Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54817.1
JCVISYN3A_0154

Uncharacterized peptidase.
M. mycoides homolog: Q6MU78.
TIGRfam Classification: 3=Putative.
Category: Quasiessential.

Statistics

Total GO Annotation: 21
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 3

Total Homologs: 509
Unique PROST Homologs: 0
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 5

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: Leucyl aminopeptidase
Zhang et al. [4]: GO:0004177|aminopeptidase activity
Bianchi et al. [5]: "Cytosol aminopeptidase (pepA-like?), Similar PDB: 1GYT (K)"

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A1WSK3 (Probable cytosol aminopeptidase) with a FATCAT P-Value: 0 and RMSD of 2.10 angstrom. The sequence alignment identity is 30.1%.
Structural alignment shown in left. Query protein AVX54817.1 colored as red in alignment, homolog A1WSK3 colored as blue. Query protein AVX54817.1 is also shown in right top, homolog A1WSK3 showed in right bottom. They are colored based on secondary structures. 

  AVX54817.1 MIKFND-K----------KEELTLVCLTEVNNKPYVSDADLSTTFISEDKTIYMVIKKDHKCLKT-KIRNAFK-KFVSTNKFN-INV-D-----VDSFLV 80
      A1WSK3 M-NF-DLKTLELAAAAAEKCDLLLVLIPE-GFTP-GQDA-LST--LAA-----LALKNGDLLLKAGKHLQLYQVPAVAARRVILLGVGDGTARAVRQALL 88

  AVX54817.1 FFDMCG-------------CKKDAI-EGIYESIAFETFDKVSY-KKDTKPNEVVYNL----ITSED---VKE-LEQKEAIKMEFVNFARMLQDTPPNIAT 157
      A1WSK3 AL---GAEIKKPQTKRLVLCFAAALKAGV-ASAAVQAVAEASYVYTTTKSKAEARSLSRCVLGVPDAAGARPGFDCGVAL-VAGVEFAREWSNRPANHAT 183

  AVX54817.1 SEYLAE--KVVQKAKEIEGLKVTVLNKKEATKLGMNLFLAVNAGSPYEP-QAVVLEY--VGDENEPKKALVGKGITFDSGGYNLKPSSAMEGMKFDMSGA 252
      A1WSK3 PSLLADAAKTLGRLPHIQ-CKVH--GPAQVRRLGMGAFVAVARGSE-QPLRFIELRYSAAAKDQAP-IVLVGKGITFDSGGISIKPAPEMDEMKFDMCGA 278

  AVX54817.1 AIMLSTVMALAKMKAKVNVVGIGMFTDNRI--GSTATLPQSVIKSMNGLTVEIDNTDAEGRLVLADGITYVIREKQATEIWEASTLTGAMVIALGSFATG 350
      A1WSK3 ASVLGVFRALGELQPAINVLGLIPACEN-LPDGR-AIKPGDVVTSMSGQTIEILNTDAEGRLILCDALTYAARFKPAAVI-DIATLTGACVVALAGVRSG 375

  AVX54817.1 VFTNCDKRWEL-IS--QASHKTSEKVWRMPIFDEHLEKVKADSVNADLTNAAKGREAGSSTAAAFLSAFAEEKPFVHFDIAGTADKAG--RGQ-----GV 440
      A1WSK3 LFANDD---DLAVSLYEAGEAALDPCWRMPLDDDYADGLKSHF--ADMGNTA-GRSGGAITAAKFLQKFVAGMRWAHLDIAGIAYKSGPAKGATGRPVGL 469

  AVX54817.1 LVRTLFEIFNK----------------------------------------- 451
      A1WSK3 LVHYL--LAQAEAMAQQAPVAPAAPAAPAAPAARPAAKRTGRSQGGLKRTAP 519

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0000976 transcription cis-regulatory region binding
1. PBF GO:0003677 DNA binding
1. PBF GO:0004180 carboxypeptidase activity
1. PBF GO:0071139 resolution of recombination intermediates
1. PBF GO:0005737 cytoplasm
1. PBF GO:0070006 metalloaminopeptidase activity
1. PBF GO:2000143 negative regulation of DNA-templated transcription, initiation
1. PBF GO:0030145 manganese ion binding
1. PBF GO:1903770 negative regulation of beta-galactosidase activity
4. PB GO:0004177 aminopeptidase activity
4. PB GO:0040009 regulation of growth rate
4. PB GO:0016805 dipeptidase activity
4. PB GO:0008233 peptidase activity
4. PB GO:0005886 plasma membrane
4. PB GO:0030496 midbody
4. PB GO:0005634 nucleus
4. PB GO:0001073 transcription antitermination factor activity, DNA binding
4. PB GO:0042150 plasmid recombination
6. F GO:0005829 cytosol
6. F GO:0008235 metalloexopeptidase activity
6. F GO:0046872 metal ion binding

Uniprot GO Annotations

GO Description
GO:0004177 aminopeptidase activity
GO:0008233 peptidase activity
GO:0005737 cytoplasm
GO:0070006 metalloaminopeptidase activity
GO:0016787 hydrolase activity
GO:0030145 manganese ion binding
GO:0019538 protein metabolic process
GO:0006508 proteolysis

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF B9DIX2 Probable cytosol aminopeptidase 0.00e+00 4.80e-58 1.21e-49 0.9186
1. PBF B7K4A4 Probable cytosol aminopeptidase 0.00e+00 9.06e-49 7.09e-44 0.8692
1. PBF A9IIK3 Probable cytosol aminopeptidase 0.00e+00 2.29e-49 1.22e-63 0.8982
1. PBF B7LKB6 Peptidase B 0.00e+00 2.93e-47 1.95e-32 0.8341
1. PBF Q8FNP8 Probable cytosol aminopeptidase 0.00e+00 8.47e-50 2.41e-37 0.8703
1. PBF A6U7J2 Probable cytosol aminopeptidase 0.00e+00 1.63e-54 1.09e-58 0.8734
1. PBF Q029J4 Probable cytosol aminopeptidase 0.00e+00 9.39e-62 2.87e-65 0.9023
1. PBF Q6N5B9 Probable cytosol aminopeptidase 0.00e+00 6.97e-51 1.77e-62 0.8829
1. PBF Q12QW7 Probable cytosol aminopeptidase 0.00e+00 2.57e-54 2.31e-68 0.8767
1. PBF B2JET5 Probable cytosol aminopeptidase 0.00e+00 7.81e-44 4.95e-69 0.88
1. PBF Q87S21 Peptidase B 0.00e+00 4.23e-49 7.43e-39 0.8413
1. PBF A5EIB4 Probable cytosol aminopeptidase 0.00e+00 1.28e-55 1.98e-59 0.8657
1. PBF Q8XWQ8 Probable cytosol aminopeptidase 0.00e+00 2.01e-44 1.54e-66 0.8791
1. PBF B1JRZ6 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8258
1. PBF B4E8G9 Probable cytosol aminopeptidase 0.00e+00 6.04e-49 2.42e-68 0.8819
1. PBF Q8K9I0 Probable cytosol aminopeptidase 0.00e+00 1.04e-54 8.30e-68 0.8858
1. PBF B5EKZ2 Probable cytosol aminopeptidase 0.00e+00 4.62e-46 9.98e-61 0.9072
1. PBF Q5HAP2 Probable cytosol aminopeptidase 0.00e+00 6.02e-53 1.76e-54 0.8794
1. PBF Q72YG1 Probable cytosol aminopeptidase 0.00e+00 2.39e-60 4.83e-77 0.9321
1. PBF B7HUR5 Probable cytosol aminopeptidase 0.00e+00 3.08e-60 2.60e-77 0.9256
1. PBF B7M9L9 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9001
1. PBF A7MU37 Peptidase B 0.00e+00 4.93e-49 2.58e-37 0.8205
1. PBF Q92QY7 Probable cytosol aminopeptidase 0.00e+00 2.41e-51 1.79e-58 0.8892
1. PBF B0JL23 Probable cytosol aminopeptidase 0.00e+00 1.59e-52 5.06e-45 0.8697
1. PBF Q0K7F5 Probable cytosol aminopeptidase 0.00e+00 2.24e-42 6.20e-68 0.8821
1. PBF B8D9F2 Probable cytosol aminopeptidase 0.00e+00 1.15e-55 1.92e-64 0.8964
1. PBF Q6LUW0 Probable cytosol aminopeptidase 0.00e+00 2.24e-52 3.27e-59 0.8973
1. PBF Q89MT4 Probable cytosol aminopeptidase 0.00e+00 6.86e-56 6.93e-60 0.8678
1. PBF B7JDH9 Probable cytosol aminopeptidase 0.00e+00 2.91e-60 2.54e-76 0.9247
1. PBF Q6MH10 Probable cytosol aminopeptidase 0.00e+00 5.07e-58 1.53e-76 0.905
1. PBF Q6DA52 Probable cytosol aminopeptidase 0.00e+00 9.42e-53 5.77e-62 0.8893
1. PBF Q9KTX5 Peptidase B 0.00e+00 4.12e-49 6.86e-37 0.8236
1. PBF B0CCF6 Probable cytosol aminopeptidase 0.00e+00 5.88e-49 2.48e-54 0.8889
1. PBF B7I309 Probable cytosol aminopeptidase 0.00e+00 2.03e-62 2.15e-63 0.8921
1. PBF Q2KA77 Probable cytosol aminopeptidase 0.00e+00 1.88e-58 7.53e-63 0.8799
1. PBF B6I595 Peptidase B 0.00e+00 2.61e-46 1.58e-32 0.8332
1. PBF A4VNZ7 Probable cytosol aminopeptidase 0.00e+00 2.60e-51 4.87e-66 0.8989
1. PBF C4ZRD1 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9049
1. PBF B3PUV3 Probable cytosol aminopeptidase 0.00e+00 2.49e-57 1.02e-63 0.87
1. PBF Q3KMX6 Probable cytosol aminopeptidase 0.00e+00 2.94e-55 1.34e-61 0.9091
1. PBF C5CCM4 Probable cytosol aminopeptidase 0.00e+00 4.40e-55 1.85e-32 0.8722
1. PBF Q1H4U4 Probable cytosol aminopeptidase 0.00e+00 2.12e-50 5.28e-71 0.898
1. PBF A3NSI1 Probable cytosol aminopeptidase 0.00e+00 1.18e-46 1.81e-69 0.8935
1. PBF C3LR42 Probable cytosol aminopeptidase 0.00e+00 2.37e-48 9.35e-68 0.89
1. PBF A1W776 Probable cytosol aminopeptidase 0.00e+00 2.16e-58 2.89e-63 0.8719
1. PBF A8FS02 Probable cytosol aminopeptidase 0.00e+00 1.63e-54 1.28e-67 0.8822
1. PBF A7GUC8 Probable cytosol aminopeptidase 0.00e+00 1.97e-60 1.36e-76 0.9198
1. PBF Q1B6R7 Probable cytosol aminopeptidase 0.00e+00 7.66e-52 4.18e-43 0.8787
1. PBF A4G7P5 Probable cytosol aminopeptidase 0.00e+00 9.44e-52 9.18e-64 0.8755
1. PBF C6DJN2 Probable cytosol aminopeptidase 0.00e+00 6.87e-53 7.74e-62 0.8886
1. PBF Q1I5F9 Probable cytosol aminopeptidase 0.00e+00 2.37e-46 3.75e-66 0.9099
1. PBF Q086N8 Probable cytosol aminopeptidase 0.00e+00 1.51e-54 2.10e-71 0.8701
1. PBF Q7NTY9 Probable cytosol aminopeptidase 0.00e+00 5.31e-48 2.34e-68 0.8769
1. PBF Q15PX4 Probable cytosol aminopeptidase 0.00e+00 1.20e-53 7.83e-66 0.8826
1. PBF B1JLS9 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8833
1. PBF B5BKS6 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8833
1. PBF Q9PH08 Probable cytosol aminopeptidase 0.00e+00 2.62e-48 1.10e-63 0.8972
1. PBF Q6AJZ3 Probable cytosol aminopeptidase 0.00e+00 1.34e-49 1.01e-55 0.899
1. PBF Q1MIZ4 Probable cytosol aminopeptidase 0.00e+00 2.42e-57 6.84e-63 0.8851
1. PBF A7FML9 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8828
1. PBF C5BMG6 Probable cytosol aminopeptidase 0.00e+00 3.01e-41 1.53e-67 0.9031
1. PBF Q9JTI8 Probable cytosol aminopeptidase 0.00e+00 3.28e-64 7.10e-59 0.8752
1. PBF B1ZAK8 Probable cytosol aminopeptidase 0.00e+00 1.51e-51 6.78e-59 0.8871
1. PBF B1LNH8 Peptidase B 0.00e+00 6.51e-47 1.64e-32 0.8331
1. PBF B7MYF7 Peptidase B 0.00e+00 2.14e-46 2.17e-32 0.8333
1. PBF B8HTK3 Probable cytosol aminopeptidase 0.00e+00 1.99e-53 1.45e-52 0.8588
1. PBF Q83P64 Probable cytosol aminopeptidase 0.00e+00 7.85e-56 6.03e-63 0.8829
1. PBF B1JBA9 Probable cytosol aminopeptidase 0.00e+00 1.34e-46 1.22e-68 0.8995
1. PBF B1XEN9 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8888
1. PBF A7FFX8 Peptidase B 0.00e+00 3.99e-52 1.83e-35 0.8106
1. PBF B6EMT2 Probable cytosol aminopeptidase 0.00e+00 1.40e-45 4.87e-62 0.8867
1. PBF Q0SHL0 Probable cytosol aminopeptidase 0.00e+00 2.74e-49 2.22e-42 0.8669
1. PBF B2FMS4 Probable cytosol aminopeptidase 0.00e+00 1.00e-48 1.22e-63 0.913
1. PBF A7MSE5 Probable cytosol aminopeptidase 0.00e+00 6.07e-50 3.06e-70 0.8847
1. PBF Q8YG99 Probable cytosol aminopeptidase 0.00e+00 2.39e-56 6.50e-62 0.8688
1. PBF Q7UJ62 Probable cytosol aminopeptidase 0.00e+00 7.52e-37 9.58e-53 0.878
1. PBF Q8RHT8 Probable cytosol aminopeptidase 0.00e+00 1.43e-67 1.44e-67 0.8878
1. PBF Q7V5X8 Probable cytosol aminopeptidase 0.00e+00 2.74e-51 8.29e-51 0.8774
1. PBF B0KQK8 Probable cytosol aminopeptidase 0.00e+00 7.57e-46 1.87e-66 0.8908
1. PBF Q887M0 Probable cytosol aminopeptidase 0.00e+00 1.03e-48 4.29e-64 0.9041
1. PBF A5CXK2 Probable cytosol aminopeptidase 0.00e+00 1.06e-66 2.06e-65 0.8993
1. PBF Q9RF52 Peptidase B 0.00e+00 7.59e-49 2.24e-31 0.8343
1. PBF C3PDF7 Probable cytosol aminopeptidase 0.00e+00 2.91e-60 2.54e-76 0.9249
1. PBF Q0SXK0 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8939
1. PBF A7Z8B5 Probable cytosol aminopeptidase 0.00e+00 8.97e-61 2.41e-69 0.9084
1. PBF A8LI79 Probable cytosol aminopeptidase 0.00e+00 4.31e-60 7.22e-57 0.8646
1. PBF B6I2H3 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9055
1. PBF B7H1P9 Probable cytosol aminopeptidase 0.00e+00 2.03e-62 2.15e-63 0.8916
1. PBF B5Z0Z6 Peptidase B 0.00e+00 7.57e-46 1.36e-31 0.8332
1. PBF Q8EI85 Probable cytosol aminopeptidase 1 0.00e+00 7.86e-54 2.26e-56 0.8706
1. PBF Q1RJN2 Probable cytosol aminopeptidase 0.00e+00 1.45e-53 2.49e-59 0.8937
1. PBF C5CLU5 Probable cytosol aminopeptidase 0.00e+00 4.31e-52 1.25e-61 0.8593
1. PBF A4TQP6 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8829
1. PBF P9WHT2 Probable cytosol aminopeptidase 0.00e+00 1.21e-43 5.09e-45 0.8883
1. PBF B7MSZ3 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8852
1. PBF A4ISE0 Probable cytosol aminopeptidase 0.00e+00 2.81e-50 5.90e-72 0.9153
1. PBF Q5YZ53 Probable cytosol aminopeptidase 0.00e+00 4.12e-49 1.35e-41 0.8587
1. PBF P57823 Probable cytosol aminopeptidase 0.00e+00 2.02e-54 2.79e-65 0.8927
1. PBF Q66F09 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8785
1. PBF Q17W06 Probable cytosol aminopeptidase 0.00e+00 3.68e-64 1.14e-44 0.876
1. PBF O25294 Cytosol aminopeptidase 0.00e+00 1.51e-63 2.98e-46 0.8766
1. PBF Q8Z116 Probable cytosol aminopeptidase 0.00e+00 1.18e-55 1.03e-61 0.893
1. PBF B7UGW9 Peptidase B 0.00e+00 2.14e-46 2.17e-32 0.8394
1. PBF Q11HH5 Probable cytosol aminopeptidase 0.00e+00 9.97e-59 8.82e-65 0.8806
1. PBF Q0AB75 Probable cytosol aminopeptidase 0.00e+00 9.76e-51 1.06e-65 0.9124
1. PBF Q8XHI3 Probable cytosol aminopeptidase 0.00e+00 1.96e-61 1.37e-71 0.9167
1. PBF C0QC86 Probable cytosol aminopeptidase 0.00e+00 9.72e-48 7.01e-61 0.8988
1. PBF Q5PJD4 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8928
1. PBF Q7WD42 Probable cytosol aminopeptidase 0.00e+00 8.36e-48 1.16e-63 0.9017
1. PBF B5Z6U1 Probable cytosol aminopeptidase 0.00e+00 1.13e-63 1.82e-46 0.8735
1. PBF B8J457 Probable cytosol aminopeptidase 0.00e+00 6.69e-53 2.07e-51 0.9007
1. PBF Q3YZ29 Peptidase B 0.00e+00 2.61e-46 1.58e-32 0.8343
1. PBF O32956 Probable cytosol aminopeptidase 0.00e+00 4.15e-42 5.44e-46 0.8765
1. PBF C1A138 Probable cytosol aminopeptidase 0.00e+00 1.91e-50 4.98e-42 0.8894
1. PBF B3QNM5 Probable cytosol aminopeptidase 0.00e+00 1.44e-50 5.90e-63 0.8904
1. PBF A3N6U4 Probable cytosol aminopeptidase 0.00e+00 1.18e-46 1.81e-69 0.8919
1. PBF Q1R2Z4 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9016
1. PBF B7UQR7 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8856
1. PBF A5UFE2 Probable cytosol aminopeptidase 0.00e+00 3.45e-55 2.73e-64 0.9086
1. PBF Q2T0C0 Probable cytosol aminopeptidase 0.00e+00 2.98e-48 5.22e-69 0.8887
1. PBF B6JLF2 Probable cytosol aminopeptidase 0.00e+00 3.90e-64 1.65e-46 0.8801
1. PBF B7NRH2 Peptidase B 0.00e+00 1.48e-46 1.95e-32 0.8333
1. PBF Q62LH2 Probable cytosol aminopeptidase 0.00e+00 1.43e-44 1.33e-69 0.8949
1. PBF C4ZX98 Peptidase B 0.00e+00 4.05e-47 1.63e-33 0.8423
1. PBF Q65FE6 Probable cytosol aminopeptidase 0.00e+00 4.11e-59 9.45e-71 0.9239
1. PBF A8AD60 Peptidase B 0.00e+00 9.69e-45 3.21e-33 0.8311
1. PBF Q67NI4 Probable cytosol aminopeptidase 0.00e+00 5.98e-66 5.08e-59 0.896
1. PBF Q87LG8 Probable cytosol aminopeptidase 0.00e+00 1.59e-50 1.97e-69 0.8856
1. PBF B7VJT3 Peptidase B 0.00e+00 2.40e-47 4.96e-35 0.8271
1. PBF Q893F8 Probable cytosol aminopeptidase 0.00e+00 2.29e-70 6.48e-65 0.908
1. PBF Q488M4 Probable cytosol aminopeptidase 0.00e+00 4.04e-54 1.48e-66 0.8804
1. PBF Q8G1M4 Probable cytosol aminopeptidase 0.00e+00 3.18e-54 3.24e-62 0.896
1. PBF A0RKB5 Probable cytosol aminopeptidase 0.00e+00 5.39e-60 2.46e-76 0.9306
1. PBF Q1QKW6 Probable cytosol aminopeptidase 0.00e+00 5.16e-55 6.42e-61 0.8779
1. PBF Q5H4N2 Probable cytosol aminopeptidase 0.00e+00 2.29e-51 6.67e-58 0.9037
1. PBF B2HGY2 Probable cytosol aminopeptidase 0.00e+00 3.86e-42 1.63e-45 0.879
1. PBF O84049 Probable cytosol aminopeptidase 0.00e+00 1.35e-55 7.46e-62 0.9169
1. PBF A0PTP9 Probable cytosol aminopeptidase 0.00e+00 2.13e-42 7.92e-46 0.8771
1. PBF B1YUW5 Probable cytosol aminopeptidase 0.00e+00 3.82e-50 2.20e-68 0.8843
1. PBF B7MI07 Peptidase B 0.00e+00 2.43e-46 2.11e-32 0.8331
1. PBF B7NGJ2 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9018
1. PBF P47707 Probable cytosol aminopeptidase 0.00e+00 2.22e-28 8.29e-93 0.9447
1. PBF B2K3E9 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8828
1. PBF Q5QY05 Probable cytosol aminopeptidase 0.00e+00 4.04e-54 3.87e-67 0.885
1. PBF Q0I816 Probable cytosol aminopeptidase 0.00e+00 4.18e-58 8.29e-53 0.8667
1. PBF A8A329 Peptidase B 0.00e+00 1.07e-46 1.80e-32 0.8333
1. PBF B5F1B3 Peptidase B 0.00e+00 7.59e-49 2.24e-31 0.8345
1. PBF Q4ZXH7 Probable cytosol aminopeptidase 0.00e+00 5.20e-50 9.26e-64 0.8938
1. PBF A6V0T2 Probable cytosol aminopeptidase 0.00e+00 1.54e-44 8.11e-65 0.8965
1. PBF B6JGL8 Probable cytosol aminopeptidase 0.00e+00 2.95e-53 8.57e-64 0.8718
1. PBF B5F9Q6 Probable cytosol aminopeptidase 0.00e+00 1.15e-49 4.03e-62 0.8958
1. PBF Q1QTE5 Probable cytosol aminopeptidase 0.00e+00 4.93e-49 2.46e-63 0.8991
1. PBF A4JGZ2 Probable cytosol aminopeptidase 0.00e+00 3.57e-47 4.80e-67 0.8911
1. PBF Q2P7G2 Probable cytosol aminopeptidase 0.00e+00 2.29e-51 6.67e-58 0.9058
1. PBF A8ML24 Probable cytosol aminopeptidase 0.00e+00 7.95e-48 6.94e-69 0.8916
1. PBF Q68XM6 Probable cytosol aminopeptidase 0.00e+00 5.49e-57 4.84e-56 0.8907
1. PBF B5RD05 Peptidase B 0.00e+00 4.93e-49 1.46e-31 0.8395
1. PBF Q7N231 Peptidase B 0.00e+00 2.60e-51 1.27e-36 0.8106
1. PBF A6TCE4 Peptidase B 0.00e+00 7.01e-48 1.33e-34 0.8295
1. PBF Q6HBY2 Probable cytosol aminopeptidase 0.00e+00 3.35e-60 3.08e-76 0.9241
1. PBF B1V932 Probable cytosol aminopeptidase 0.00e+00 1.28e-56 1.78e-64 0.8937
1. PBF A3Q1S2 Probable cytosol aminopeptidase 0.00e+00 3.32e-52 5.50e-43 0.8783
1. PBF A6X259 Probable cytosol aminopeptidase 0.00e+00 1.51e-52 1.13e-60 0.8919
1. PBF Q1IPU7 Probable cytosol aminopeptidase 0.00e+00 3.69e-44 4.19e-60 0.892
1. PBF Q8D295 Probable cytosol aminopeptidase 0.00e+00 4.74e-54 2.00e-60 0.8876
1. PBF Q319F5 Probable cytosol aminopeptidase 0.00e+00 1.15e-56 5.00e-53 0.8629
1. PBF P00727 Cytosol aminopeptidase 0.00e+00 3.22e-38 5.57e-62 0.8706
1. PBF Q7VEN5 Probable cytosol aminopeptidase 0.00e+00 8.60e-44 2.55e-45 0.8804
1. PBF B7KYK4 Probable cytosol aminopeptidase 0.00e+00 2.81e-50 2.62e-59 0.8879
1. PBF Q9Z8F8 Probable cytosol aminopeptidase 0.00e+00 4.05e-51 1.11e-57 0.8985
1. PBF Q0T1Z6 Peptidase B 0.00e+00 5.89e-47 1.40e-32 0.8335
1. PBF A1K9L5 Probable cytosol aminopeptidase 0.00e+00 3.50e-52 1.58e-62 0.8913
1. PBF C1EX85 Probable cytosol aminopeptidase 0.00e+00 5.39e-60 2.46e-76 0.9244
1. PBF B0VMG3 Probable cytosol aminopeptidase 0.00e+00 1.29e-62 4.05e-63 0.8927
1. PBF O86436 Cytosol aminopeptidase 0.00e+00 3.15e-45 3.87e-66 0.8932
1. PBF Q2JRU4 Probable cytosol aminopeptidase 0.00e+00 2.18e-45 2.56e-51 0.8685
1. PBF A9BBV5 Probable cytosol aminopeptidase 0.00e+00 2.57e-55 1.40e-50 0.8706
1. PBF Q9A7M9 Probable cytosol aminopeptidase 0.00e+00 7.85e-56 9.94e-58 0.8494
1. PBF Q3KHM4 Probable cytosol aminopeptidase 0.00e+00 7.34e-51 1.17e-67 0.8847
1. PBF B7LMT2 Probable cytosol aminopeptidase 0.00e+00 7.05e-56 4.63e-62 0.8927
1. PBF Q1CTV6 Probable cytosol aminopeptidase 0.00e+00 1.84e-63 4.43e-47 0.8787
1. PBF Q7MNF5 Peptidase B 0.00e+00 1.88e-45 8.15e-34 0.8269
1. PBF C1AUB5 Probable cytosol aminopeptidase 0.00e+00 5.18e-49 5.69e-43 0.8727
1. PBF Q7V0D4 Probable cytosol aminopeptidase 0.00e+00 4.94e-58 3.59e-50 0.8888
1. PBF Q81XS5 Probable cytosol aminopeptidase 0.00e+00 2.91e-60 2.54e-76 0.9214
1. PBF B2UTQ8 Probable cytosol aminopeptidase 0.00e+00 1.20e-63 2.07e-47 0.8765
1. PBF B7LDB5 Peptidase B 0.00e+00 2.61e-46 1.58e-32 0.8333
1. PBF Q6MC72 Probable cytosol aminopeptidase 0.00e+00 1.04e-57 1.49e-58 0.8937
1. PBF Q2SKR0 Probable cytosol aminopeptidase 0.00e+00 7.43e-53 7.72e-75 0.8952
1. PBF B2TXU8 Peptidase B 0.00e+00 7.38e-46 1.11e-31 0.8332
1. PBF Q57LH5 Peptidase B 0.00e+00 5.45e-49 8.09e-31 0.8345
1. PBF C3K6G5 Probable cytosol aminopeptidase 0.00e+00 1.61e-47 1.08e-68 0.8911
1. PBF A4WF25 Probable cytosol aminopeptidase 0.00e+00 1.46e-56 2.87e-61 0.8837
1. PBF A0RUA5 Probable cytosol aminopeptidase 0.00e+00 2.08e-60 1.28e-59 0.897
1. PBF C4LA51 Probable cytosol aminopeptidase 0.00e+00 4.40e-55 1.79e-71 0.8922
1. PBF A8F0Q0 Probable cytosol aminopeptidase 0.00e+00 1.69e-53 6.85e-58 0.8944
1. PBF A1UIA8 Probable cytosol aminopeptidase 0.00e+00 7.66e-52 4.18e-43 0.8708
1. PBF Q6AFG2 Probable cytosol aminopeptidase 0.00e+00 6.40e-59 6.76e-37 0.8686
1. PBF Q42876 Leucine aminopeptidase 2, chloroplastic 0.00e+00 1.49e-09 3.95e-43 0.8855
1. PBF A9AHG9 Probable cytosol aminopeptidase 0.00e+00 6.68e-49 4.73e-70 0.8894
1. PBF Q02RY8 Probable cytosol aminopeptidase 0.00e+00 2.01e-44 3.11e-65 0.896
1. PBF B3R663 Probable cytosol aminopeptidase 0.00e+00 8.84e-40 5.17e-68 0.8902
1. PBF Q21KZ5 Probable cytosol aminopeptidase 0.00e+00 1.54e-48 4.86e-71 0.8922
1. PBF A1BGN2 Probable cytosol aminopeptidase 0.00e+00 1.44e-50 2.39e-64 0.8969
1. PBF Q6NG90 Probable cytosol aminopeptidase 0.00e+00 5.03e-55 7.27e-48 0.866
1. PBF B2UAK8 Probable cytosol aminopeptidase 0.00e+00 1.66e-44 3.06e-65 0.9104
1. PBF B3R0N4 Probable cytosol aminopeptidase 0.00e+00 9.22e-57 1.51e-60 0.8881
1. PBF Q3JV16 Probable cytosol aminopeptidase 0.00e+00 1.44e-46 2.44e-69 0.8878
1. PBF B1XK83 Probable cytosol aminopeptidase 0.00e+00 4.73e-51 5.95e-51 0.8875
1. PBF B5Z3L7 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9068
1. PBF A5UBH1 Probable cytosol aminopeptidase 0.00e+00 4.89e-55 5.68e-65 0.9064
1. PBF B8GTX6 Probable cytosol aminopeptidase 0.00e+00 1.26e-50 9.89e-67 0.8893
1. PBF Q328S1 Probable cytosol aminopeptidase 0.00e+00 1.28e-55 2.77e-62 0.893
1. PBF B7M7M6 Peptidase B 0.00e+00 2.61e-46 1.58e-32 0.8335
1. PBF O32106 Probable cytosol aminopeptidase 0.00e+00 7.32e-60 3.44e-68 0.895
1. PBF Q5NXM1 Probable cytosol aminopeptidase 0.00e+00 1.82e-49 3.40e-66 0.8941
1. PBF B1LVC3 Probable cytosol aminopeptidase 0.00e+00 5.91e-50 8.99e-64 0.8832
1. PBF A9N680 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.893
1. PBF Q0VSA5 Probable cytosol aminopeptidase 0.00e+00 1.09e-54 3.86e-65 0.8572
1. PBF Q73YK2 Probable cytosol aminopeptidase 0.00e+00 3.61e-46 9.05e-44 0.8767
1. PBF P73971 Probable cytosol aminopeptidase 0.00e+00 7.63e-53 1.15e-44 0.8583
1. PBF C4K1N6 Probable cytosol aminopeptidase 0.00e+00 2.59e-53 1.90e-61 0.8984
1. PBF A1WUV1 Probable cytosol aminopeptidase 0.00e+00 3.11e-50 1.71e-63 0.8874
1. PBF C5D720 Probable cytosol aminopeptidase 0.00e+00 4.94e-58 9.71e-73 0.9289
1. PBF B5R9L5 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8927
1. PBF Q7VQT0 Probable cytosol aminopeptidase 0.00e+00 2.23e-51 3.72e-57 0.8866
1. PBF Q31ET3 Probable cytosol aminopeptidase 0.00e+00 6.52e-53 1.51e-66 0.8926
1. PBF Q667Y8 Peptidase B 0.00e+00 8.29e-52 1.44e-35 0.8084
1. PBF Q8ZBH3 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8793
1. PBF Q5WTG8 Probable cytosol aminopeptidase 0.00e+00 2.67e-61 5.30e-73 0.8834
1. PBF Q4QM33 Peptidase B 0.00e+00 1.14e-50 1.25e-32 0.8309
1. PBF Q0TEW2 Peptidase B 0.00e+00 2.14e-46 2.17e-32 0.8335
1. PBF B3QVE8 Probable cytosol aminopeptidase 0.00e+00 2.01e-50 3.75e-64 0.9095
1. PBF Q0I236 Probable cytosol aminopeptidase 0.00e+00 2.37e-54 4.51e-66 0.882
1. PBF Q9S2Q7 Probable cytosol aminopeptidase 0.00e+00 8.14e-47 7.14e-45 0.8346
1. PBF B4T3M4 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8829
1. PBF A9R5F5 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8841
1. PBF Q8EH62 Probable cytosol aminopeptidase 2 0.00e+00 4.89e-55 5.97e-69 0.8871
1. PBF Q7W5K6 Probable cytosol aminopeptidase 0.00e+00 8.57e-48 1.14e-63 0.9063
1. PBF Q65SA3 Probable cytosol aminopeptidase 0.00e+00 8.09e-58 6.90e-69 0.8803
1. PBF Q984S1 Probable cytosol aminopeptidase 0.00e+00 8.99e-47 4.44e-64 0.8864
1. PBF P68766 Cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9004
1. PBF Q0AIF5 Probable cytosol aminopeptidase 0.00e+00 3.49e-47 4.08e-64 0.9007
1. PBF B2T146 Probable cytosol aminopeptidase 0.00e+00 5.46e-47 1.62e-69 0.888
1. PBF B1XAZ8 Peptidase B 0.00e+00 4.05e-47 1.63e-33 0.8427
1. PBF A6VMX3 Probable cytosol aminopeptidase 0.00e+00 3.36e-58 4.06e-67 0.875
1. PBF P75206 Probable cytosol aminopeptidase 0.00e+00 2.10e-77 5.73e-91 0.9195
1. PBF Q46XT9 Probable cytosol aminopeptidase 0.00e+00 9.94e-44 1.17e-68 0.8835
1. PBF A3MLR1 Probable cytosol aminopeptidase 0.00e+00 1.43e-44 1.33e-69 0.8954
1. PBF Q87F32 Probable cytosol aminopeptidase 0.00e+00 3.29e-48 5.95e-64 0.9042
1. PBF Q8DI46 Probable cytosol aminopeptidase 0.00e+00 4.61e-51 1.86e-53 0.8615
1. PBF B7LCX0 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9017
1. PBF Q7U8Q1 Probable cytosol aminopeptidase 0.00e+00 5.38e-56 2.44e-50 0.8682
1. PBF Q2IX74 Probable cytosol aminopeptidase 0.00e+00 9.98e-54 4.11e-62 0.8714
1. PBF A5F5D8 Cytosol aminopeptidase 0.00e+00 2.37e-48 9.35e-68 0.8759
1. PBF B7IMU0 Probable cytosol aminopeptidase 0.00e+00 4.83e-61 1.16e-77 0.9301
1. PBF B2TYY4 Probable cytosol aminopeptidase 0.00e+00 4.28e-55 3.38e-62 0.8925
1. PBF B1VZN5 Probable cytosol aminopeptidase 0.00e+00 6.69e-46 1.34e-42 0.8304
1. PBF A1WSK3 Probable cytosol aminopeptidase 0.00e+00 1.31e-46 7.94e-54 0.8855
1. PBF Q3JEC8 Probable cytosol aminopeptidase 0.00e+00 3.54e-49 8.45e-67 0.8868
1. PBF Q1LTH8 Probable cytosol aminopeptidase 0.00e+00 1.54e-55 1.22e-59 0.8998
1. PBF Q5N569 Probable cytosol aminopeptidase 0.00e+00 3.45e-57 8.89e-39 0.8843
1. PBF Q72UC6 Probable cytosol aminopeptidase 0.00e+00 3.47e-64 4.31e-56 0.8917
1. PBF A8EXL1 Probable cytosol aminopeptidase 0.00e+00 5.99e-56 3.16e-62 0.9053
1. PBF Q8FF47 Peptidase B 0.00e+00 2.14e-46 2.17e-32 0.8403
1. PBF Q3M9J6 Probable cytosol aminopeptidase 0.00e+00 2.28e-58 9.57e-51 0.8725
1. PBF Q5E7T8 Probable cytosol aminopeptidase 0.00e+00 2.06e-51 3.71e-62 0.8961
1. PBF Q88P73 Probable cytosol aminopeptidase 0.00e+00 1.52e-46 6.69e-66 0.899
1. PBF C6DBI4 Peptidase B 0.00e+00 1.22e-54 8.07e-33 0.8213
1. PBF Q6FFD8 Probable cytosol aminopeptidase 0.00e+00 8.93e-65 9.92e-67 0.8836
1. PBF Q12AW5 Probable cytosol aminopeptidase 0.00e+00 1.36e-50 1.50e-64 0.8779
1. PBF C5BBY4 Probable cytosol aminopeptidase 0.00e+00 5.45e-55 9.70e-61 0.8843
1. PBF A4TMU7 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8258
1. PBF A4WDA4 Peptidase B 0.00e+00 2.09e-48 4.54e-35 0.8362
1. PBF Q9ZLR1 Cytosol aminopeptidase 0.00e+00 5.95e-63 2.28e-46 0.8756
1. PBF A3M1A8 Probable cytosol aminopeptidase 0.00e+00 2.03e-62 2.15e-63 0.8823
1. PBF B7MLR5 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8849
1. PBF Q1C3R8 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8884
1. PBF Q4UKD7 Probable cytosol aminopeptidase 0.00e+00 4.43e-52 7.01e-59 0.9041
1. PBF Q82X54 Probable cytosol aminopeptidase 0.00e+00 3.45e-50 1.19e-64 0.902
1. PBF B7UVT6 Probable cytosol aminopeptidase 0.00e+00 5.53e-45 1.74e-66 0.8886
1. PBF B4TG58 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.893
1. PBF Q8SQZ7 Cytosol aminopeptidase 0.00e+00 1.81e-60 8.28e-61 0.8566
1. PBF B4F2N1 Probable cytosol aminopeptidase 0.00e+00 1.63e-55 4.21e-62 0.8818
1. PBF Q92J85 Probable cytosol aminopeptidase 0.00e+00 2.21e-53 3.39e-61 0.8976
1. PBF A7ZVE0 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8853
1. PBF A9R811 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8106
1. PBF B9MJ44 Probable cytosol aminopeptidase 0.00e+00 6.32e-58 1.35e-63 0.8492
1. PBF Q8PCR4 Probable cytosol aminopeptidase 0.00e+00 2.94e-54 7.04e-58 0.9018
1. PBF Q74GB4 Probable cytosol aminopeptidase 0.00e+00 1.74e-44 8.31e-61 0.8964
1. PBF B5F465 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8931
1. PBF Q8ZK29 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8931
1. PBF B1YKV4 Probable cytosol aminopeptidase 0.00e+00 4.93e-57 6.54e-69 0.8986
1. PBF Q89AG2 Probable cytosol aminopeptidase 0.00e+00 2.67e-51 5.83e-63 0.8996
1. PBF Q31XW7 Peptidase B 0.00e+00 7.38e-46 1.11e-31 0.8331
1. PBF Q632E1 Probable cytosol aminopeptidase 0.00e+00 5.09e-60 1.25e-76 0.9243
1. PBF B0U1L5 Probable cytosol aminopeptidase 0.00e+00 1.03e-48 3.63e-64 0.8964
1. PBF P58473 Peptidase B 0.00e+00 7.57e-46 1.36e-31 0.8334
1. PBF A0KPF3 Probable cytosol aminopeptidase 0.00e+00 6.94e-55 7.74e-72 0.8951
1. PBF A7NG41 Probable cytosol aminopeptidase 0.00e+00 3.26e-61 1.12e-62 0.8952
1. PBF B9J3C5 Probable cytosol aminopeptidase 0.00e+00 7.32e-60 1.25e-76 0.9241
1. PBF A8GXC3 Probable cytosol aminopeptidase 0.00e+00 1.14e-53 2.52e-59 0.8991
1. PBF Q82AN2 Probable cytosol aminopeptidase 0.00e+00 1.34e-46 3.07e-46 0.8614
1. PBF A2SAC2 Probable cytosol aminopeptidase 0.00e+00 1.43e-44 1.33e-69 0.8983
1. PBF Q8F0Q1 Probable cytosol aminopeptidase 0.00e+00 2.32e-64 3.85e-56 0.8899
1. PBF A5G9C7 Probable cytosol aminopeptidase 0.00e+00 1.73e-47 1.30e-64 0.9112
1. PBF C3LC57 Probable cytosol aminopeptidase 0.00e+00 2.91e-60 2.54e-76 0.9255
1. PBF A6T0V4 Probable cytosol aminopeptidase 0.00e+00 1.17e-53 8.08e-62 0.8779
1. PBF B8F6N9 Probable cytosol aminopeptidase 0.00e+00 1.97e-52 1.87e-66 0.8995
1. PBF Q3SS04 Probable cytosol aminopeptidase 0.00e+00 3.36e-55 3.43e-64 0.8906
1. PBF Q63WC3 Probable cytosol aminopeptidase 0.00e+00 1.18e-46 1.81e-69 0.8953
1. PBF P27888 Cytosol aminopeptidase 0.00e+00 2.03e-56 1.22e-55 0.8934
1. PBF B4TTA0 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8873
1. PBF Q254B9 Probable cytosol aminopeptidase 0.00e+00 1.51e-54 6.97e-56 0.9045
1. PBF A1JJ31 Probable cytosol aminopeptidase 0.00e+00 3.27e-55 1.98e-63 0.888
1. PBF Q83I32 Probable cytosol aminopeptidase 0.00e+00 2.26e-61 1.50e-44 0.8591
1. PBF A6TWW9 Probable cytosol aminopeptidase 0.00e+00 8.36e-51 4.89e-61 0.8964
1. PBF B1WR01 Probable cytosol aminopeptidase 0.00e+00 2.54e-49 8.52e-45 0.8597
1. PBF A3QBG2 Probable cytosol aminopeptidase 0.00e+00 2.71e-55 1.53e-72 0.8852
1. PBF C0PYL4 Peptidase B 0.00e+00 7.59e-49 2.24e-31 0.8347
1. PBF C1F4B7 Probable cytosol aminopeptidase 0.00e+00 1.82e-35 1.04e-57 0.877
1. PBF Q8DCE5 Probable cytosol aminopeptidase 0.00e+00 2.07e-52 3.13e-71 0.8786
1. PBF A9N1Y3 Peptidase B 0.00e+00 7.59e-49 2.24e-31 0.8347
1. PBF A1KKQ5 Probable cytosol aminopeptidase 0.00e+00 8.60e-44 2.55e-45 0.8863
1. PBF Q816E3 Probable cytosol aminopeptidase 0.00e+00 2.91e-61 2.77e-77 0.9243
1. PBF B5ZWY7 Probable cytosol aminopeptidase 0.00e+00 2.11e-57 1.49e-61 0.8831
1. PBF B4SJ73 Probable cytosol aminopeptidase 0.00e+00 1.02e-47 2.34e-63 0.916
1. PBF B0RVI0 Probable cytosol aminopeptidase 0.00e+00 2.94e-54 7.04e-58 0.9015
1. PBF Q0SQ50 Probable cytosol aminopeptidase 0.00e+00 1.05e-61 1.23e-71 0.9156
1. PBF B0BB32 Probable cytosol aminopeptidase 0.00e+00 8.06e-56 1.34e-61 0.8948
1. PBF Q1CKA2 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8083
1. PBF A3N1A7 Probable cytosol aminopeptidase 0.00e+00 2.97e-51 1.82e-70 0.8891
1. PBF Q5L681 Probable cytosol aminopeptidase 0.00e+00 2.56e-52 3.97e-56 0.9147
1. PBF Q9PP04 Probable cytosol aminopeptidase 0.00e+00 7.04e-67 4.24e-44 0.8796
1. PBF P57448 Cytosol aminopeptidase 0.00e+00 2.19e-55 1.62e-64 0.9069
1. PBF Q2YB18 Probable cytosol aminopeptidase 0.00e+00 1.30e-50 9.59e-74 0.89
1. PBF A1VP99 Probable cytosol aminopeptidase 0.00e+00 4.69e-50 2.26e-62 0.8752
1. PBF Q21WL3 Probable cytosol aminopeptidase 0.00e+00 2.13e-61 1.42e-62 0.8674
1. PBF Q1C5H7 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8106
1. PBF B3ED46 Probable cytosol aminopeptidase 0.00e+00 6.35e-49 2.03e-65 0.8858
1. PBF Q3B4B5 Probable cytosol aminopeptidase 0.00e+00 2.28e-47 1.93e-55 0.8821
1. PBF Q83G32 Probable cytosol aminopeptidase 0.00e+00 2.26e-61 1.50e-44 0.859
1. PBF Q606B9 Probable cytosol aminopeptidase 0.00e+00 8.19e-49 1.85e-68 0.8955
1. PBF B8D7Q4 Probable cytosol aminopeptidase 0.00e+00 1.09e-55 9.41e-64 0.9091
1. PBF Q1R8K9 Peptidase B 0.00e+00 2.43e-46 2.11e-32 0.8332
1. PBF B7N6B0 Peptidase B 0.00e+00 1.99e-46 2.47e-32 0.8393
1. PBF A2BSQ4 Probable cytosol aminopeptidase 0.00e+00 1.74e-57 1.43e-50 0.8897
1. PBF A9MHK1 Peptidase B 0.00e+00 1.65e-47 1.27e-31 0.8408
1. PBF B5XNK4 Peptidase B 0.00e+00 2.04e-46 8.22e-36 0.8306
1. PBF Q1BUE7 Probable cytosol aminopeptidase 0.00e+00 1.80e-48 1.30e-67 0.8906
1. PBF B5FSH0 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8827
1. PBF Q7MHG4 Probable cytosol aminopeptidase 0.00e+00 2.07e-52 3.13e-71 0.8857
1. PBF B8CU18 Probable cytosol aminopeptidase 0.00e+00 2.31e-54 8.26e-70 0.8842
1. PBF B2I6L3 Probable cytosol aminopeptidase 0.00e+00 3.29e-48 5.95e-64 0.894
1. PBF Q3AZE8 Probable cytosol aminopeptidase 0.00e+00 9.22e-57 8.75e-47 0.8792
1. PBF B2I1U0 Probable cytosol aminopeptidase 0.00e+00 2.03e-62 2.15e-63 0.8928
1. PBF A1SRZ1 Probable cytosol aminopeptidase 0.00e+00 7.84e-50 1.69e-58 0.902
1. PBF A8FH04 Probable cytosol aminopeptidase 0.00e+00 1.18e-62 2.10e-71 0.9172
1. PBF Q39DS5 Probable cytosol aminopeptidase 0.00e+00 2.07e-49 2.96e-68 0.8876
1. PBF Q7M8W6 Probable cytosol aminopeptidase 0.00e+00 1.81e-62 6.08e-50 0.8874
1. PBF P58474 Putative peptidase B 0.00e+00 1.72e-51 1.32e-31 0.8274
1. PBF B5Y2T8 Probable cytosol aminopeptidase 0.00e+00 1.31e-55 2.57e-60 0.8927
1. PBF B0UVX4 Probable cytosol aminopeptidase 0.00e+00 3.27e-54 3.21e-65 0.8963
1. PBF C3PMI0 Probable cytosol aminopeptidase 0.00e+00 2.21e-53 3.39e-61 0.8876
1. PBF A6THI2 Probable cytosol aminopeptidase 0.00e+00 9.48e-56 4.25e-60 0.8929
1. PBF C1AQC8 Probable cytosol aminopeptidase 0.00e+00 8.60e-44 2.55e-45 0.8863
1. PBF A5VPM3 Probable cytosol aminopeptidase 0.00e+00 1.06e-54 3.01e-62 0.8976
1. PBF Q9CM16 Peptidase B 0.00e+00 1.49e-49 1.87e-30 0.8261
1. PBF P31427 Leucine aminopeptidase, chloroplastic 0.00e+00 1.27e-07 2.26e-39 0.8927
1. PBF B3GXY6 Probable cytosol aminopeptidase 0.00e+00 9.42e-53 6.11e-69 0.8913
1. PBF B0VDC8 Probable cytosol aminopeptidase 0.00e+00 2.03e-62 2.15e-63 0.8889
1. PBF A3PEG6 Probable cytosol aminopeptidase 0.00e+00 3.27e-57 2.63e-52 0.8925
1. PBF B1ISB1 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9035
1. PBF P45334 Cytosol aminopeptidase 0.00e+00 1.50e-55 8.61e-64 0.9124
1. PBF A8A816 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9046
1. PBF Q9Y935 Probable cytosol aminopeptidase 0.00e+00 2.28e-65 4.41e-53 0.8765
1. PBF Q83QK5 Peptidase B 0.00e+00 1.15e-46 1.42e-33 0.8335
1. PBF Q6A9W5 Probable cytosol aminopeptidase 0.00e+00 8.62e-43 3.70e-42 0.8769
1. PBF O06865 Probable cytosol aminopeptidase 0.00e+00 1.36e-57 7.24e-40 0.8794
1. PBF B7KCB0 Probable cytosol aminopeptidase 0.00e+00 7.73e-51 4.81e-45 0.8845
1. PBF P0C6E1 Cytosol aminopeptidase 0.00e+00 2.37e-48 9.35e-68 0.8778
1. PBF A2SH61 Probable cytosol aminopeptidase 0.00e+00 1.11e-53 3.13e-60 0.8738
1. PBF Q823J9 Probable cytosol aminopeptidase 0.00e+00 3.85e-58 3.55e-58 0.9192
1. PBF Q4QJN7 Probable cytosol aminopeptidase 0.00e+00 4.89e-55 5.68e-65 0.9094
1. PBF Q8UGC8 Probable cytosol aminopeptidase 0.00e+00 1.07e-52 1.41e-62 0.8666
1. PBF Q31TK2 Probable cytosol aminopeptidase 0.00e+00 4.64e-55 3.38e-62 0.8828
1. PBF Q5XGB9 Cytosol aminopeptidase 0.00e+00 6.39e-40 4.22e-63 0.8432
1. PBF Q5R7G6 Probable aminopeptidase NPEPL1 0.00e+00 4.01e-43 8.94e-38 0.8289
1. PBF Q5X1Q9 Probable cytosol aminopeptidase 0.00e+00 3.26e-61 2.29e-72 0.8988
1. PBF Q7VGF0 Probable cytosol aminopeptidase 0.00e+00 8.68e-65 5.31e-50 0.8778
1. PBF A0LK12 Probable cytosol aminopeptidase 0.00e+00 4.59e-47 2.68e-53 0.9
1. PBF Q8KD74 Probable cytosol aminopeptidase 0.00e+00 1.89e-48 1.78e-63 0.8771
1. PBF Q215R8 Probable cytosol aminopeptidase 0.00e+00 3.20e-53 2.73e-60 0.8772
1. PBF B7NUH4 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.907
1. PBF Q5FFZ5 Probable cytosol aminopeptidase 0.00e+00 1.36e-52 1.81e-54 0.8806
1. PBF Q8DEZ4 Peptidase B 0.00e+00 1.88e-45 8.15e-34 0.8272
1. PBF A4WRK9 Probable cytosol aminopeptidase 0.00e+00 2.73e-56 4.01e-60 0.8585
1. PBF Q5FU70 Probable cytosol aminopeptidase 0.00e+00 1.61e-57 7.18e-56 0.8748
1. PBF Q3YU89 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.8997
1. PBF A5GN62 Probable cytosol aminopeptidase 0.00e+00 2.00e-57 2.20e-52 0.885
1. PBF B9JCD8 Probable cytosol aminopeptidase 0.00e+00 9.73e-57 1.05e-59 0.8718
1. PBF Q2JKL5 Probable cytosol aminopeptidase 0.00e+00 1.04e-46 2.03e-48 0.8591
1. PBF O67868 Probable cytosol aminopeptidase 0.00e+00 1.15e-56 5.54e-58 0.8804
1. PBF B7J5I9 Probable cytosol aminopeptidase 0.00e+00 4.62e-46 9.98e-61 0.9021
1. PBF C3M9C8 Probable cytosol aminopeptidase 0.00e+00 1.47e-51 5.28e-59 0.8811
1. PBF B3Q9R8 Probable cytosol aminopeptidase 0.00e+00 6.29e-51 1.85e-62 0.8814
1. PBF Q73QZ3 Probable cytosol aminopeptidase 0.00e+00 5.99e-69 1.72e-57 0.8922
1. PBF B2V6F5 Probable cytosol aminopeptidase 0.00e+00 1.29e-51 4.40e-56 0.879
1. PBF B2K9R0 Peptidase B 0.00e+00 8.29e-52 1.44e-35 0.8087
1. PBF Q7MZ27 Probable cytosol aminopeptidase 0.00e+00 7.12e-55 2.58e-59 0.8822
1. PBF Q8Z4N3 Peptidase B 0.00e+00 4.23e-49 2.11e-31 0.8344
1. PBF O68822 Cytosol aminopeptidase 0.00e+00 5.53e-45 1.74e-66 0.9026
1. PBF Q10712 Leucine aminopeptidase 1, chloroplastic 0.00e+00 8.21e-08 1.40e-36 0.8773
1. PBF Q315M7 Probable cytosol aminopeptidase 0.00e+00 7.05e-56 2.01e-47 0.8776
1. PBF Q7VNH9 Probable cytosol aminopeptidase 0.00e+00 4.66e-52 4.60e-69 0.8894
1. PBF B7HBG1 Probable cytosol aminopeptidase 0.00e+00 8.24e-61 4.42e-76 0.9321
1. PBF A8G6E3 Probable cytosol aminopeptidase 0.00e+00 5.83e-56 3.79e-52 0.8582
1. PBF Q3A831 Probable cytosol aminopeptidase 0.00e+00 4.80e-49 7.03e-65 0.9041
1. PBF B0B9F3 Probable cytosol aminopeptidase 0.00e+00 8.06e-56 1.34e-61 0.893
1. PBF A5U4P1 Probable cytosol aminopeptidase 0.00e+00 1.21e-43 5.09e-45 0.8883
1. PBF A4SSA7 Probable cytosol aminopeptidase 0.00e+00 2.86e-55 2.24e-72 0.8951
1. PBF B0BWB2 Probable cytosol aminopeptidase 0.00e+00 2.71e-54 1.41e-62 0.9011
1. PBF Q47BG9 Probable cytosol aminopeptidase 0.00e+00 3.15e-52 4.14e-67 0.8989
1. PBF A7MGW9 Peptidase B 0.00e+00 2.96e-49 1.26e-40 0.8314
1. PBF A7IFB7 Probable cytosol aminopeptidase 0.00e+00 7.25e-54 2.98e-61 0.8744
1. PBF Q2NR41 Probable cytosol aminopeptidase 0.00e+00 1.02e-52 5.74e-58 0.8831
1. PBF A0K9N9 Probable cytosol aminopeptidase 0.00e+00 1.80e-48 1.30e-67 0.8796
1. PBF Q1CM01 Probable cytosol aminopeptidase 0.00e+00 2.02e-55 2.65e-64 0.8885
1. PBF Q7VAP4 Probable cytosol aminopeptidase 0.00e+00 5.35e-57 1.22e-53 0.8828
1. PBF P38019 Probable cytosol aminopeptidase 0.00e+00 5.60e-55 5.80e-62 0.9122
1. PBF B2SPE7 Probable cytosol aminopeptidase 0.00e+00 2.29e-51 6.67e-58 0.9073
1. PBF B4T0R5 Peptidase B 0.00e+00 7.59e-49 2.24e-31 0.8402
1. PBF Q8PGR0 Probable cytosol aminopeptidase 0.00e+00 4.61e-51 1.20e-57 0.9165
1. PBF P68768 Cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.9056
1. PBF A5IAU5 Probable cytosol aminopeptidase 0.00e+00 1.62e-60 9.40e-73 0.8856
1. PBF Q0BCQ2 Probable cytosol aminopeptidase 0.00e+00 7.26e-50 2.09e-68 0.8822
1. PBF Q3AHT4 Probable cytosol aminopeptidase 0.00e+00 1.43e-58 8.47e-51 0.8654
1. PBF C4K346 Probable cytosol aminopeptidase 0.00e+00 2.11e-57 2.91e-62 0.9076
1. PBF Q0T9D1 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.905
1. PBF A5GV03 Probable cytosol aminopeptidase 0.00e+00 1.01e-57 4.62e-53 0.8463
1. PBF Q73IU2 Probable cytosol aminopeptidase 0.00e+00 5.14e-54 5.69e-63 0.8682
1. PBF C1DPG2 Probable cytosol aminopeptidase 0.00e+00 2.13e-49 1.20e-66 0.908
1. PBF Q7VW48 Probable cytosol aminopeptidase 0.00e+00 8.36e-48 1.16e-63 0.9018
1. PBF Q3BPA1 Probable cytosol aminopeptidase 0.00e+00 4.15e-51 1.05e-57 0.9129
1. PBF Q143Y9 Probable cytosol aminopeptidase 0.00e+00 3.82e-49 1.16e-71 0.8863
1. PBF Q135P8 Probable cytosol aminopeptidase 0.00e+00 1.54e-55 1.79e-62 0.8597
1. PBF P28839 Cytosol aminopeptidase 0.00e+00 4.30e-37 6.48e-63 0.8428
1. PBF Q32D41 Peptidase B 0.00e+00 1.66e-45 1.35e-32 0.8344
1. PBF A1AJG3 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.887
1. PBF Q07LG0 Probable cytosol aminopeptidase 0.00e+00 6.50e-56 3.77e-60 0.8494
1. PBF A1V5Z5 Probable cytosol aminopeptidase 0.00e+00 1.43e-44 1.33e-69 0.9028
1. PBF A5CRI6 Probable cytosol aminopeptidase 0.00e+00 2.17e-59 9.87e-38 0.863
1. PBF B1JWV2 Probable cytosol aminopeptidase 0.00e+00 1.58e-48 2.44e-68 0.8906
1. PBF Q72F03 Probable cytosol aminopeptidase 0.00e+00 6.04e-49 3.51e-53 0.889
1. PBF Q7NHC6 Probable cytosol aminopeptidase 0.00e+00 3.00e-45 9.92e-54 0.8712
1. PBF B1IWD8 Peptidase B 0.00e+00 1.07e-46 1.80e-32 0.8393
1. PBF A5VZ69 Probable cytosol aminopeptidase 0.00e+00 5.77e-46 1.51e-65 0.8998
1. PBF B5R595 Peptidase B 0.00e+00 4.93e-49 1.46e-31 0.8344
1. PBF Q8NNJ4 Probable cytosol aminopeptidase 0.00e+00 3.35e-46 4.47e-47 0.8845
1. PBF A9MET9 Probable cytosol aminopeptidase 0.00e+00 8.06e-56 4.17e-63 0.893
1. PBF B2VL42 Probable cytosol aminopeptidase 0.00e+00 7.02e-57 1.04e-60 0.8849
1. PBF P58475 Peptidase B 0.00e+00 1.59e-51 2.52e-35 0.8089
1. PBF Q8Z064 Probable cytosol aminopeptidase 0.00e+00 9.18e-59 3.67e-49 0.8712
1. PBF A9VMY8 Probable cytosol aminopeptidase 0.00e+00 1.62e-60 9.44e-77 0.9211
1. PBF A8GHX6 Peptidase B 0.00e+00 2.14e-46 1.40e-29 0.8244
1. PBF Q4UQP6 Probable cytosol aminopeptidase 0.00e+00 2.94e-54 7.04e-58 0.9096
1. PBF A8GQW7 Probable cytosol aminopeptidase 0.00e+00 2.71e-54 1.41e-62 0.8986
1. PBF A7ZPW6 Peptidase B 0.00e+00 4.85e-46 1.74e-32 0.8343
1. PBF B5R1K2 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8932
1. PBF B9JUW1 Probable cytosol aminopeptidase 0.00e+00 3.19e-55 1.89e-55 0.8816
1. PBF A9VXD6 Probable cytosol aminopeptidase 0.00e+00 5.14e-53 4.56e-59 0.8811
1. PBF A8AMA5 Probable cytosol aminopeptidase 0.00e+00 5.91e-55 2.70e-61 0.8927
1. PBF Q11A96 Probable cytosol aminopeptidase 0.00e+00 7.45e-50 8.99e-54 0.8721
1. PBF B5FR78 Peptidase B 0.00e+00 4.93e-49 1.46e-31 0.8344
1. PBF Q1LJJ6 Probable cytosol aminopeptidase 0.00e+00 7.65e-43 4.68e-65 0.8603
1. PBF P47631 Probable cytosol aminopeptidase 0.00e+00 3.44e-75 4.69e-90 0.9187
1. PBF A1AE61 Peptidase B 0.00e+00 2.43e-46 2.11e-32 0.8334
1. PBF Q6D266 Peptidase B 0.00e+00 8.83e-55 7.98e-39 0.8197
1. PBF C0QSL9 Probable cytosol aminopeptidase 0.00e+00 1.32e-51 6.03e-58 0.8933
1. PBF C6E543 Probable cytosol aminopeptidase 0.00e+00 1.02e-52 1.88e-58 0.8858
1. PBF A8G978 Probable cytosol aminopeptidase 0.00e+00 1.46e-56 2.12e-65 0.8874
1. PBF Q57GC3 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8932
1. PBF B0BQ37 Probable cytosol aminopeptidase 0.00e+00 1.05e-52 7.37e-70 0.8929
1. PBF C0Q7D6 Probable cytosol aminopeptidase 0.00e+00 9.74e-56 1.90e-62 0.8928
1. PBF B2J3G8 Probable cytosol aminopeptidase 0.00e+00 1.24e-58 8.56e-52 0.8678
1. PBF Q2KWX0 Probable cytosol aminopeptidase 0.00e+00 7.26e-50 4.08e-65 0.9079
1. PBF B1LRE5 Probable cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 0.905
4. PB Q5V9F0 Cytosol aminopeptidase 0.00e+00 6.06e-36 3.90e-56 NA
4. PB Q9CPY7 Cytosol aminopeptidase 0.00e+00 1.52e-33 4.52e-61 NA
4. PB Q8RX72 Leucine aminopeptidase 3, chloroplastic 0.00e+00 7.73e-07 8.41e-43 NA
4. PB Q27245 Putative aminopeptidase W07G4.4 0.00e+00 1.86e-35 3.74e-17 NA
4. PB Q6K669 Leucine aminopeptidase 2, chloroplastic 0.00e+00 5.75e-05 3.73e-50 NA
4. PB Q09735 Putative aminopeptidase C13A11.05 0.00e+00 9.04e-40 1.30e-67 NA
4. PB P30184 Leucine aminopeptidase 1 0.00e+00 1.84e-29 3.02e-54 NA
4. PB Q2QSB9 Putative leucine aminopeptidase 1 0.00e+00 4.02e-16 1.39e-37 NA
4. PB P68767 Cytosol aminopeptidase 0.00e+00 8.51e-56 4.30e-62 NA
4. PB P9WHT3 Probable cytosol aminopeptidase 0.00e+00 1.21e-43 5.09e-45 NA
4. PB Q6NSR8 Probable aminopeptidase NPEPL1 0.00e+00 8.22e-43 8.53e-39 NA
4. PB Q8NDH3 Probable aminopeptidase NPEPL1 0.00e+00 1.26e-42 1.01e-37 NA
4. PB P28838 Cytosol aminopeptidase 0.00e+00 6.06e-36 2.25e-63 NA
4. PB Q68FS4 Cytosol aminopeptidase 0.00e+00 3.20e-33 8.22e-61 NA
4. PB Q944P7 Leucine aminopeptidase 2, chloroplastic 0.00e+00 3.33e-07 1.15e-50 NA
4. PB P37095 Peptidase B 0.00e+00 4.05e-47 1.63e-33 NA
4. PB P34629 Leucine aminopeptidase 1 0.00e+00 6.86e-58 9.21e-39 NA
6. F C4JHZ6 Probable zinc metalloprotease UREG_01421 3.10e-03 NA NA 0.3357
6. F E4URG0 Probable zinc metalloprotease MGYG_02393 7.77e-03 NA NA 0.3719
6. F D4D8N9 Probable zinc metalloprotease TRV_03476 2.76e-03 NA NA 0.3715
6. F C5FP82 Probable zinc metalloprotease MCYG_04217 1.00e-02 NA NA 0.3611
6. F Q7RYC8 Leucine aminopeptidase 1 1.28e-03 NA NA 0.3845