e-02 | NA | NA |
| 5. P | Q54L98 | Protein KRTCAP2 homolog | 6.84e-06 | 1.74e-05 | NA | NA |
| 5. P | Q197D8 | Transmembrane protein 022L | NA | 8.49e-03 | NA | NA |
| 5. P | B3M9W1 | Calcium channel flower | 7.45e-04 | 3.22e-05 | NA | NA |
| 5. P | Q96AQ2 | Transmembrane protein 125 | 2.68e-04 | 6.66e-03 | NA | NA |
| 5. P | A6ZMD0 | Golgi apparatus membrane protein TVP18 | 1.58e-04 | 2.08e-05 | NA | NA |
| 5. P | Q7YTM7 | Heme transporter hrg-6 | 7.15e-06 | 3.83e-03 | NA | NA |
| 5. P | Q74ZU2 | Golgi apparatus membrane protein TVP15 | 2.58e-05 | 2.14e-02 | NA | NA |
| 5. P | Q494T4 | Transmembrane protein 54 | 2.83e-06 | 7.22e-03 | NA | NA |
| 5. P | P33250 | ATP synthase protein I | 3.00e-07 | 2.50e-15 | NA | NA |
| 5. P | Q9ZB71 | Uncharacterized protein MG384.1 | 1.86e-06 | 3.69e-03 | NA | NA |
| 5. P | Q32KQ5 | Transmembrane protein 225 | 6.91e-06 | 3.31e-04 | NA | NA |
| 5. P | B1JGL3 | NADH-quinone oxidoreductase subunit A | 6.89e-05 | 9.01e-04 | NA | NA |
| 5. P | Q1C6A9 | NADH-quinone oxidoreductase subunit A | 7.59e-05 | 9.01e-04 | NA | NA |
| 5. P | E7FDE0 | Transmembrane protein 138 | 3.55e-10 | 3.62e-02 | NA | NA |
| 5. P | B4L0H1 | Calcium channel flower | 3.03e-04 | 2.40e-02 | NA | NA |
| 5. P | Q03860 | Golgi apparatus membrane protein TVP15 | 7.55e-04 | 1.37e-03 | NA | NA |
| 5. P | Q642A2 | Type-1 angiotensin II receptor-associated protein | 1.11e-03 | 2.20e-02 | NA | NA |
| 5. P | P11022 | Membrane protein P8A7 | 6.27e-04 | 4.12e-03 | NA | NA |
| 5. P | Q6GV28 | Transmembrane protein 225 | 3.77e-05 | 4.26e-02 | NA | NA |
| 5. P | O65708 | Protein MODIFYING WALL LIGNIN-2 | 8.36e-09 | 1.35e-07 | NA | NA |
| 5. P | A5DSM9 | Golgi apparatus membrane protein TVP18 | 8.68e-04 | 3.56e-02 | NA | NA |
| 5. P | A4TM36 | NADH-quinone oxidoreductase subunit A | 6.96e-05 | 9.01e-04 | NA | NA |
| 5. P | Q5ZHU0 | Heme transporter HRG1 | 8.45e-07 | 9.91e-04 | NA | NA |
| 5. P | P34360 | Uncharacterized protein C48B4.6 | 1.14e-06 | 1.05e-06 | NA | NA |
| 5. P | Q99382 | SRP-independent targeting protein 2 | 7.72e-05 | 1.17e-04 | NA | NA |
| 5. P | Q54CL4 | Protein transport protein got1 homolog | 3.56e-04 | 1.45e-03 | NA | NA |
| 5. P | Q95L73 | Cytochrome b-245 light chain | 2.56e-03 | 2.58e-06 | NA | NA |