Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54819.1

JCVISYN3A_0494

N-acetylmannosamine-6-phosphate 2-epimerase.
M. mycoides homolog: Q6MT55.
TIGRfam Classification: 3=Putative.
Category: Nonessential.

Statistics

Total GO Annotation: 120
Unique PROST Go: 45
Unique BLAST Go: 11
Unique Foldseek Go: 27

Total Homologs: 4113
Unique PROST Homologs: 3142
Unique BLAST Homologs: 18
Unique Foldseek Homologs: 184

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: Putative N-acetylmannosamine-6-phosphate 2-epimerase
Zhang et al. [4]: GO:0047465|N-acylglucosamine-6-phosphate 2-epimerase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B9DIJ5 (Putative N-acetylmannosamine-6-phosphate 2-epimerase) with a FATCAT P-Value: 0 and RMSD of 1.17 angstrom. The sequence alignment identity is 44.0%.
Structural alignment shown in left. Query protein AVX54819.1 colored as red in alignment, homolog B9DIJ5 colored as blue. Query protein AVX54819.1 is also shown in right top, homolog B9DIJ5 showed in right bottom. They are colored based on secondary structures.

  AVX54819.1 MNLIDQIKNTLIVSCQAVDDEPLNDSYVLSKMCYALVLGGAKVLRLSQVEHIKKIKEVVNVPIIGLIKKHYDNSEVFITPTIKEVDQLVDLKVDIIALDA 100
      B9DIJ5 -----MLPQGLIVSCQALPDEPLHSSFIMSKLALAAYEGGAVGIRANTKEDIEAIKTEVPLPVIGIVKRDYEGSDVFITATSKEVDELIESGCEVIALDA 95

  AVX54819.1 TLRKRPDQDLTNLIKTIKTKY-PNQLLMADCSNINDAINAQNLGFDLISTTLRGYTKDTLNHNNIENDYQFLKD-LKKVITKPIIAEGGIWTPQQAKEIL 198
      B9DIJ5 TKQKRPKETLEELVTYIR-KHAPNVEIMADISTVEEAVNADKLGFDYVGTTLRGYTSYTKGHILFEDDFAFLKEVLDKVNAK-VIAEGNVITPEMYQTVS 193

  AVX54819.1 NLGIHSVVVGSAITRLHLIV-KYWN---DNLK 226
      B9DIJ5 NLGVYCTVVGGAITRPKQITERFVQAAKDQS- 224

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0006053	N-acetylmannosamine catabolic process
1. PBF	GO:0047465	N-acylglucosamine-6-phosphate 2-epimerase activity
1. PBF	GO:0004834	tryptophan synthase activity
1. PBF	GO:0019262	N-acetylneuraminate catabolic process
1. PBF	GO:0005975	carbohydrate metabolic process
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0009385	N-acylmannosamine-6-phosphate 2-epimerase activity
1. PBF	GO:0006051	N-acetylmannosamine metabolic process
1. PBF	GO:0004789	thiamine-phosphate diphosphorylase activity
2. PF	GO:0004139	deoxyribose-phosphate aldolase activity
2. PF	GO:0000105	histidine biosynthetic process
2. PF	GO:0005886	plasma membrane
2. PF	GO:0000162	tryptophan biosynthetic process
2. PF	GO:1990107	thiazole synthase activity
2. PF	GO:0003949	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
2. PF	GO:0016052	carbohydrate catabolic process
2. PF	GO:0000107	imidazoleglycerol-phosphate synthase activity
2. PF	GO:0009228	thiamine biosynthetic process
2. PF	GO:0016829	lyase activity
2. PF	GO:0046474	glycerophospholipid biosynthetic process
2. PF	GO:0009229	thiamine diphosphate biosynthetic process
2. PF	GO:0006094	gluconeogenesis
2. PF	GO:0004640	phosphoribosylanthranilate isomerase activity
2. PF	GO:0046872	metal ion binding
2. PF	GO:0004807	triose-phosphate isomerase activity
2. PF	GO:0004425	indole-3-glycerol-phosphate synthase activity
2. PF	GO:0000287	magnesium ion binding
2. PF	GO:0047294	phosphoglycerol geranylgeranyltransferase activity
2. PF	GO:0006096	glycolytic process
2. PF	GO:0009264	deoxyribonucleotide catabolic process
2. PF	GO:0046166	glyceraldehyde-3-phosphate biosynthetic process
2. PF	GO:0046386	deoxyribose phosphate catabolic process
3. BF	GO:0005524	ATP binding
3. BF	GO:0017150	tRNA dihydrouridine synthase activity
3. BF	GO:0009384	N-acylmannosamine kinase activity
4. PB	GO:0036381	pyridoxal 5'-phosphate synthase (glutamine hydrolysing) activity
4. PB	GO:0042823	pyridoxal phosphate biosynthetic process
5. P	GO:0008615	pyridoxine biosynthetic process
5. P	GO:2001120	methanofuran biosynthetic process
5. P	GO:0003723	RNA binding
5. P	GO:0033982	3-dehydro-L-gulonate-6-phosphate decarboxylase activity
5. P	GO:0019323	pentose catabolic process
5. P	GO:0004589	orotate reductase (NADH) activity
5. P	GO:0043801	hexulose-6-phosphate synthase activity
5. P	GO:0046279	3,4-dihydroxybenzoate biosynthetic process
5. P	GO:0044262	cellular carbohydrate metabolic process
5. P	GO:0016843	amine-lyase activity
5. P	GO:0006098	pentose-phosphate shunt
5. P	GO:0019647	formaldehyde assimilation via ribulose monophosphate cycle
5. P	GO:0046391	5-phosphoribose 1-diphosphate metabolic process
5. P	GO:0004152	dihydroorotate dehydrogenase activity
5. P	GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives
5. P	GO:0019854	L-ascorbic acid catabolic process
5. P	GO:0005739	mitochondrion
5. P	GO:0005634	nucleus
5. P	GO:0003855	3-dehydroquinate dehydratase activity
5. P	GO:0009052	pentose-phosphate shunt, non-oxidative branch
5. P	GO:0004750	D-ribulose-phosphate 3-epimerase activity
5. P	GO:0016830	carbon-carbon lyase activity
5. P	GO:0009073	aromatic amino acid family biosynthetic process
5. P	GO:0042803	protein homodimerization activity
5. P	GO:0016021	integral component of membrane
5. P	GO:0016832	aldehyde-lyase activity
5. P	GO:0004332	fructose-bisphosphate aldolase activity
5. P	GO:0044205	'de novo' UMP biosynthetic process
5. P	GO:0042802	identical protein binding
5. P	GO:0004590	orotidine-5'-phosphate decarboxylase activity
5. P	GO:0001072	transcription antitermination factor activity, RNA binding
5. P	GO:0009423	chorismate biosynthetic process
5. P	GO:0003824	catalytic activity
5. P	GO:0034700	allulose 6-phosphate 3-epimerase activity
5. P	GO:0016833	oxo-acid-lyase activity
5. P	GO:0005576	extracellular region
5. P	GO:0008674	2-dehydro-3-deoxy-6-phosphogalactonate aldolase activity
5. P	GO:0016744	transketolase or transaldolase activity
5. P	GO:0005783	endoplasmic reticulum
5. P	GO:0033856	pyridoxine 5'-phosphate synthase activity
5. P	GO:0008675	2-dehydro-3-deoxy-phosphogluconate aldolase activity
5. P	GO:0006878	cellular copper ion homeostasis
5. P	GO:0008652	cellular amino acid biosynthetic process
5. P	GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process
5. P	GO:0002094	polyprenyltransferase activity
6. F	GO:0003864	3-methyl-2-oxobutanoate hydroxymethyltransferase activity
6. F	GO:0008972	phosphomethylpyrimidine kinase activity
6. F	GO:0009396	folic acid-containing compound biosynthetic process
6. F	GO:0009636	response to toxic substance
6. F	GO:0008672	2-dehydro-3-deoxyglucarate aldolase activity
6. F	GO:0004156	dihydropteroate synthase activity
6. F	GO:0046654	tetrahydrofolate biosynthetic process
6. F	GO:0042838	D-glucarate catabolic process
6. F	GO:0000049	tRNA binding
6. F	GO:2001059	D-tagatose 6-phosphate catabolic process
6. F	GO:0034213	quinolinate catabolic process
6. F	GO:0018580	nitronate monooxygenase activity
6. F	GO:0043863	4-hydroxy-2-ketopimelate aldolase activity
6. F	GO:0008902	hydroxymethylpyrimidine kinase activity
6. F	GO:0008270	zinc ion binding
6. F	GO:0010124	phenylacetate catabolic process
6. F	GO:0004410	homocitrate synthase activity
6. F	GO:0000166	nucleotide binding
6. F	GO:0004514	nicotinate-nucleotide diphosphorylase (carboxylating) activity
6. F	GO:0019878	lysine biosynthetic process via aminoadipic acid
6. F	GO:0018802	2,4-dihydroxyhept-2-ene-1,7-dioate aldolase activity
6. F	GO:0004326	tetrahydrofolylpolyglutamate synthase activity
6. F	GO:0043799	glycine oxidase activity
6. F	GO:0046656	folic acid biosynthetic process
6. F	GO:0046392	galactarate catabolic process
6. F	GO:0009025	tagatose-bisphosphate aldolase activity
6. F	GO:0019404	galactitol catabolic process
7. B	GO:0006177	GMP biosynthetic process
7. B	GO:0003938	IMP dehydrogenase activity
7. B	GO:0071353	cellular response to interleukin-4
7. B	GO:0009630	gravitropism
7. B	GO:0052544	defense response by callose deposition in cell wall
7. B	GO:0007623	circadian rhythm
7. B	GO:0009851	auxin biosynthetic process
7. B	GO:0033984	indole-3-glycerol-phosphate lyase activity
7. B	GO:0006183	GTP biosynthetic process
7. B	GO:0060041	retina development in camera-type eye
7. B	GO:0046651	lymphocyte proliferation

Uniprot GO Annotations

GO	Description
GO:0047465	N-acylglucosamine-6-phosphate 2-epimerase activity
GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0019262	N-acetylneuraminate catabolic process
GO:0005975	carbohydrate metabolic process
GO:0016853	isomerase activity
GO:0009385	N-acylmannosamine-6-phosphate 2-epimerase activity
GO:0006051	N-acetylmannosamine metabolic process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q040Z7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.70e-33	2.39e-54	0.9185
1. PBF	Q5HJ50	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	0.9735
1. PBF	B9DVU8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.84e-27	3.18e-50	0.9279
1. PBF	A5F7B9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.34e-20	3.05e-32	0.9035
1. PBF	Q38V36	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.93e-34	1.16e-62	0.9694
1. PBF	Q8RDN5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.09e-35	7.22e-66	0.9607
1. PBF	P65520	Putative N-acetylmannosamine-6-phosphate 2-epimerase 2	0.00e+00	7.17e-32	1.36e-54	0.9173
1. PBF	A0AMC4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	8.72e-33	7.32e-70	0.9706
1. PBF	A6TEN5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.26e-29	3.08e-39	0.8792
1. PBF	O51589	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.46e-32	7.67e-67	0.957
1. PBF	Q5N1J0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.63e-37	4.60e-27	0.8924
1. PBF	B0BSI0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.13e-23	1.11e-45	0.9021
1. PBF	Q8NMD0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.86e-24	2.38e-29	0.8955
1. PBF	Q939I2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.81e-29	1.08e-38	0.8781
1. PBF	Q7VC70	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.42e-07	3.55e-04	0.005	0.6469
1. PBF	Q6MT55	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.31e-90	1.00e-163	0.9997
1. PBF	Q6GJZ8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	0.9736
1. PBF	Q7VKN0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.08e-25	3.49e-42	0.8997
1. PBF	P65521	Putative N-acetylmannosamine-6-phosphate 2-epimerase 2	0.00e+00	7.17e-32	1.36e-54	0.9173
1. PBF	A2RCG2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.94e-27	4.49e-50	0.9299
1. PBF	Q71VW2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.10e-40	1.42e-71	0.9636
1. PBF	P65517	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.94e-33	1.31e-66	0.9716
1. PBF	B7NDK1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8787
1. PBF	B7NKT4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.25e-30	8.50e-38	0.8788
1. PBF	Q4L9T7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.29e-37	1.97e-65	0.9763
1. PBF	Q9KR62	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.24e-20	2.96e-32	0.8937
1. PBF	P0DC69	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.81e-26	1.12e-49	0.9303
1. PBF	Q2YVA8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.83e-33	3.89e-66	0.9716
1. PBF	Q660M6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.34e-34	6.44e-67	0.9611
1. PBF	P0DC68	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.81e-26	1.12e-49	0.9302
1. PBF	Q1JDM7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.81e-26	1.12e-49	0.93
1. PBF	B2K948	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.07e-26	3.40e-31	0.894
1. PBF	B7UJV6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.92e-30	1.66e-37	0.8784
1. PBF	Q5PLF1	Putative N-acetylmannosamine-6-phosphate 2-epimerase 2	0.00e+00	6.02e-29	1.23e-39	0.8781
1. PBF	C1C8S3	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.17e-32	1.36e-54	0.9174
1. PBF	Q0TCP3	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8785
1. PBF	Q31W92	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8789
1. PBF	Q1C5U6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.04e-27	4.20e-32	0.8939
1. PBF	A4VW79	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.21e-30	9.57e-48	0.9202
1. PBF	B5XSS5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.67e-28	5.34e-43	0.8803
1. PBF	Q8DGQ5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.99e-38	1.14e-37	0.917
1. PBF	C5B754	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	8.98e-26	3.64e-40	0.8815
1. PBF	Q5PG85	Putative N-acetylmannosamine-6-phosphate 2-epimerase 1	0.00e+00	2.16e-28	5.99e-34	0.877
1. PBF	P59442	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.10e-30	2.78e-38	0.8789
1. PBF	Q8Y3N4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.52e-36	5.36e-72	0.9694
1. PBF	Q9CGC2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.04e-30	1.04e-49	0.9266
1. PBF	Q6A6A0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.52e-34	1.28e-39	0.884
1. PBF	Q8NYC4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.13e-34	1.01e-65	0.972
1. PBF	Q8D613	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.45e-18	4.05e-34	0.9014
1. PBF	B7J2K0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.46e-32	7.67e-67	0.9571
1. PBF	A4QH48	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.86e-24	2.38e-29	0.8923
1. PBF	A7ZSB6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.24e-29	3.51e-37	0.8783
1. PBF	Q0SWI9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.29e-37	1.43e-66	0.9483
1. PBF	B1LGI8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8788
1. PBF	C4ZSW1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8787
1. PBF	Q185B2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.80e-34	4.57e-60	0.9374
1. PBF	B7MBY5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8788
1. PBF	Q5XDY5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.58e-28	4.64e-50	0.9301
1. PBF	P71340	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.28e-21	6.77e-50	0.8853
1. PBF	A8YZE2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	0.9736
1. PBF	P60631	Putative N-acetylmannosamine-6-phosphate 2-epimerase 1	0.00e+00	3.09e-28	3.29e-34	0.8774
1. PBF	B8F667	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	8.40e-25	4.73e-45	0.9056
1. PBF	Q8R7I7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.22e-28	1.45e-64	0.9224
1. PBF	Q8EWM9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.57e-50	1.45e-83	0.9746
1. PBF	C5VXY0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.21e-30	9.57e-48	0.9202
1. PBF	Q8ZCG8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.04e-27	4.20e-32	0.8944
1. PBF	A3CK30	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.04e-37	2.36e-47	0.9114
1. PBF	Q0SMK9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.29e-35	1.75e-68	0.9623
1. PBF	A2RKU2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.95e-31	8.02e-53	0.9293
1. PBF	Q2FJU6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	0.9719
1. PBF	Q0TUP9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.52e-36	2.46e-66	0.9485
1. PBF	Q74HT0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.72e-34	2.31e-56	0.9199
1. PBF	Q8KU93	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.05e-33	2.42e-53	0.9302
1. PBF	C3LNA0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.24e-20	2.96e-32	0.9035
1. PBF	Q8XNZ3	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.52e-36	2.46e-66	0.9485
1. PBF	Q32BB6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	8.42e-30	2.12e-37	0.8789
1. PBF	B8DD13	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.12e-36	1.23e-71	0.9685
1. PBF	B1IQQ6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.10e-30	2.78e-38	0.8787
1. PBF	Q1J8K5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.20e-26	1.37e-49	0.9302
1. PBF	A4WDW4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.92e-35	8.29e-64	0.9716
1. PBF	Q8EMP6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.30e-40	4.18e-68	0.9728
1. PBF	P65516	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.94e-33	1.31e-66	0.9736
1. PBF	Q668J7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.07e-26	3.40e-31	0.8944
1. PBF	Q97Q95	Putative N-acetylmannosamine-6-phosphate 2-epimerase 1	0.00e+00	1.23e-31	2.51e-52	0.9259
1. PBF	A8A533	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.10e-30	2.78e-38	0.8788
1. PBF	B5YSV0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.05e-29	1.10e-37	0.8783
1. PBF	Q1CJY8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.04e-27	4.20e-32	0.894
1. PBF	B9DIJ5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.60e-34	2.80e-62	0.9748
1. PBF	B7M0T5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8788
1. PBF	Q5WK54	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.28e-42	1.04e-70	0.9728
1. PBF	A1AGB7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.879
1. PBF	P65519	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.21e-34	1.25e-50	0.9306
1. PBF	Q03HR3	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.51e-35	9.51e-58	0.9741
1. PBF	Q926V7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.41e-40	2.83e-72	0.9682
1. PBF	C1CSU8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.17e-32	1.36e-54	0.9173
1. PBF	Q1JIP7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.25e-26	7.64e-50	0.9302
1. PBF	B3GZ03	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.81e-23	2.72e-46	0.9015
1. PBF	A7FG95	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.75e-26	2.04e-31	0.8942
1. PBF	Q31KC5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.63e-37	4.60e-27	0.8928
1. PBF	Q8DPF0	Putative N-acetylmannosamine-6-phosphate 2-epimerase 1	0.00e+00	9.04e-30	2.11e-55	0.9181
1. PBF	P59441	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.22e-33	2.70e-53	0.9607
1. PBF	A9N831	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.01e-28	1.40e-39	0.8783
1. PBF	B4EZY9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.92e-26	5.24e-30	0.8837
1. PBF	Q9L6B4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.48e-23	4.36e-51	0.9036
1. PBF	B1XHJ6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8787
1. PBF	Q5E735	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	8.81e-27	1.14e-40	0.8891
1. PBF	Q3K3Z4	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.87e-34	7.65e-51	0.9306
1. PBF	C1L0D5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.71e-39	4.33e-72	0.9682
1. PBF	A6QDV0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	0.9737
1. PBF	B1JFV9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.22e-28	4.25e-32	0.8938
1. PBF	A4FX32	Thiamine-phosphate synthase	6.26e-11	2.11e-07	0.010	0.6453
1. PBF	B8D7H4	Tryptophan synthase alpha chain	1.09e-06	2.87e-07	0.023	0.5646
1. PBF	A5IPI5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.94e-33	1.31e-66	0.9718
1. PBF	Q3YX25	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.48e-30	5.19e-38	0.8787
1. PBF	P0CB52	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.23e-30	9.69e-47	0.9204
1. PBF	B7LRJ1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.55e-30	2.39e-37	0.8787
1. PBF	Q6LPV5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.33e-23	8.29e-36	0.8805
1. PBF	Q7MD32	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.45e-18	4.05e-34	0.9013
1. PBF	P65518	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.21e-34	1.25e-50	0.9306
1. PBF	A3N350	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.81e-23	2.72e-46	0.9016
1. PBF	P65522	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.48e-26	2.73e-50	0.9244
1. PBF	Q48VD6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.81e-26	1.12e-49	0.9301
1. PBF	Q8ZLQ7	Putative N-acetylmannosamine-6-phosphate 2-epimerase 2	0.00e+00	3.14e-28	9.28e-40	0.8783
1. PBF	B5F7J7	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.60e-28	6.79e-40	0.878
1. PBF	A8AUI0	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	4.09e-35	6.80e-50	0.918
1. PBF	B2U1W1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8791
1. PBF	A7WXZ6	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.94e-33	1.31e-66	0.9716
1. PBF	P25053	Thiazole tautomerase	6.86e-11	5.93e-05	0.042	0.6553
1. PBF	A4TMJ5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.04e-27	4.20e-32	0.8943
1. PBF	B6I1U1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8787
1. PBF	Q8X9G9	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.05e-29	1.10e-37	0.8789
1. PBF	Q6GCF3	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	7.13e-34	1.01e-65	0.9718
1. PBF	A9MNY8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.85e-29	5.78e-40	0.8802
1. PBF	Q65TE9	Tryptophan synthase alpha chain	3.89e-09	6.19e-06	0.020	0.5875
1. PBF	P65523	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	1.48e-26	2.73e-50	0.9283
1. PBF	Q2SS69	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	9.93e-69	1.73e-145	0.9969
1. PBF	Q0T067	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.10e-30	2.78e-38	0.8786
1. PBF	A6TYA2	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.94e-33	1.31e-66	0.9736
1. PBF	Q1JNJ8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.81e-26	1.12e-49	0.9301
1. PBF	B5XJP1	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.45e-26	5.23e-50	0.9303
1. PBF	Q02YU5	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.06e-31	7.37e-54	0.9284
1. PBF	P0A762	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	0.8786
1. PBF	Q98QJ8	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.06e-40	3.41e-63	0.9341
1. PBF	P60668	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	3.09e-28	3.29e-34	0.8774
1. PBF	Q4A094	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	6.03e-36	1.20e-64	0.9749
2. PF	B7GKQ8	Thiamine-phosphate synthase	6.53e-07	4.63e-07	NA	0.6202
2. PF	Q8TYD6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.21e-07	4.92e-08	NA	0.5941
2. PF	A6QIT5	Thiamine-phosphate synthase	3.65e-06	5.48e-04	NA	0.6644
2. PF	Q73DB1	Thiazole synthase	1.67e-05	4.77e-07	NA	0.5132
2. PF	Q8DMA5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.98e-07	3.03e-04	NA	0.6317
2. PF	Q5H0K7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.98e-10	2.12e-05	NA	0.6213
2. PF	P60581	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.41e-07	1.24e-09	NA	0.6075
2. PF	Q723Y9	Thiamine-phosphate synthase	5.58e-07	1.23e-07	NA	0.6648
2. PF	Q9KCY6	Thiazole synthase	5.56e-09	3.02e-07	NA	0.547
2. PF	B0KN58	Thiazole synthase	3.28e-09	1.26e-06	NA	0.5553
2. PF	A6UYJ0	Thiazole synthase	3.93e-09	7.66e-07	NA	0.5555
2. PF	Q1IX16	Thiamine-phosphate synthase	8.23e-10	2.54e-04	NA	0.5917
2. PF	Q8ZFX9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.06e-08	2.71e-05	NA	0.5985
2. PF	B1ILA1	Deoxyribose-phosphate aldolase	4.37e-10	6.19e-06	NA	0.6422
2. PF	A7ZA58	Thiamine-phosphate synthase	8.54e-07	1.34e-08	NA	0.6188
2. PF	B2ISS3	Indole-3-glycerol phosphate synthase	1.74e-08	1.50e-09	NA	0.6564
2. PF	A8FWD0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.81e-09	3.31e-07	NA	0.5868
2. PF	P43048	Deoxyribose-phosphate aldolase	2.25e-10	2.16e-07	NA	0.6659
2. PF	Q4K4C5	Thiazole synthase	3.12e-09	4.40e-07	NA	0.5684
2. PF	P05325	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.50e-10	1.42e-08	NA	0.6447
2. PF	Q50757	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.69e-10	2.13e-07	NA	0.628
2. PF	A4FLL9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.43e-07	2.76e-09	NA	0.6084
2. PF	Q97RH2	Deoxyribose-phosphate aldolase	5.85e-10	3.30e-06	NA	0.6399
2. PF	P66921	Thiamine-phosphate synthase 2	7.37e-10	8.22e-04	NA	0.6684
2. PF	A4VVB2	Deoxyribose-phosphate aldolase	3.88e-10	1.74e-07	NA	0.6534
2. PF	Q6F0H8	Deoxyribose-phosphate aldolase 2	2.09e-10	7.58e-07	NA	0.6923
2. PF	A4SSI2	Thiazole synthase	2.00e-09	3.93e-06	NA	0.5412
2. PF	Q83PC0	Thiazole synthase	1.95e-09	8.72e-07	NA	0.5518
2. PF	B2TQ13	Thiamine-phosphate synthase	2.56e-09	7.44e-05	NA	0.6644
2. PF	A5ISQ2	Indole-3-glycerol phosphate synthase	9.09e-11	9.81e-09	NA	0.6513
2. PF	Q980N1	Geranylgeranylglyceryl phosphate synthase	2.54e-07	3.22e-02	NA	0.5135
2. PF	Q87KF4	Thiazole synthase	1.68e-09	2.86e-05	NA	0.5531
2. PF	P66917	Thiamine-phosphate synthase	4.86e-09	5.01e-06	NA	0.6094
2. PF	B7V3W7	Thiazole synthase	3.87e-09	1.20e-06	NA	0.5679
2. PF	B7HT70	Thiamine-phosphate synthase	6.53e-10	1.11e-07	NA	0.6195
2. PF	Q7NFI7	Deoxyribose-phosphate aldolase	2.05e-10	8.06e-08	NA	0.6055
2. PF	Q1CGW6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.12e-08	2.71e-05	NA	0.5949
2. PF	A5U2W7	Indole-3-glycerol phosphate synthase	1.05e-08	1.39e-08	NA	0.6674
2. PF	A5D4K4	Thiamine-phosphate synthase	1.71e-07	8.37e-05	NA	0.6294
2. PF	B8GJY2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.34e-10	5.33e-07	NA	0.6071
2. PF	A3Q119	Indole-3-glycerol phosphate synthase	5.31e-09	1.98e-09	NA	0.6812
2. PF	P0A633	Indole-3-glycerol phosphate synthase	1.00e-08	1.39e-08	NA	0.6608
2. PF	B2A4J4	Deoxyribose-phosphate aldolase	4.09e-10	2.97e-05	NA	0.6251
2. PF	Q03GM4	Thiamine-phosphate synthase	5.25e-07	1.47e-05	NA	0.6688
2. PF	O67378	Putative thiamine-phosphate synthase 2	9.79e-11	4.08e-04	NA	0.6994
2. PF	B4SEN7	Tryptophan synthase alpha chain	1.04e-06	2.03e-07	NA	0.6059
2. PF	A3CS45	Thiamine-phosphate synthase	8.10e-10	2.23e-03	NA	0.6215
2. PF	A7FPT0	Thiamine-phosphate synthase	3.93e-10	3.43e-06	NA	0.6816
2. PF	P64359	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.41e-09	1.22e-07	NA	0.6231
2. PF	P62356	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.19e-10	1.93e-07	NA	0.6371
2. PF	A6US29	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.62e-10	3.21e-07	NA	0.6409
2. PF	A4JAW9	Imidazole glycerol phosphate synthase subunit HisF	1.13e-09	1.40e-03	NA	0.6274
2. PF	B8D710	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.63e-06	1.97e-05	NA	0.5915
2. PF	C0QUK5	Thiazole synthase	4.51e-07	4.48e-08	NA	0.569
2. PF	Q5GXR6	Tryptophan synthase alpha chain	1.12e-08	2.17e-06	NA	0.5457
2. PF	B9J2L5	Thiamine-phosphate synthase	4.24e-07	1.11e-07	NA	0.6234
2. PF	Q81Z95	Thiamine-phosphate synthase	4.35e-07	1.31e-07	NA	0.6386
2. PF	Q65D22	Deoxyribose-phosphate aldolase 2	1.42e-09	1.44e-07	NA	0.6076
2. PF	B2V959	Thiazole synthase	6.76e-10	3.47e-08	NA	0.6015
2. PF	Q6ALS3	Deoxyribose-phosphate aldolase	2.96e-10	7.98e-09	NA	0.6021
2. PF	A7FJH4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.04e-08	2.71e-05	NA	0.5951
2. PF	P73618	Deoxyribose-phosphate aldolase	3.89e-10	4.63e-07	NA	0.6216
2. PF	Q5V2C9	Imidazole glycerol phosphate synthase subunit HisF	4.17e-10	2.92e-04	NA	0.6426
2. PF	Q9Y8T7	Indole-3-glycerol phosphate synthase	8.17e-10	7.14e-07	NA	0.6158
2. PF	B0JK91	Deoxyribose-phosphate aldolase	6.33e-10	1.83e-08	NA	0.6375
2. PF	P39121	Deoxyribose-phosphate aldolase	1.16e-09	5.96e-07	NA	0.6011
2. PF	Q6F1Z6	Deoxyribose-phosphate aldolase 1	2.24e-10	1.75e-07	NA	0.6665
2. PF	Q03VX9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.23e-07	1.76e-02	NA	0.6303
2. PF	B5RFJ4	Thiazole synthase	1.45e-09	1.17e-05	NA	0.5558
2. PF	P46314	Uncharacterized protein ycf23	4.73e-11	4.49e-04	NA	0.6139
2. PF	A3MUC6	Triosephosphate isomerase	1.67e-10	3.26e-10	NA	0.6536
2. PF	Q5N4L8	Deoxyribose-phosphate aldolase	3.08e-10	9.94e-11	NA	0.6137
2. PF	A5GKX4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.88e-07	2.74e-03	NA	0.6106
2. PF	Q7MLS2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.99e-08	4.43e-09	NA	0.5729
2. PF	P9WG74	Thiamine-phosphate synthase	4.86e-09	5.01e-06	NA	0.6085
2. PF	B9DMC3	Deoxyribose-phosphate aldolase	4.85e-10	4.52e-08	NA	0.6451
2. PF	Q1B7H6	Indole-3-glycerol phosphate synthase	5.31e-09	1.98e-09	NA	0.681
2. PF	A3QF20	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.39e-09	2.32e-08	NA	0.6
2. PF	Q7WDX9	Imidazole glycerol phosphate synthase subunit HisF	9.52e-10	5.17e-05	NA	0.6356
2. PF	Q5NE80	Tryptophan synthase alpha chain	2.17e-09	1.17e-04	NA	0.5736
2. PF	Q8PS49	Thiamine-phosphate synthase	8.56e-10	1.73e-05	NA	0.6367
2. PF	A9VRN4	Thiamine-phosphate synthase	3.55e-07	2.28e-09	NA	0.6391
2. PF	C5BG15	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.83e-08	9.35e-07	NA	0.593
2. PF	A5N7N8	Indole-3-glycerol phosphate synthase	1.46e-07	1.20e-07	NA	0.6913
2. PF	Q8XK02	Thiazole synthase	2.09e-09	6.08e-09	NA	0.5669
2. PF	Q254T1	Tryptophan synthase alpha chain	6.20e-10	2.04e-08	NA	0.6451
2. PF	A4XLW0	Deoxyribose-phosphate aldolase	1.33e-07	9.52e-08	NA	0.6642
2. PF	A0PYX5	Deoxyribose-phosphate aldolase	1.05e-09	5.90e-07	NA	0.6134
2. PF	Q8NKN9	Triosephosphate isomerase	8.42e-11	2.75e-12	NA	0.6631
2. PF	C1C6H7	Deoxyribose-phosphate aldolase	7.70e-10	1.49e-06	NA	0.6233
2. PF	C0M9B0	Deoxyribose-phosphate aldolase	6.08e-10	1.85e-07	NA	0.6533
2. PF	O83288	Deoxyribose-phosphate aldolase	8.79e-10	3.59e-07	NA	0.6404
2. PF	P39594	Thiamine-phosphate synthase	1.00e-06	8.99e-09	NA	0.6212
2. PF	B1KV12	Thiamine-phosphate synthase	3.01e-10	3.38e-05	NA	0.6806
2. PF	Q7N8D1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2	3.11e-07	6.16e-10	NA	0.6316
2. PF	A4W0K4	Thiamine-phosphate synthase	1.51e-08	6.75e-03	NA	0.6216
2. PF	Q6HK62	Deoxyribose-phosphate aldolase	1.06e-09	9.62e-08	NA	0.6142
2. PF	A1RJR5	Thiazole synthase	2.08e-09	1.02e-06	NA	0.5376
2. PF	A8ZZX0	Indole-3-glycerol phosphate synthase	9.21e-11	1.27e-07	NA	0.6913
2. PF	B4SDV8	Indole-3-glycerol phosphate synthase	1.53e-11	2.59e-07	NA	0.6288
2. PF	A4IR26	Deoxyribose-phosphate aldolase	1.12e-09	1.14e-07	NA	0.6121
2. PF	P09924	Deoxyribose-phosphate aldolase	1.27e-10	4.14e-07	NA	0.6194
2. PF	Q1GNC2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.85e-09	1.34e-06	NA	0.624
2. PF	A9VQK2	Deoxyribose-phosphate aldolase	7.79e-10	3.26e-08	NA	0.6283
2. PF	Q600B2	Deoxyribose-phosphate aldolase	5.70e-11	4.67e-08	NA	0.6451
2. PF	B1LB68	Deoxyribose-phosphate aldolase	2.18e-09	6.37e-05	NA	0.6534
2. PF	B5ENK9	Thiazole synthase	2.01e-09	2.59e-07	NA	0.5132
2. PF	Q81EY8	Deoxyribose-phosphate aldolase	6.64e-10	2.05e-07	NA	0.5978
2. PF	A7X234	Indole-3-glycerol phosphate synthase	1.08e-10	9.81e-09	NA	0.6458
2. PF	Q04L69	Deoxyribose-phosphate aldolase	5.95e-10	2.30e-06	NA	0.6271
2. PF	B7JN72	Thiamine-phosphate synthase	4.34e-07	4.25e-08	NA	0.6197
2. PF	A5ULP6	Triosephosphate isomerase	5.27e-11	5.54e-11	NA	0.6572
2. PF	Q6G9I9	Indole-3-glycerol phosphate synthase	8.49e-11	7.00e-09	NA	0.6332
2. PF	A6GWR9	Thiamine-phosphate synthase	4.07e-07	1.90e-02	NA	0.6535
2. PF	A0AJ82	Indole-3-glycerol phosphate synthase	3.56e-11	1.22e-09	NA	0.5986
2. PF	Q6HP17	Thiamine-phosphate synthase	9.61e-10	3.99e-08	NA	0.6194
2. PF	Q5HSI8	Imidazole glycerol phosphate synthase subunit HisF	1.19e-10	2.98e-03	NA	0.6476
2. PF	P31605	Uncharacterized protein ycf23	3.08e-10	2.32e-12	NA	0.6316
2. PF	B7MIX6	Thiazole synthase	1.40e-09	5.49e-07	NA	0.5657
2. PF	B2UV41	Tryptophan synthase alpha chain	8.85e-07	2.52e-09	NA	0.5744
2. PF	A5G7P4	Thiazole synthase	1.56e-09	2.84e-10	NA	0.5948
2. PF	Q0W1L8	Thiamine-phosphate synthase	9.01e-10	3.87e-04	NA	0.6187
2. PF	Q1JF38	Deoxyribose-phosphate aldolase	5.19e-08	1.21e-06	NA	0.6362
2. PF	A1S6Z5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.90e-06	7.73e-07	NA	0.6076
2. PF	Q8KF55	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.34e-07	2.27e-03	NA	0.6389
2. PF	A5HYZ3	Thiamine-phosphate synthase	2.70e-10	3.43e-06	NA	0.6807
2. PF	Q3AU73	Indole-3-glycerol phosphate synthase	1.82e-11	2.22e-04	NA	0.6638
2. PF	Q5HM84	Deoxyribose-phosphate aldolase	4.12e-10	3.67e-07	NA	0.6413
2. PF	B1IB13	Deoxyribose-phosphate aldolase	6.28e-10	1.34e-05	NA	0.6445
2. PF	Q2IM25	Thiamine-phosphate synthase	1.81e-09	1.55e-06	NA	0.6183
2. PF	C1KWT9	Deoxyribose-phosphate aldolase	1.47e-09	2.75e-08	NA	0.5763
2. PF	Q9RQ33	Tryptophan synthase alpha chain	8.42e-07	2.41e-07	NA	0.579
2. PF	A2BQT3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.06e-06	3.67e-04	NA	0.6003
2. PF	Q824E9	Thiamine-phosphate synthase	8.39e-11	2.36e-07	NA	0.6682
2. PF	Q74IA4	Deoxyribose-phosphate aldolase	3.33e-09	3.99e-11	NA	0.6357
2. PF	A9AAG9	Thiamine-phosphate synthase	1.03e-10	1.73e-06	NA	0.652
2. PF	A7GAL0	Thiamine-phosphate synthase	2.98e-10	3.86e-06	NA	0.681
2. PF	B5YIB7	Imidazole glycerol phosphate synthase subunit HisF	1.40e-06	7.09e-03	NA	0.6319
2. PF	A9BHQ5	Indole-3-glycerol phosphate synthase	1.23e-10	2.50e-09	NA	0.6983
2. PF	A7FK39	Deoxyribose-phosphate aldolase	8.02e-10	6.65e-07	NA	0.6634
2. PF	P58263	Thiazole synthase	1.38e-09	4.55e-06	NA	0.5566
2. PF	Q5HPH2	Indole-3-glycerol phosphate synthase	9.79e-11	3.97e-09	NA	0.6416
2. PF	Q9PPQ4	Deoxyribose-phosphate aldolase	4.31e-10	2.52e-09	NA	0.6438
2. PF	B7MWU2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.75e-08	6.20e-07	NA	0.5871
2. PF	A1T8X3	Indole-3-glycerol phosphate synthase	6.67e-09	3.55e-09	NA	0.7032
2. PF	B6JNB7	Tryptophan synthase alpha chain	1.20e-06	9.29e-09	NA	0.6168
2. PF	Q63DW9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.02e-08	7.67e-04	NA	0.5866
2. PF	P66991	Indole-3-glycerol phosphate synthase	6.72e-11	9.81e-09	NA	0.649
2. PF	P66920	Thiamine-phosphate synthase 2	7.78e-10	8.22e-04	NA	0.6681
2. PF	Q7VSY6	Imidazole glycerol phosphate synthase subunit HisF	1.14e-09	5.17e-05	NA	0.6359
2. PF	Q5JHG3	Triosephosphate isomerase	8.01e-11	8.23e-14	NA	0.6509
2. PF	P42389	Tryptophan synthase alpha chain	6.73e-07	1.24e-06	NA	0.5713
2. PF	Q9PNP6	Thiazole synthase	2.93e-09	1.51e-09	NA	0.5908
2. PF	B9E8I5	Deoxyribose-phosphate aldolase	6.13e-10	2.62e-07	NA	0.6696
2. PF	A6W6A2	Thiamine-phosphate synthase	1.83e-09	7.51e-05	NA	0.6571
2. PF	Q5HEA8	Thiamine-phosphate synthase	3.81e-06	5.48e-04	NA	0.6524
2. PF	P47722	Deoxyribose-phosphate aldolase	2.45e-10	5.24e-08	NA	0.6413
2. PF	Q9RL78	Indole-3-glycerol phosphate synthase	1.12e-10	2.61e-08	NA	0.6393
2. PF	C1FN33	Deoxyribose-phosphate aldolase	3.22e-10	4.09e-06	NA	0.6604
2. PF	Q39RH2	Thiazole synthase	1.42e-09	6.89e-10	NA	0.5911
2. PF	Q74FL9	Thiazole synthase	1.87e-09	6.85e-09	NA	0.5689
2. PF	O74067	Triosephosphate isomerase	6.28e-10	8.54e-13	NA	0.6392
2. PF	Q65US7	Thiamine-phosphate synthase	5.30e-07	9.43e-08	NA	0.6236
2. PF	C6E0C4	Thiazole synthase	1.86e-09	4.53e-10	NA	0.5808
2. PF	B8E0F1	Deoxyribose-phosphate aldolase	1.48e-10	1.95e-08	NA	0.6707
2. PF	C3KVW7	Deoxyribose-phosphate aldolase	3.78e-10	7.94e-06	NA	0.6673
2. PF	Q8TU55	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.50e-10	4.08e-04	NA	0.6228
2. PF	B3W783	Thiamine-phosphate synthase	5.94e-10	1.03e-03	NA	0.608
2. PF	B9DIP2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.69e-09	3.53e-06	NA	0.5737
2. PF	C1CS48	Deoxyribose-phosphate aldolase	6.24e-10	6.31e-06	NA	0.6474
2. PF	Q2YUL6	Deoxyribose-phosphate aldolase 2	5.44e-10	2.00e-06	NA	0.6314
2. PF	B2SEK8	Tryptophan synthase alpha chain	3.03e-09	1.75e-04	NA	0.5918
2. PF	A8FM94	Thiazole synthase	3.10e-09	1.55e-09	NA	0.5748
2. PF	Q3IQC4	Tryptophan synthase alpha chain	3.14e-09	1.08e-04	NA	0.569
2. PF	A8FJ14	Deoxyribose-phosphate aldolase	4.50e-10	1.19e-08	NA	0.5721
2. PF	Q3BRL7	Tryptophan synthase alpha chain	1.59e-06	3.47e-06	NA	0.5869
2. PF	A6TGP7	Thiazole synthase	1.47e-09	1.08e-06	NA	0.5629
2. PF	Q46IC6	Thiazole synthase	1.27e-08	6.25e-06	NA	0.5448
2. PF	Q4JW54	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.40e-06	2.13e-07	NA	0.6432
2. PF	Q9KCY8	Thiamine-phosphate synthase	4.79e-07	3.22e-04	NA	0.6283
2. PF	P9WFX6	Indole-3-glycerol phosphate synthase	5.65e-09	2.25e-08	NA	0.6695
2. PF	Q8NVF5	Deoxyribose-phosphate aldolase 2	6.57e-10	3.11e-06	NA	0.6232
2. PF	Q0W628	N-(5'-phosphoribosyl)anthranilate isomerase	8.58e-10	6.03e-03	NA	0.6611
2. PF	A1V8H5	Imidazole glycerol phosphate synthase subunit HisF	5.08e-10	9.24e-03	NA	0.6406
2. PF	Q02YD6	Deoxyribose-phosphate aldolase	8.19e-10	1.83e-07	NA	0.6275
2. PF	B5E3L5	Deoxyribose-phosphate aldolase	6.31e-10	3.11e-06	NA	0.6389
2. PF	Q8DNM9	Tryptophan synthase alpha chain	5.81e-08	2.69e-06	NA	0.5705
2. PF	A9WDL8	Thiamine-phosphate synthase	1.92e-10	2.49e-06	NA	0.6367
2. PF	B8DET0	Thiamine-phosphate synthase	5.48e-07	2.05e-07	NA	0.6648
2. PF	B5YJ73	Thiazole synthase	1.60e-05	1.21e-09	NA	0.5558
2. PF	Q1JK46	Deoxyribose-phosphate aldolase	6.77e-08	6.72e-07	NA	0.636
2. PF	Q3IT10	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.58e-08	6.09e-05	NA	0.6194
2. PF	Q186F8	Thiamine-phosphate synthase	1.15e-09	2.87e-08	NA	0.6263
2. PF	Q96YZ9	Triosephosphate isomerase	8.54e-11	4.03e-08	NA	0.6249
2. PF	A0QHH0	Indole-3-glycerol phosphate synthase	6.32e-09	2.70e-09	NA	0.6661
2. PF	P51373	Uncharacterized protein ycf23	2.15e-11	1.42e-08	NA	0.6585
2. PF	Q2FN18	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.38e-10	1.16e-06	NA	0.6035
2. PF	Q9RV25	Deoxyribose-phosphate aldolase	5.04e-10	6.79e-07	NA	0.6513
2. PF	A3CV22	Triosephosphate isomerase	4.36e-11	4.47e-09	NA	0.6438
2. PF	Q0BP46	Tryptophan synthase alpha chain	2.60e-09	5.71e-05	NA	0.5756
2. PF	A6UPE6	Thiamine-phosphate synthase	6.18e-11	6.15e-05	NA	0.6765
2. PF	A9ML12	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.42e-08	2.39e-07	NA	0.5997
2. PF	A0Q2A0	Thiamine-phosphate synthase	2.01e-10	1.33e-05	NA	0.6725
2. PF	A7FU80	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.71e-08	8.53e-05	NA	0.6477
2. PF	B1L1S5	Deoxyribose-phosphate aldolase	3.94e-10	3.08e-06	NA	0.6671
2. PF	Q8NVH5	Thiamine-phosphate synthase	4.64e-06	4.77e-04	NA	0.6592
2. PF	Q2FH66	Indole-3-glycerol phosphate synthase	9.39e-11	7.00e-09	NA	0.6355
2. PF	Q1XDB4	Uncharacterized protein ycf23	2.75e-11	1.04e-05	NA	0.6096
2. PF	Q8U192	Thiamine-phosphate synthase	1.63e-10	3.43e-06	NA	0.6738
2. PF	Q4A7J6	Deoxyribose-phosphate aldolase	6.70e-11	5.10e-09	NA	0.6566
2. PF	A5I244	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.70e-08	8.53e-05	NA	0.6475
2. PF	Q5E634	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.05e-08	8.76e-08	NA	0.574
2. PF	Q97IU5	Deoxyribose-phosphate aldolase	1.05e-09	1.31e-06	NA	0.6491
2. PF	Q8DDL8	Thiazole synthase	2.54e-09	4.59e-06	NA	0.5515
2. PF	Q9YGA9	Tryptophan synthase alpha chain	4.71e-10	1.49e-07	NA	0.5854
2. PF	Q2YXU9	Indole-3-glycerol phosphate synthase	8.52e-11	1.97e-08	NA	0.6366
2. PF	A5ULP4	Thiamine-phosphate synthase	1.49e-07	3.78e-07	NA	0.652
2. PF	C4Z3P0	Deoxyribose-phosphate aldolase	8.37e-10	1.11e-07	NA	0.6307
2. PF	A4W1L5	Deoxyribose-phosphate aldolase	4.32e-10	2.49e-07	NA	0.6519
2. PF	B8HXS4	Deoxyribose-phosphate aldolase	6.87e-10	3.16e-08	NA	0.5836
2. PF	Q15RU3	Imidazole glycerol phosphate synthase subunit HisF	1.40e-10	1.91e-02	NA	0.6445
2. PF	O26909	Deoxyribose-phosphate aldolase	2.42e-07	1.76e-06	NA	0.6086
2. PF	B0VKA4	Thiazole synthase	3.49e-09	7.32e-09	NA	0.5258
2. PF	Q7W2X9	Imidazole glycerol phosphate synthase subunit HisF	1.25e-09	6.80e-05	NA	0.6387
2. PF	A6Q3P0	Indole-3-glycerol phosphate synthase	9.66e-12	7.00e-07	NA	0.6898
2. PF	Q8ESZ3	Thiamine-phosphate synthase	5.90e-09	8.74e-06	NA	0.6565
2. PF	C1CDJ0	Deoxyribose-phosphate aldolase	6.61e-10	3.11e-06	NA	0.6356
2. PF	A5I237	Deoxyribose-phosphate aldolase	4.24e-10	2.42e-06	NA	0.6208
2. PF	Q04IZ0	Tryptophan synthase alpha chain	5.78e-08	2.69e-06	NA	0.5853
2. PF	A5IWA1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.57e-09	1.22e-07	NA	0.6229
2. PF	A6WNR8	Thiazole synthase	1.93e-09	7.08e-06	NA	0.5405
2. PF	A9KTR8	Tryptophan synthase alpha chain	3.63e-09	6.08e-04	NA	0.5607
2. PF	B1WNQ1	Tryptophan synthase alpha chain	9.69e-10	2.13e-07	NA	0.6084
2. PF	B0TY42	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.01e-09	1.05e-04	NA	0.6179
2. PF	B0UTU0	Deoxyribose-phosphate aldolase	2.47e-07	6.28e-09	NA	0.6179
2. PF	Q2GDS9	Thiazole synthase	1.14e-09	4.19e-10	NA	0.6049
2. PF	B3W6W8	Indole-3-glycerol phosphate synthase	2.87e-08	3.66e-08	NA	0.6387
2. PF	A8MCN3	Triosephosphate isomerase	1.04e-10	7.93e-13	NA	0.6621
2. PF	A1KJ27	Indole-3-glycerol phosphate synthase	1.01e-08	1.39e-08	NA	0.672
2. PF	Q8AA14	Thiazole synthase	1.95e-09	3.38e-05	NA	0.5719
2. PF	B0TDM8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.99e-07	4.46e-06	NA	0.6267
2. PF	B2INW0	Deoxyribose-phosphate aldolase	7.32e-10	2.09e-06	NA	0.6559
2. PF	Q0T5D6	Tryptophan synthase alpha chain	2.84e-09	3.47e-06	NA	0.5628
2. PF	B8HPH2	Tryptophan synthase alpha chain	1.55e-09	7.58e-07	NA	0.6004
2. PF	B1YBK5	Indole-3-glycerol phosphate synthase	2.90e-07	5.05e-09	NA	0.6538
2. PF	Q46GY9	Imidazole glycerol phosphate synthase subunit HisF	2.62e-10	7.41e-04	NA	0.6627
2. PF	Q6GET8	Deoxyribose-phosphate aldolase 2	5.86e-10	1.03e-06	NA	0.6359
2. PF	A9R4U4	Deoxyribose-phosphate aldolase	9.38e-10	3.70e-07	NA	0.6679
2. PF	A8AX59	Deoxyribose-phosphate aldolase	9.74e-10	1.63e-08	NA	0.6416
2. PF	Q5HU56	Thiazole synthase	2.37e-09	2.02e-09	NA	0.5477
2. PF	Q3A247	Deoxyribose-phosphate aldolase	5.37e-10	1.13e-05	NA	0.6411
2. PF	Q97KH9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.44e-08	8.39e-03	NA	0.6156
2. PF	Q1D282	Thiamine-phosphate synthase	1.98e-09	4.29e-06	NA	0.5973
2. PF	A0LHK5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.09e-07	8.36e-04	NA	0.6271
2. PF	Q11CK8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.63e-06	9.08e-06	NA	0.6462
2. PF	B8ZN61	Indole-3-glycerol phosphate synthase	1.88e-08	1.50e-09	NA	0.6572
2. PF	Q9RGS5	Thiamine-phosphate synthase	3.90e-06	5.38e-03	NA	0.6656
2. PF	B7HMQ9	Deoxyribose-phosphate aldolase	7.47e-10	3.82e-08	NA	0.6159
2. PF	B4SFM7	Imidazole glycerol phosphate synthase subunit HisF	3.00e-07	1.36e-02	NA	0.6099
2. PF	B4ESZ9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.42e-08	5.21e-06	NA	0.6026
2. PF	A0LJ58	Indole-3-glycerol phosphate synthase	8.36e-11	1.97e-08	NA	0.662
2. PF	Q97RS5	Thiamine-phosphate synthase 1	6.76e-09	1.44e-03	NA	0.6601
2. PF	Q92EW5	Thiamine-phosphate synthase	5.93e-07	2.03e-07	NA	0.6627
2. PF	Q9PM72	Imidazole glycerol phosphate synthase subunit hisF1	1.23e-10	2.98e-03	NA	0.6468
2. PF	B8ZRB9	Indole-3-glycerol phosphate synthase	6.27e-09	1.27e-08	NA	0.687
2. PF	B9E149	Indole-3-glycerol phosphate synthase	2.52e-10	1.20e-07	NA	0.6704
2. PF	C1C965	Tryptophan synthase alpha chain	5.84e-08	1.09e-05	NA	0.5726
2. PF	Q6D3R0	Deoxyribose-phosphate aldolase	1.22e-09	1.83e-08	NA	0.6227
2. PF	A0AKA1	Deoxyribose-phosphate aldolase	1.32e-09	6.68e-08	NA	0.5716
2. PF	Q822W2	Tryptophan synthase alpha chain	5.25e-10	1.93e-08	NA	0.6522
2. PF	Q466J5	Thiamine-phosphate synthase	8.24e-10	1.60e-04	NA	0.6356
2. PF	B2KBN0	Deoxyribose-phosphate aldolase	8.50e-10	4.04e-04	NA	0.6677
2. PF	B2JZM5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.01e-08	2.71e-05	NA	0.5953
2. PF	Q9HLB6	Triosephosphate isomerase	5.02e-09	5.19e-13	NA	0.5999
2. PF	A4J0M0	Thiazole synthase	3.08e-09	3.98e-07	NA	0.5314
2. PF	B1IEG6	Thiamine-phosphate synthase	3.03e-10	4.91e-06	NA	0.6806
2. PF	Q6GKG7	Deoxyribose-phosphate aldolase 1	5.36e-10	3.90e-07	NA	0.6365
2. PF	B9E4U5	Deoxyribose-phosphate aldolase	1.99e-10	2.63e-08	NA	0.6731
2. PF	Q99Y51	Deoxyribose-phosphate aldolase	6.33e-08	7.58e-07	NA	0.6363
2. PF	Q8CPB2	Indole-3-glycerol phosphate synthase	1.41e-10	3.18e-10	NA	0.6451
2. PF	Q8D8Q4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.99e-08	4.88e-09	NA	0.5744
2. PF	B5ZCA0	Deoxyribose-phosphate aldolase	3.93e-10	1.26e-08	NA	0.5922
2. PF	B7I2M9	Thiazole synthase	3.69e-09	2.37e-08	NA	0.5364
2. PF	Q2YUU4	Deoxyribose-phosphate aldolase 1	5.42e-10	2.36e-07	NA	0.6277
2. PF	C1KZ34	Thiamine-phosphate synthase	5.59e-07	1.53e-07	NA	0.6631
2. PF	A4IN28	Thiamine-phosphate synthase	4.00e-07	9.34e-05	NA	0.6265
2. PF	P66919	Thiamine-phosphate synthase	3.97e-06	5.48e-04	NA	0.67
2. PF	Q8F7V2	Indole-3-glycerol phosphate synthase	1.01e-10	4.38e-09	NA	0.6561
2. PF	Q8Y5R1	Deoxyribose-phosphate aldolase	1.21e-09	4.67e-08	NA	0.5642
2. PF	P61411	Putative thiamine-phosphate synthase	4.17e-10	1.85e-04	NA	0.6174
2. PF	Q081M2	Thiazole synthase	3.22e-09	1.57e-03	NA	0.5642
2. PF	Q8KBW1	Indole-3-glycerol phosphate synthase	1.00e-11	6.20e-07	NA	0.6053
2. PF	Q8CQ93	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.62e-09	5.72e-04	NA	0.6011
2. PF	Q839J1	Deoxyribose-phosphate aldolase	5.75e-10	1.01e-07	NA	0.6238
2. PF	A7GKR4	Thiamine-phosphate synthase	6.31e-10	3.51e-08	NA	0.6337
2. PF	Q31B81	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.01e-06	6.98e-04	NA	0.6053
2. PF	A0KKB4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.27e-08	1.58e-07	NA	0.5795
2. PF	A4TN86	Deoxyribose-phosphate aldolase	1.02e-09	5.72e-07	NA	0.6224
2. PF	B8I3J4	Thiamine-phosphate synthase	1.07e-09	9.63e-07	NA	0.6625
2. PF	B0S0N1	Deoxyribose-phosphate aldolase	5.22e-10	2.69e-06	NA	0.685
2. PF	Q1CAE0	Deoxyribose-phosphate aldolase	8.24e-10	5.72e-07	NA	0.6685
2. PF	Q8CNH7	Deoxyribose-phosphate aldolase	6.12e-10	1.49e-07	NA	0.6632
2. PF	A0R981	Thiamine-phosphate synthase	4.20e-07	2.34e-08	NA	0.62
2. PF	B1HTK8	Deoxyribose-phosphate aldolase	8.08e-10	5.82e-09	NA	0.6242
2. PF	Q65WA1	Deoxyribose-phosphate aldolase	2.29e-07	3.63e-09	NA	0.6127
2. PF	P34793	Tryptophan synthase alpha chain	1.43e-08	5.26e-05	NA	0.5106
2. PF	Q9KSW9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.17e-08	2.13e-07	NA	0.5794
2. PF	A5IM24	Deoxyribose-phosphate aldolase	2.24e-09	3.71e-05	NA	0.6541
2. PF	A8M9N4	Thiamine-phosphate synthase	1.18e-10	1.45e-06	NA	0.6573
2. PF	Q0AJ67	Thiazole synthase	3.15e-09	1.93e-05	NA	0.5376
2. PF	Q9X1P5	Deoxyribose-phosphate aldolase	2.08e-09	6.09e-05	NA	0.6469
2. PF	B1IZ49	Imidazole glycerol phosphate synthase subunit HisF	1.16e-07	4.12e-02	NA	0.6386
2. PF	O67926	Thiazole synthase	4.79e-07	8.40e-08	NA	0.5638
2. PF	Q38XI2	Deoxyribose-phosphate aldolase	7.38e-10	1.83e-07	NA	0.6251
2. PF	Q1D4M2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.19e-09	1.49e-07	NA	0.5806
2. PF	B7JRB1	Thiazole synthase	1.91e-05	4.91e-06	NA	0.5183
2. PF	C1ANN3	Indole-3-glycerol phosphate synthase	5.95e-09	1.39e-08	NA	0.6743
2. PF	A7X4S8	Thiamine-phosphate synthase	4.49e-06	5.48e-04	NA	0.6692
2. PF	Q9RCE7	Tryptophan synthase alpha chain	5.10e-09	1.06e-04	NA	0.5643
2. PF	Q9ZGM0	Putative imidazole glycerol phosphate synthase subunit HisF	3.19e-09	2.21e-03	NA	0.6145
2. PF	Q8DQC4	Deoxyribose-phosphate aldolase	7.62e-10	2.30e-06	NA	0.6558
2. PF	A9R2K8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.03e-08	2.71e-05	NA	0.5991
2. PF	B1YES2	Thiazole synthase	4.70e-09	2.13e-06	NA	0.5201
2. PF	Q5WH87	Thiamine-phosphate synthase	8.09e-10	7.50e-06	NA	0.6407
2. PF	B1KRG4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.55e-09	6.26e-07	NA	0.599
2. PF	A6TMN5	Thiamine-phosphate synthase	4.97e-10	7.73e-09	NA	0.6379
2. PF	A8G8F3	Thiamine-phosphate synthase	8.06e-09	3.35e-02	NA	0.5986
2. PF	Q9Y948	Deoxyribose-phosphate aldolase	3.90e-07	1.68e-08	NA	0.6187
2. PF	A4YGQ6	Triosephosphate isomerase	3.11e-11	1.20e-08	NA	0.6312
2. PF	Q0AQ76	Thiazole synthase	2.43e-05	1.49e-11	NA	0.5372
2. PF	Q8DJZ1	Deoxyribose-phosphate aldolase	2.80e-07	8.33e-06	NA	0.6288
2. PF	O26931	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.22e-10	4.53e-04	NA	0.6041
2. PF	Q9I6B4	Thiazole synthase	3.79e-09	1.20e-06	NA	0.556
2. PF	A1BDW1	Indole-3-glycerol phosphate synthase	3.26e-11	3.71e-06	NA	0.6294
2. PF	B7GEY2	Thiazole synthase	4.27e-09	1.31e-07	NA	0.5536
2. PF	B2G7Q4	Thiamine-phosphate synthase	3.25e-07	2.68e-04	NA	0.6454
2. PF	Q1XDC6	Thiazole synthase	1.34e-08	2.91e-06	NA	0.5482
2. PF	Q1RA49	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.30e-08	3.48e-07	NA	0.5943
2. PF	C5D6J1	Thiazole synthase	1.64e-09	1.37e-08	NA	0.5493
2. PF	Q2YUL2	Thiamine-phosphate synthase	3.80e-06	1.00e-03	NA	0.6726
2. PF	Q6MGR8	Deoxyribose-phosphate aldolase	5.55e-10	1.57e-07	NA	0.646
2. PF	A8MK92	Thiamine-phosphate synthase	3.40e-10	2.66e-08	NA	0.6356
2. PF	Q830K5	Thiamine-phosphate synthase	8.25e-10	1.62e-03	NA	0.6523
2. PF	P61108	Deoxyribose-phosphate aldolase 1	5.45e-10	2.76e-07	NA	0.6345
2. PF	Q03CY1	Indole-3-glycerol phosphate synthase	1.11e-08	4.82e-08	NA	0.6384
2. PF	Q92E87	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.02e-08	7.81e-04	NA	0.6422
2. PF	Q5SKG9	Thiamine-phosphate synthase	1.49e-09	2.63e-03	NA	0.6246
2. PF	C5BV85	Indole-3-glycerol phosphate synthase	7.65e-09	2.29e-08	NA	0.7074
2. PF	Q8DQK4	Thiamine-phosphate synthase 1	8.46e-09	1.89e-03	NA	0.6623
2. PF	Q2SRA7	Deoxyribose-phosphate aldolase	4.33e-10	2.39e-07	NA	0.652
2. PF	B1MBX5	Phosphoribosyl isomerase A	3.38e-07	4.48e-08	NA	0.6174
2. PF	A5UUL3	Thiamine-phosphate synthase	1.08e-09	2.16e-07	NA	0.5539
2. PF	A4T9N5	Indole-3-glycerol phosphate synthase	6.23e-09	5.33e-09	NA	0.6807
2. PF	A3MPU4	Imidazole glycerol phosphate synthase subunit HisF	1.15e-09	9.24e-03	NA	0.6189
2. PF	Q4FNT6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.95e-07	1.82e-03	NA	0.6436
2. PF	C1A4L9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.22e-10	1.43e-06	NA	0.608
2. PF	B0SDS6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.34e-09	2.70e-07	NA	0.6261
2. PF	B7GQS5	Imidazole glycerol phosphate synthase subunit HisF	3.56e-10	6.54e-03	NA	0.6292
2. PF	Q5FLZ2	Deoxyribose-phosphate aldolase	2.53e-09	1.49e-10	NA	0.5963
2. PF	A8Z242	Indole-3-glycerol phosphate synthase	9.81e-11	7.00e-09	NA	0.633
2. PF	B2HQX7	Indole-3-glycerol phosphate synthase	8.57e-09	9.19e-09	NA	0.6778
2. PF	Q02YS6	Thiamine-phosphate synthase	9.47e-07	2.82e-04	NA	0.6211
2. PF	Q64TA1	Thiamine-phosphate synthase	5.10e-09	3.57e-06	NA	0.6022
2. PF	A5TZE0	Thiamine-phosphate synthase	5.48e-09	5.01e-06	NA	0.609
2. PF	A5CVZ0	Thiazole synthase	2.70e-09	1.76e-08	NA	0.5506
2. PF	P61084	Deoxyribose-phosphate aldolase 2	5.86e-10	2.56e-06	NA	0.6287
2. PF	Q63GK3	Thiamine-phosphate synthase	6.27e-10	5.83e-08	NA	0.6436
2. PF	A2BW33	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.07e-06	7.22e-04	NA	0.5957
2. PF	A4XL21	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.73e-08	4.35e-03	NA	0.6512
2. PF	Q71Y27	Deoxyribose-phosphate aldolase	1.25e-09	6.82e-08	NA	0.5716
2. PF	Q97LQ9	Thiamine-phosphate synthase	5.40e-10	7.11e-08	NA	0.6351
2. PF	A6VG83	Thiamine-phosphate synthase	1.21e-10	2.00e-06	NA	0.6364
2. PF	B5YE90	Imidazole glycerol phosphate synthase subunit HisF	2.46e-10	1.81e-04	NA	0.6416
2. PF	B1MBV4	Indole-3-glycerol phosphate synthase	5.37e-09	3.86e-08	NA	0.6853
2. PF	P56141	Tryptophan synthase alpha chain	9.11e-07	4.11e-08	NA	0.6091
2. PF	Q8FLJ5	Tryptophan synthase alpha chain	1.18e-09	2.29e-05	NA	0.5733
2. PF	A1UHJ6	Indole-3-glycerol phosphate synthase	5.33e-09	1.98e-09	NA	0.7014
2. PF	A1KFN6	Thiamine-phosphate synthase	5.12e-09	5.01e-06	NA	0.5811
2. PF	A3QER0	Thiazole synthase	3.67e-09	1.78e-05	NA	0.5433
2. PF	B8ZNP4	Deoxyribose-phosphate aldolase	6.04e-10	3.11e-06	NA	0.6238
2. PF	A3M6Z4	Thiazole synthase	2.59e-09	2.37e-08	NA	0.5327
2. PF	A1BEF7	Thiazole synthase	1.28e-09	1.02e-03	NA	0.5929
2. PF	A9WQA3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.04e-07	6.82e-08	NA	0.588
2. PF	B5QYE5	Thiazole synthase	1.42e-09	1.17e-05	NA	0.5593
2. PF	Q8NWU3	Indole-3-glycerol phosphate synthase	1.06e-10	7.00e-09	NA	0.6355
2. PF	A4WIJ6	Triosephosphate isomerase	9.13e-11	1.02e-11	NA	0.6352
2. PF	Q8TMD6	Thiamine-phosphate synthase	3.46e-07	8.49e-08	NA	0.619
2. PF	P47296	Deoxyribose-phosphate aldolase	1.82e-10	1.16e-07	NA	0.6442
2. PF	B0K2U1	Indole-3-glycerol phosphate synthase	5.42e-09	6.84e-11	NA	0.7131
2. PF	Q72NP6	Indole-3-glycerol phosphate synthase	9.22e-11	4.38e-09	NA	0.6583
2. PF	B3QUZ7	Thiazole synthase	2.12e-09	6.33e-07	NA	0.5888
2. PF	A1RXV6	Geranylgeranylglyceryl phosphate synthase	1.17e-07	9.09e-09	NA	0.578
2. PF	C4LFI3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.29e-08	1.18e-07	NA	0.5906
2. PF	Q8YA44	Thiamine-phosphate synthase	5.93e-07	2.67e-07	NA	0.6595
2. PF	C3LFA6	Thiazole synthase	1.72e-05	4.91e-06	NA	0.5302
2. PF	Q48RH2	Deoxyribose-phosphate aldolase	6.55e-08	4.40e-07	NA	0.6384
2. PF	Q8DLN9	Tryptophan synthase alpha chain	1.68e-09	4.03e-08	NA	0.5463
2. PF	Q81RZ3	Deoxyribose-phosphate aldolase	1.02e-09	9.62e-08	NA	0.6169
2. PF	B9IXA5	Deoxyribose-phosphate aldolase	7.79e-10	5.24e-08	NA	0.6158
2. PF	A0QX95	Indole-3-glycerol phosphate synthase	6.15e-09	5.22e-09	NA	0.6653
2. PF	Q8RI59	Thiamine-phosphate synthase	1.23e-06	1.16e-03	NA	0.6494
2. PF	B2SKN4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.24e-10	2.12e-05	NA	0.617
2. PF	P57937	Deoxyribose-phosphate aldolase	2.46e-07	3.40e-09	NA	0.6331
2. PF	B8ZN58	Tryptophan synthase alpha chain	6.30e-08	1.24e-05	NA	0.5872
2. PF	Q8DWZ0	Deoxyribose-phosphate aldolase	5.30e-08	1.53e-07	NA	0.6356
2. PF	B2I6S5	Indole-3-glycerol phosphate synthase	4.46e-10	8.40e-08	NA	0.6906
2. PF	Q0SHZ5	Indole-3-glycerol phosphate synthase	5.34e-09	7.18e-08	NA	0.6738
2. PF	B1AJM6	Deoxyribose-phosphate aldolase	4.68e-10	2.52e-09	NA	0.6437
2. PF	Q8EMT9	Deoxyribose-phosphate aldolase 2	1.57e-10	3.49e-10	NA	0.6726
2. PF	Q73QJ5	Deoxyribose-phosphate aldolase	1.08e-09	5.69e-09	NA	0.6711
2. PF	A8MH18	Deoxyribose-phosphate aldolase	1.29e-09	2.39e-07	NA	0.6633
2. PF	Q5LYI8	Tryptophan synthase alpha chain	6.28e-08	2.93e-07	NA	0.5896
2. PF	A4SG41	Indole-3-glycerol phosphate synthase	1.22e-11	3.59e-07	NA	0.6406
2. PF	O74044	Triosephosphate isomerase	4.86e-10	4.70e-11	NA	0.643
2. PF	Q5LCA7	Thiamine-phosphate synthase	3.90e-09	5.21e-06	NA	0.6172
2. PF	P0CH94	Deoxyribose-phosphate aldolase	3.91e-09	5.03e-05	NA	0.6219
2. PF	Q65DK0	Thiamine-phosphate synthase	8.25e-07	2.04e-09	NA	0.6069
2. PF	B4EYU2	Thiamine-phosphate synthase	2.78e-06	3.18e-06	NA	0.5698
2. PF	Q24XQ0	Thiamine-phosphate synthase	6.65e-10	7.98e-08	NA	0.6513
2. PF	A4FLL0	Indole-3-glycerol phosphate synthase	7.27e-09	6.16e-10	NA	0.6987
2. PF	A0PP28	Indole-3-glycerol phosphate synthase	7.84e-09	1.37e-08	NA	0.6903
2. PF	Q65L94	Thiazole synthase	2.30e-09	1.04e-04	NA	0.5666
2. PF	P58800	Imidazole glycerol phosphate synthase subunit HisF	1.63e-10	1.17e-02	NA	0.6395
2. PF	Q8AA13	Thiamine-phosphate synthase	3.76e-09	4.28e-03	NA	0.6176
2. PF	Q92A19	Deoxyribose-phosphate aldolase	1.40e-09	7.57e-08	NA	0.5713
2. PF	B1W0N8	Indole-3-glycerol phosphate synthase	4.53e-09	5.31e-10	NA	0.6849
2. PF	B9LAF4	Indole-3-glycerol phosphate synthase	1.75e-11	4.94e-09	NA	0.6852
2. PF	A6UWA5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.11e-10	2.24e-04	NA	0.65
2. PF	A8FIR6	Thiamine-phosphate synthase	7.28e-07	1.62e-07	NA	0.6119
2. PF	Q30SM1	Indole-3-glycerol phosphate synthase	7.68e-12	7.57e-08	NA	0.706
2. PF	B8D115	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.55e-07	3.82e-03	NA	0.6467
2. PF	Q47R37	Thiazole synthase	6.52e-09	2.39e-08	NA	0.5464
2. PF	B8FUD4	Thiamine-phosphate synthase	3.07e-07	4.78e-09	NA	0.6518
2. PF	B0SXB0	Thiazole synthase	3.59e-09	2.28e-10	NA	0.5261
2. PF	Q9RVT0	Tryptophan synthase alpha chain	2.30e-08	1.56e-05	NA	0.6154
2. PF	B4U2S5	Deoxyribose-phosphate aldolase	6.42e-10	1.85e-07	NA	0.6533
2. PF	Q5HE63	Deoxyribose-phosphate aldolase 2	5.27e-10	1.68e-06	NA	0.6379
2. PF	Q81IG8	Thiamine-phosphate synthase	5.32e-10	2.82e-09	NA	0.6219
2. PF	B0K8T4	Indole-3-glycerol phosphate synthase	4.50e-09	1.77e-10	NA	0.7109
2. PF	C3L627	Thiamine-phosphate synthase	8.34e-10	1.31e-07	NA	0.6386
2. PF	Q7NAQ0	Deoxyribose-phosphate aldolase	2.20e-10	1.43e-09	NA	0.6505
2. PF	A7GDP8	Deoxyribose-phosphate aldolase	5.52e-10	1.50e-05	NA	0.6557
2. PF	O58878	Thiamine-phosphate synthase	7.12e-11	2.44e-05	NA	0.6594
2. PF	B5XID8	Deoxyribose-phosphate aldolase	6.40e-08	7.58e-07	NA	0.6381
2. PF	B4ENZ2	Deoxyribose-phosphate aldolase	9.19e-10	9.33e-08	NA	0.642
2. PF	Q3B4B1	Thiamine-phosphate synthase	8.13e-10	4.42e-05	NA	0.5944
2. PF	A4W5B3	Thiazole synthase	1.68e-09	2.00e-06	NA	0.5397
2. PF	Q2FM63	Thiamine-phosphate synthase	1.60e-09	5.77e-04	NA	0.6314
2. PF	A3D465	Thiazole synthase	1.95e-09	6.88e-06	NA	0.5409
2. PF	Q49Z39	Thiamine-phosphate synthase	2.79e-06	9.93e-03	NA	0.6547
2. PF	C3L061	Thiamine-phosphate synthase	4.13e-10	1.36e-04	NA	0.6804
2. PF	Q97VM8	Triosephosphate isomerase	8.08e-11	2.36e-09	NA	0.6312
2. PF	C1CT50	Tryptophan synthase alpha chain	5.37e-08	7.94e-06	NA	0.577
2. PF	Q8ZX28	Triosephosphate isomerase	1.38e-10	7.52e-12	NA	0.6442
2. PF	Q609Z5	Thiazole synthase	3.00e-09	3.69e-10	NA	0.5255
2. PF	A7H4P0	Indole-3-glycerol phosphate synthase	1.82e-12	6.13e-06	NA	0.6755
2. PF	Q3AYT2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.66e-07	3.26e-03	NA	0.5796
2. PF	Q8E092	Thiamine-phosphate synthase	1.97e-08	2.84e-03	NA	0.6355
2. PF	Q6D407	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.72e-09	2.76e-05	NA	0.5859
2. PF	P66990	Indole-3-glycerol phosphate synthase	9.30e-11	9.81e-09	NA	0.6458
2. PF	Q49XH6	Indole-3-glycerol phosphate synthase	8.88e-11	4.27e-07	NA	0.6349
2. PF	Q8EWT4	Deoxyribose-phosphate aldolase	3.23e-07	4.88e-09	NA	0.6658
2. PF	Q2RHX4	Thiazole synthase	2.54e-09	1.02e-07	NA	0.5372
2. PF	A4XZZ8	Thiazole synthase	2.82e-09	3.31e-07	NA	0.5624
2. PF	A8FC15	Thiazole synthase	1.79e-09	4.36e-07	NA	0.5677
2. PF	B8GWP9	Indole-3-glycerol phosphate synthase	5.83e-11	4.77e-07	NA	0.6007
2. PF	Q8PLG7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.17e-10	7.43e-06	NA	0.6456
2. PF	A6VXY2	Thiazole synthase	4.10e-09	1.76e-06	NA	0.5707
2. PF	Q890C0	Thiamine-phosphate synthase	5.89e-07	1.19e-04	NA	0.6444
2. PF	A2RKJ7	Thiamine-phosphate synthase	6.60e-07	6.03e-03	NA	0.6214
2. PF	A6M1W6	Thiamine-phosphate synthase	2.85e-09	5.61e-07	NA	0.6711
2. PF	Q5KZU0	Thiamine-phosphate synthase	1.14e-09	4.72e-03	NA	0.6317
2. PF	Q2S2A8	Thiamine-phosphate synthase	5.58e-10	2.29e-05	NA	0.5912
2. PF	A6U1J2	Indole-3-glycerol phosphate synthase	9.76e-11	9.81e-09	NA	0.643
2. PF	Q3K1L6	Thiamine-phosphate synthase	1.66e-08	2.84e-03	NA	0.6353
2. PF	Q2KTT1	Imidazole glycerol phosphate synthase subunit HisF	8.16e-10	3.16e-03	NA	0.6432
2. PF	B9J523	Thiazole synthase	1.64e-05	1.60e-06	NA	0.5315
2. PF	B0U1P0	Indole-3-glycerol phosphate synthase	4.40e-10	1.48e-08	NA	0.7068
2. PF	Q9A727	Indole-3-glycerol phosphate synthase	5.70e-11	4.77e-07	NA	0.5981
2. PF	A6QGS2	Indole-3-glycerol phosphate synthase	9.50e-11	2.61e-08	NA	0.6351
2. PF	P61410	Thiamine-phosphate synthase	6.41e-10	2.42e-08	NA	0.5912
2. PF	A9A6L5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.04e-10	2.94e-06	NA	0.6579
2. PF	A5FYE4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.95e-07	8.26e-03	NA	0.6171
2. PF	A3DJF6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.77e-07	1.55e-02	NA	0.6194
2. PF	Q2RGI8	Thiamine-phosphate synthase	3.73e-10	9.33e-08	NA	0.6209
2. PF	P00930	Tryptophan synthase alpha chain	3.14e-09	3.54e-05	NA	0.6003
2. PF	B7K8P2	Deoxyribose-phosphate aldolase	4.06e-10	5.39e-09	NA	0.6316
2. PF	A5UCY8	Deoxyribose-phosphate aldolase	1.76e-07	4.27e-07	NA	0.6162
2. PF	B8DBT6	Deoxyribose-phosphate aldolase	1.30e-09	1.93e-08	NA	0.5718
2. PF	A4YHD8	Indole-3-glycerol phosphate synthase	2.21e-11	8.52e-09	NA	0.6651
2. PF	Q2RRZ2	Deoxyribose-phosphate aldolase	6.90e-10	7.90e-09	NA	0.6477
2. PF	Q6LVX7	Thiazole synthase	1.33e-09	1.62e-05	NA	0.5342
2. PF	B1JRK6	Deoxyribose-phosphate aldolase	8.48e-10	5.72e-07	NA	0.6504
2. PF	B8GQT0	Thiazole synthase	2.97e-09	5.69e-09	NA	0.541
2. PF	B2UY65	Thiamine-phosphate synthase	1.96e-09	6.72e-07	NA	0.6722
2. PF	Q9UZQ5	Thiamine-phosphate synthase	1.49e-10	3.24e-06	NA	0.6293
2. PF	Q87EX2	Indole-3-glycerol phosphate synthase	4.43e-10	8.40e-08	NA	0.6939
2. PF	Q6G7H3	Deoxyribose-phosphate aldolase 2	5.52e-10	3.11e-06	NA	0.6235
2. PF	B1YLS2	Indole-3-glycerol phosphate synthase	1.26e-12	1.38e-09	NA	0.6544
2. PF	B5XYE8	Thiazole synthase	1.50e-09	4.63e-07	NA	0.559
2. PF	Q7TTU8	Tryptophan synthase alpha chain	4.00e-09	7.08e-06	NA	0.6112
2. PF	A1T2Z5	Thiamine-phosphate synthase	1.27e-09	9.83e-08	NA	0.62
2. PF	A6VQ73	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.48e-09	1.02e-06	NA	0.638
2. PF	A8G8F0	Thiazole synthase	2.49e-09	1.57e-05	NA	0.534
2. PF	P61413	Thiamine-phosphate synthase	1.49e-10	6.72e-07	NA	0.6422
2. PF	B1IUQ7	Thiazole synthase	1.49e-09	3.71e-06	NA	0.5446
2. PF	Q2FF35	Thiamine-phosphate synthase	3.77e-06	5.48e-04	NA	0.6619
2. PF	A6QCU4	Imidazole glycerol phosphate synthase subunit HisF	5.26e-07	7.74e-04	NA	0.6495
2. PF	A7FU73	Deoxyribose-phosphate aldolase	5.45e-10	2.42e-06	NA	0.6246
2. PF	Q8RB49	Deoxyribose-phosphate aldolase	6.10e-10	5.57e-09	NA	0.6049
2. PF	A1R562	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.94e-07	2.47e-09	NA	0.6306
2. PF	B1HX34	Thiamine-phosphate synthase	9.48e-07	2.05e-03	NA	0.6104
2. PF	A1RUV7	Triosephosphate isomerase	1.78e-10	3.42e-11	NA	0.6593
2. PF	A1VYK3	Indole-3-glycerol phosphate synthase	1.80e-12	1.12e-06	NA	0.6801
2. PF	B5E7M5	Indole-3-glycerol phosphate synthase	1.90e-08	1.50e-09	NA	0.6694
2. PF	A8Z5H4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.31e-09	5.64e-08	NA	0.63
2. PF	Q1CG96	Deoxyribose-phosphate aldolase	9.12e-10	5.72e-07	NA	0.6629
2. PF	Q893R0	Thiamine-phosphate synthase	2.03e-09	1.01e-04	NA	0.6564
2. PF	B2S2L2	Deoxyribose-phosphate aldolase	8.77e-10	3.59e-07	NA	0.6347
2. PF	Q740P4	Indole-3-glycerol phosphate synthase	5.54e-09	2.70e-09	NA	0.6774
2. PF	Q4L7X3	Thiamine-phosphate synthase	3.73e-06	9.86e-05	NA	0.6588
2. PF	Q3IP34	Thiamine-phosphate synthase	6.47e-10	2.03e-05	NA	0.6179
2. PF	Q9ZJV0	Tryptophan synthase alpha chain	1.21e-06	4.43e-09	NA	0.5609
2. PF	Q03NS1	Thiamine-phosphate synthase	1.26e-06	4.50e-06	NA	0.6338
2. PF	A2RKR7	Imidazole glycerol phosphate synthase subunit HisF	2.86e-10	9.69e-03	NA	0.6409
2. PF	Q9RPQ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.82e-07	4.94e-02	NA	0.6262
2. PF	Q4QLH8	Deoxyribose-phosphate aldolase	1.72e-07	1.57e-07	NA	0.6147
2. PF	C0MG52	Deoxyribose-phosphate aldolase	7.11e-10	1.85e-07	NA	0.6533
2. PF	C1EVE6	Thiamine-phosphate synthase	4.44e-07	4.03e-08	NA	0.6231
2. PF	Q9YBR1	Triosephosphate isomerase	3.26e-10	1.31e-10	NA	0.6424
2. PF	A7ZAF1	Deoxyribose-phosphate aldolase	5.62e-10	3.75e-06	NA	0.6115
2. PF	O19915	Thiazole synthase	7.95e-05	3.18e-06	NA	0.5417
2. PF	C1EYJ3	Thiazole synthase	1.58e-05	1.48e-06	NA	0.5218
2. PF	B1XI10	Deoxyribose-phosphate aldolase	1.82e-10	2.00e-09	NA	0.6432
2. PF	A3D631	Tryptophan synthase alpha chain	3.37e-09	8.15e-04	NA	0.5652
2. PF	B0SLU9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.45e-10	2.70e-07	NA	0.6292
2. PF	Q0RFX1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.16e-07	7.73e-07	NA	0.6197
2. PF	Q8XKQ8	Thiamine-phosphate synthase	2.17e-09	4.84e-05	NA	0.6008
2. PF	Q4L819	Deoxyribose-phosphate aldolase	6.45e-10	4.40e-07	NA	0.6429
2. PF	Q6GCY6	Deoxyribose-phosphate aldolase 1	6.08e-10	3.31e-07	NA	0.649
2. PF	A6U3H7	Thiamine-phosphate synthase	4.58e-06	5.48e-04	NA	0.6591
2. PF	Q1J9Z9	Deoxyribose-phosphate aldolase	6.07e-08	6.72e-07	NA	0.6305
2. PF	Q2RNA6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.34e-07	2.46e-06	NA	0.5999
2. PF	Q46JH4	Indole-3-glycerol phosphate synthase	6.63e-10	2.57e-03	NA	0.6864
2. PF	Q6GEY4	Thiamine-phosphate synthase	4.22e-06	4.22e-04	NA	0.6699
2. PF	P99174	Deoxyribose-phosphate aldolase 2	5.47e-10	2.56e-06	NA	0.6296
2. PF	Q03CB2	Thiamine-phosphate synthase	7.47e-10	9.77e-03	NA	0.6471
2. PF	O59536	Triosephosphate isomerase	8.68e-11	9.51e-15	NA	0.6636
2. PF	B2VFL2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.22e-08	6.01e-06	NA	0.593
2. PF	Q4JCD8	Triosephosphate isomerase	5.42e-11	4.69e-04	NA	0.6583
2. PF	Q0I2N7	Deoxyribose-phosphate aldolase	2.25e-07	6.28e-09	NA	0.6009
2. PF	A5VKA1	Thiamine-phosphate synthase	3.63e-07	2.68e-04	NA	0.6281
2. PF	C1C968	Indole-3-glycerol phosphate synthase	2.02e-08	1.28e-10	NA	0.6444
2. PF	P17217	Indole-3-glycerol phosphate synthase	1.10e-08	3.59e-08	NA	0.6379
2. PF	A4Y7H1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.08e-06	3.51e-09	NA	0.6074
2. PF	Q3Z6G5	Indole-3-glycerol phosphate synthase	6.33e-11	6.21e-09	NA	0.6867
2. PF	B7N2J2	Thiazole synthase	1.84e-09	6.20e-07	NA	0.5571
2. PF	P44430	Deoxyribose-phosphate aldolase	2.01e-07	4.49e-07	NA	0.6068
2. PF	Q5HJN0	Deoxyribose-phosphate aldolase 1	5.50e-10	2.76e-07	NA	0.6344
2. PF	Q0P8U3	Putative imidazole glycerol phosphate synthase subunit hisF2	1.23e-06	6.28e-03	NA	0.6579
2. PF	Q4A9F7	Deoxyribose-phosphate aldolase	7.42e-11	3.74e-08	NA	0.6483
2. PF	A5F4E2	Thiazole synthase	1.61e-09	1.16e-05	NA	0.5997
2. PF	B0V876	Thiazole synthase	3.24e-09	2.37e-08	NA	0.5329
2. PF	Q9PGT5	Indole-3-glycerol phosphate synthase	4.33e-10	5.89e-08	NA	0.6949
2. PF	A7X764	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.78e-09	1.22e-07	NA	0.6224
2. PF	Q9CLM1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.50e-09	3.18e-07	NA	0.5698
2. PF	Q63CR9	Deoxyribose-phosphate aldolase	1.04e-09	9.62e-08	NA	0.6156
2. PF	A6WC96	Imidazole glycerol phosphate synthase subunit HisF	2.40e-10	3.26e-03	NA	0.6578
2. PF	Q9X7C7	Indole-3-glycerol phosphate synthase	5.73e-09	1.27e-08	NA	0.6779
2. PF	Q18GX9	Thiamine-phosphate synthase	1.14e-09	1.53e-04	NA	0.562
2. PF	A1JM38	Deoxyribose-phosphate aldolase	9.64e-10	4.20e-08	NA	0.6575
2. PF	B0KA53	Deoxyribose-phosphate aldolase	4.01e-10	1.06e-07	NA	0.6247
2. PF	B3PM95	Deoxyribose-phosphate aldolase	1.95e-10	1.29e-06	NA	0.6543
2. PF	Q8P9P0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.92e-10	1.80e-04	NA	0.6258
2. PF	Q5UZH1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.30e-07	1.83e-05	NA	0.6026
2. PF	A5N0Z3	Deoxyribose-phosphate aldolase	3.36e-10	2.63e-08	NA	0.686
2. PF	Q72KL8	Thiamine-phosphate synthase	8.41e-10	2.63e-03	NA	0.6251
2. PF	A7N9D1	Tryptophan synthase alpha chain	3.30e-09	5.71e-05	NA	0.5794
2. PF	A5IUN7	Thiamine-phosphate synthase	3.76e-06	5.48e-04	NA	0.6656
2. PF	P62354	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.62e-10	5.07e-05	NA	0.6181
2. PF	O27120	Triosephosphate isomerase	9.69e-11	1.82e-15	NA	0.6441
2. PF	B7H7H5	Thiamine-phosphate synthase	5.30e-10	2.28e-09	NA	0.6289
2. PF	Q6G7L9	Thiamine-phosphate synthase	3.73e-06	4.77e-04	NA	0.6623
2. PF	A2RK45	Deoxyribose-phosphate aldolase	5.86e-10	1.83e-07	NA	0.629
2. PF	C3PBW1	Thiamine-phosphate synthase	8.18e-10	1.31e-07	NA	0.6387
2. PF	A5TZE3	Thiazole synthase	3.16e-09	5.41e-08	NA	0.5615
2. PF	Q0AZ86	Thiamine-phosphate synthase	1.52e-10	1.04e-06	NA	0.636
2. PF	B4ESZ8	Imidazole glycerol phosphate synthase subunit HisF	1.36e-07	8.73e-03	NA	0.6394
2. PF	Q7U851	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.06e-07	4.73e-04	NA	0.6386
2. PF	A7MJ80	Thiamine-phosphate synthase	2.11e-06	2.53e-02	NA	0.5762
2. PF	Q3JAP1	Thiazole synthase	2.53e-09	1.25e-07	NA	0.5243
2. PF	Q5L6R5	Thiamine-phosphate synthase	5.81e-08	1.58e-06	NA	0.6916
2. PF	P60715	Imidazole glycerol phosphate synthase subunit HisF	2.42e-10	1.73e-03	NA	0.6163
2. PF	Q8NYR1	Deoxyribose-phosphate aldolase 1	7.92e-10	3.31e-07	NA	0.6371
2. PF	Q0AW40	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.80e-07	1.43e-05	NA	0.633
2. PF	P99102	Deoxyribose-phosphate aldolase 1	5.25e-10	2.76e-07	NA	0.6345
2. PF	Q88UE2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.93e-10	2.25e-03	NA	0.6385
2. PF	A3DDS7	Indole-3-glycerol phosphate synthase	1.28e-11	4.11e-08	NA	0.7088
2. PF	A5FPM3	Indole-3-glycerol phosphate synthase	3.27e-11	4.28e-09	NA	0.6847
2. PF	A6QKG2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.39e-09	5.64e-08	NA	0.6233
2. PF	Q8ESS1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.77e-07	1.63e-04	NA	0.6367
2. PF	Q88Z64	Deoxyribose-phosphate aldolase	1.52e-09	6.62e-06	NA	0.6484
2. PF	Q8E5W9	Thiamine-phosphate synthase	2.03e-08	3.16e-03	NA	0.6353
2. PF	P66918	Thiamine-phosphate synthase	3.84e-06	5.48e-04	NA	0.66
2. PF	Q02U32	Thiazole synthase	3.88e-09	1.20e-06	NA	0.5564
2. PF	B1ZW79	Indole-3-glycerol phosphate synthase	2.59e-08	4.77e-08	NA	0.649
2. PF	Q8R806	Thiamine-phosphate synthase	3.12e-07	1.40e-03	NA	0.659
2. PF	C4Z138	Indole-3-glycerol phosphate synthase	5.24e-10	2.66e-05	NA	0.6716
2. PF	Q4ZMV1	Deoxyribose-phosphate aldolase	5.23e-10	3.82e-08	NA	0.639
3. BF	Q8FWN5	Bifunctional enzyme NanE/NanK	1.11e-16	NA	2.64e-32	0.9008
3. BF	Q8YBP2	Bifunctional enzyme NanE/NanK	1.11e-16	NA	2.09e-32	0.9014
4. PB	Q7NHC5	Tryptophan synthase alpha chain	2.13e-09	1.14e-05	0.002	NA
4. PB	B8D970	Tryptophan synthase alpha chain	9.84e-07	2.87e-07	0.023	NA
4. PB	Q2G157	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	5.73e-33	1.40e-66	NA
4. PB	A7H2Z6	Thiazole synthase	2.96e-09	1.85e-09	0.033	NA
4. PB	Q8ESU5	Tryptophan synthase alpha chain	3.11e-06	3.82e-07	0.001	NA
4. PB	A3MZI8	Tryptophan synthase alpha chain	3.53e-09	1.23e-07	0.035	NA
4. PB	P57365	Tryptophan synthase alpha chain	1.29e-06	2.87e-07	0.023	NA
4. PB	B0BU73	Tryptophan synthase alpha chain	3.40e-09	4.29e-08	0.019	NA
4. PB	P0A761	Putative N-acetylmannosamine-6-phosphate 2-epimerase	0.00e+00	2.88e-30	8.50e-38	NA
4. PB	B0UU33	Tryptophan synthase alpha chain	4.24e-09	3.15e-07	0.002	NA
4. PB	B3GX47	Tryptophan synthase alpha chain	4.29e-09	8.52e-09	0.022	NA
4. PB	P57854	Tryptophan synthase alpha chain	3.56e-09	2.39e-06	0.027	NA
4. PB	O69190	Pyridoxal 5'-phosphate synthase subunit PdxS (Fragment)	1.12e-09	4.33e-11	0.022	NA
5. P	B5ZV92	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.56e-06	1.26e-04	NA	NA
5. P	Q0SHY7	Imidazole glycerol phosphate synthase subunit HisF	2.34e-07	6.23e-03	NA	NA
5. P	C1EV72	Heptaprenylglyceryl phosphate synthase	8.63e-06	1.33e-10	NA	NA
5. P	Q3MBD2	Tryptophan synthase alpha chain	2.58e-09	2.08e-05	NA	NA
5. P	Q3K5V4	Indole-3-glycerol phosphate synthase	2.72e-10	3.05e-06	NA	NA
5. P	C0QWR6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.94e-10	3.57e-05	NA	NA
5. P	P9WG73	Thiazole synthase	3.28e-09	5.41e-08	NA	NA
5. P	Q83RA1	3-dehydroquinate dehydratase	2.24e-08	1.16e-03	NA	NA
5. P	Q3SWF0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.28e-06	6.75e-06	NA	NA
5. P	Q8U213	Geranylgeranylglyceryl phosphate synthase	1.94e-10	1.07e-10	NA	NA
5. P	Q2NYD7	Indole-3-glycerol phosphate synthase	1.68e-10	2.02e-08	NA	NA
5. P	Q64SX3	Tryptophan synthase alpha chain	4.89e-06	3.11e-05	NA	NA
5. P	A8FEJ7	Tryptophan synthase alpha chain	1.59e-09	5.07e-05	NA	NA
5. P	A6L645	Thiamine-phosphate synthase	4.25e-09	6.26e-05	NA	NA
5. P	B1JUU5	Indole-3-glycerol phosphate synthase	1.36e-10	4.19e-09	NA	NA
5. P	Q5V0G6	Thiamine-phosphate synthase	7.21e-10	3.02e-07	NA	NA
5. P	Q9K6Z6	Imidazole glycerol phosphate synthase subunit HisF	1.22e-10	2.57e-03	NA	NA
5. P	Q88MY2	Pyridoxine 5'-phosphate synthase	3.05e-08	1.53e-08	NA	NA
5. P	A8AKT3	Thiazole synthase	1.70e-09	1.48e-06	NA	NA
5. P	Q7W387	Indole-3-glycerol phosphate synthase	9.25e-11	2.39e-06	NA	NA
5. P	Q31R76	Tryptophan synthase alpha chain	2.17e-10	1.24e-05	NA	NA
5. P	C0Q3N3	Tryptophan synthase alpha chain	3.70e-09	3.67e-07	NA	NA
5. P	B3DF93	Pyridoxine 5'-phosphate synthase	1.23e-08	2.77e-11	NA	NA
5. P	A8ZZW7	Tryptophan synthase alpha chain	2.20e-09	6.07e-06	NA	NA
5. P	Q8PXE7	3-dehydroquinate dehydratase	1.55e-07	1.51e-02	NA	NA
5. P	A9KZ80	Deoxyribose-phosphate aldolase	4.78e-09	3.75e-03	NA	NA
5. P	O30128	Putative 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 2	1.43e-09	2.61e-02	NA	NA
5. P	B4TX39	Tryptophan synthase alpha chain	3.72e-09	1.91e-07	NA	NA
5. P	B5R6M4	Tryptophan synthase alpha chain	3.74e-09	3.78e-07	NA	NA
5. P	P63930	Deoxyribose-phosphate aldolase	1.34e-10	8.95e-03	NA	NA
5. P	Q12NS9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.65e-09	9.43e-06	NA	NA
5. P	Q88QR6	Indole-3-glycerol phosphate synthase	3.00e-10	8.55e-07	NA	NA
5. P	A5IBF6	N-(5'-phosphoribosyl)anthranilate isomerase	1.58e-06	1.83e-04	NA	NA
5. P	P26938	Indole-3-glycerol phosphate synthase	2.42e-10	5.16e-09	NA	NA
5. P	Q9PDN8	Copper homeostasis protein CutC	3.29e-08	3.05e-03	NA	NA
5. P	B9M0L9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.91e-09	1.37e-09	NA	NA
5. P	C3LAW0	Indole-3-glycerol phosphate synthase	2.61e-08	3.55e-11	NA	NA
5. P	Q31HP0	Pyridoxine 5'-phosphate synthase	1.68e-08	2.55e-09	NA	NA
5. P	A2C0N7	Imidazole glycerol phosphate synthase subunit HisF	2.83e-10	1.43e-02	NA	NA
5. P	B2HQU3	Deoxyribose-phosphate aldolase	1.36e-10	1.74e-05	NA	NA
5. P	B7K3A9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.41e-07	1.86e-04	NA	NA
5. P	A0KMD1	Tryptophan synthase alpha chain	1.29e-09	3.14e-06	NA	NA
5. P	A0RRT8	Imidazole glycerol phosphate synthase subunit HisF	4.05e-10	3.16e-03	NA	NA
5. P	Q0A9A1	Tryptophan synthase alpha chain	1.54e-06	1.43e-04	NA	NA
5. P	B7V0S0	Tryptophan synthase alpha chain	4.84e-05	3.78e-07	NA	NA
5. P	Q1C9R5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.16e-08	2.71e-05	NA	NA
5. P	P59119	Imidazole glycerol phosphate synthase subunit HisF	1.31e-10	1.35e-02	NA	NA
5. P	A6U9C5	Indole-3-glycerol phosphate synthase	1.90e-07	2.54e-07	NA	NA
5. P	B5FU65	Tryptophan synthase alpha chain	3.94e-09	3.78e-07	NA	NA
5. P	C3K6V3	Imidazole glycerol phosphate synthase subunit HisF	3.80e-10	1.21e-03	NA	NA
5. P	P26920	Tryptophan synthase alpha chain	2.13e-05	1.97e-08	NA	NA
5. P	Q82UQ7	Thiamine-phosphate synthase	7.29e-11	7.81e-08	NA	NA
5. P	O26102	Pyridoxine 5'-phosphate synthase	7.14e-07	2.33e-05	NA	NA
5. P	Q2JSG7	Pyridoxine 5'-phosphate synthase	1.12e-08	1.38e-09	NA	NA
5. P	Q6BF16	2-dehydro-3-deoxy-6-phosphogalactonate aldolase	4.32e-10	2.14e-02	NA	NA
5. P	B1JPW4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.09e-08	2.71e-05	NA	NA
5. P	A4QFF9	Imidazole glycerol phosphate synthase subunit HisF	2.88e-10	2.45e-04	NA	NA
5. P	Q3SRJ3	Indole-3-glycerol phosphate synthase	2.55e-07	2.01e-07	NA	NA
5. P	O84173	Tryptophan synthase alpha chain	7.25e-07	9.93e-07	NA	NA
5. P	A9KNX3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.39e-07	1.35e-05	NA	NA
5. P	A5INE6	Imidazole glycerol phosphate synthase subunit HisF	1.00e-07	3.55e-04	NA	NA
5. P	Q04539	Ribulose-phosphate 3-epimerase 2	1.67e-08	2.54e-04	NA	NA
5. P	B0KV24	Pyridoxine 5'-phosphate synthase	2.99e-08	6.93e-09	NA	NA
5. P	Q3MA33	N-(5'-phosphoribosyl)anthranilate isomerase	7.55e-08	3.35e-02	NA	NA
5. P	B0T3H6	Pyridoxine 5'-phosphate synthase	3.68e-08	8.21e-07	NA	NA
5. P	Q8CPB0	Tryptophan synthase alpha chain	2.88e-06	1.24e-06	NA	NA
5. P	Q31AB8	Pyridoxine 5'-phosphate synthase	5.91e-09	5.24e-08	NA	NA
5. P	B3QSI0	Imidazole glycerol phosphate synthase subunit HisF	1.53e-07	1.15e-03	NA	NA
5. P	Q9HJH3	Geranylgeranylglyceryl phosphate synthase	2.31e-10	6.01e-09	NA	NA
5. P	B8GQE5	Tryptophan synthase alpha chain	6.65e-07	9.49e-09	NA	NA
5. P	O31139	Imidazole glycerol phosphate synthase subunit HisF	2.82e-10	2.45e-04	NA	NA
5. P	B8GW15	Imidazole glycerol phosphate synthase subunit HisF	2.25e-07	5.93e-03	NA	NA
5. P	B7HSW3	Heptaprenylglyceryl phosphate synthase	7.72e-06	2.21e-10	NA	NA
5. P	B9JMX8	Thiazole synthase	6.98e-09	3.29e-03	NA	NA
5. P	A4ITL5	Probable transaldolase	1.12e-08	4.72e-02	NA	NA
5. P	Q5FHH4	Pyridoxine 5'-phosphate synthase	1.03e-08	3.50e-11	NA	NA
5. P	B1J538	N-(5'-phosphoribosyl)anthranilate isomerase	1.46e-06	2.68e-02	NA	NA
5. P	Q8NNY6	Thiazole synthase	6.37e-09	8.65e-06	NA	NA
5. P	Q4L7M1	Heptaprenylglyceryl phosphate synthase	1.20e-05	1.83e-08	NA	NA
5. P	Q5HKP1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.78e-09	1.14e-04	NA	NA
5. P	O30009	2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1	5.22e-09	3.32e-02	NA	NA
5. P	C1FSC1	Thiamine-phosphate synthase	3.04e-10	3.43e-06	NA	NA
5. P	Q88WI2	Indole-3-glycerol phosphate synthase	8.68e-09	4.10e-09	NA	NA
5. P	Q6GDD0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.27e-09	7.89e-08	NA	NA
5. P	Q6LPA3	Tryptophan synthase alpha chain	1.71e-09	4.03e-05	NA	NA
5. P	O67098	Ribulose-phosphate 3-epimerase	5.21e-09	1.46e-04	NA	NA
5. P	P58314	Fructose-bisphosphate aldolase class 1	1.82e-09	2.40e-02	NA	NA
5. P	A9M9R9	Imidazole glycerol phosphate synthase subunit HisF	4.22e-10	1.17e-04	NA	NA
5. P	A7X013	3-dehydroquinate dehydratase	9.09e-07	1.91e-02	NA	NA
5. P	B7IS80	Deoxyribose-phosphate aldolase	6.21e-10	1.10e-07	NA	NA
5. P	P12291	Tryptophan synthase alpha chain	8.00e-05	7.29e-04	NA	NA
5. P	A0RNN3	Indole-3-glycerol phosphate synthase	3.97e-12	1.85e-08	NA	NA
5. P	A0AG16	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.10e-08	2.39e-06	NA	NA
5. P	A4IQ83	N-(5'-phosphoribosyl)anthranilate isomerase	2.43e-07	2.65e-04	NA	NA
5. P	B8DHB2	Indole-3-glycerol phosphate synthase	3.39e-11	5.33e-09	NA	NA
5. P	Q9KCB2	Indole-3-glycerol phosphate synthase	3.62e-10	1.35e-11	NA	NA
5. P	A7HPD4	N-(5'-phosphoribosyl)anthranilate isomerase	4.28e-07	1.54e-02	NA	NA
5. P	Q5HG46	Tryptophan synthase alpha chain	1.29e-08	6.21e-09	NA	NA
5. P	C1L0J3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.21e-08	6.80e-05	NA	NA
5. P	Q9X4E3	N-(5'-phosphoribosyl)anthranilate isomerase	1.13e-07	2.03e-03	NA	NA
5. P	Q2SMB3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.67e-08	3.14e-06	NA	NA
5. P	A1VTG7	Indole-3-glycerol phosphate synthase	2.20e-10	5.13e-08	NA	NA
5. P	Q755M2	Ribulose-phosphate 3-epimerase	9.49e-08	5.98e-04	NA	NA
5. P	B8I5V6	Imidazole glycerol phosphate synthase subunit HisF	2.31e-10	4.87e-02	NA	NA
5. P	Q5SJ49	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.15e-10	2.49e-06	NA	NA
5. P	C3MQK8	Pyridoxal 5'-phosphate synthase subunit PdxS	2.81e-06	4.87e-02	NA	NA
5. P	B8DCI1	3-dehydroquinate dehydratase	1.67e-08	2.48e-02	NA	NA
5. P	Q1GEZ3	Imidazole glycerol phosphate synthase subunit HisF	6.29e-10	9.46e-03	NA	NA
5. P	A3QGT3	Deoxyribose-phosphate aldolase	3.94e-09	2.68e-03	NA	NA
5. P	Q9Z8Z9	Ribulose-phosphate 3-epimerase	7.00e-09	1.40e-02	NA	NA
5. P	Q58114	Uncharacterized protein MJ0703	7.17e-05	8.85e-08	NA	NA
5. P	Q88LE0	N-(5'-phosphoribosyl)anthranilate isomerase	1.95e-06	1.85e-02	NA	NA
5. P	Q6AF73	Imidazole glycerol phosphate synthase subunit HisF	3.67e-10	9.86e-05	NA	NA
5. P	Q57700	Orotidine 5'-phosphate decarboxylase	5.78e-10	2.68e-04	NA	NA
5. P	B0K709	Deoxyribose-phosphate aldolase	5.79e-10	1.91e-08	NA	NA
5. P	Q186R1	Thiazole synthase	3.12e-09	2.15e-06	NA	NA
5. P	Q3SWL9	Tryptophan synthase alpha chain	2.29e-08	8.84e-05	NA	NA
5. P	Q0VM72	Imidazole glycerol phosphate synthase subunit HisF	3.19e-10	1.08e-02	NA	NA
5. P	B9JXN7	Pyridoxine 5'-phosphate synthase	2.44e-07	6.01e-09	NA	NA
5. P	Q9JSN4	Indole-3-glycerol phosphate synthase	2.38e-10	4.91e-06	NA	NA
5. P	A1SL44	Indole-3-glycerol phosphate synthase	1.13e-08	2.15e-08	NA	NA
5. P	C3P505	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.82e-08	2.41e-04	NA	NA
5. P	A1JTW3	Imidazole glycerol phosphate synthase subunit HisF	2.42e-07	2.38e-02	NA	NA
5. P	Q603K2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.51e-07	4.22e-07	NA	NA
5. P	Q1QDV0	Pyridoxine 5'-phosphate synthase	3.87e-08	6.67e-12	NA	NA
5. P	Q02YB8	Tryptophan synthase alpha chain	1.05e-08	7.49e-08	NA	NA
5. P	Q465F4	Tryptophan synthase alpha chain	1.90e-09	3.73e-10	NA	NA
5. P	A5VRD3	Pyridoxine 5'-phosphate synthase	8.44e-07	8.15e-08	NA	NA
5. P	B2VD79	Thiazole synthase	6.91e-09	1.44e-07	NA	NA
5. P	B1GZC1	N-(5'-phosphoribosyl)anthranilate isomerase	7.59e-07	4.83e-02	NA	NA
5. P	O31618	Thiazole synthase	2.42e-09	1.97e-06	NA	NA
5. P	A0RZ77	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.15e-10	9.92e-04	NA	NA
5. P	A3CNT0	Imidazole glycerol phosphate synthase subunit HisF	3.18e-10	2.68e-03	NA	NA
5. P	A0M284	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.68e-10	6.68e-08	NA	NA
5. P	A6L7N1	Tryptophan synthase alpha chain	2.09e-06	3.30e-06	NA	NA
5. P	Q2G0K7	3-hexulose-6-phosphate synthase	1.94e-09	1.07e-07	NA	NA
5. P	A3PED0	Indole-3-glycerol phosphate synthase	7.40e-10	4.13e-06	NA	NA
5. P	B1XG01	3-dehydroquinate dehydratase	2.41e-08	6.69e-04	NA	NA
5. P	Q66CP8	Deoxyribose-phosphate aldolase 1	8.59e-10	5.72e-07	NA	NA
5. P	A6VK15	(5-formylfuran-3-yl)methyl phosphate synthase	1.21e-09	1.60e-02	NA	NA
5. P	Q8R9M7	Indole-3-glycerol phosphate synthase	2.02e-11	1.51e-10	NA	NA
5. P	B1J4B0	Tryptophan synthase alpha chain	5.13e-05	5.93e-04	NA	NA
5. P	Q6KZH9	Thiamine-phosphate synthase	9.88e-07	5.04e-03	NA	NA
5. P	B9JXV5	N-(5'-phosphoribosyl)anthranilate isomerase	1.02e-06	8.06e-03	NA	NA
5. P	Q02YB4	Indole-3-glycerol phosphate synthase	1.91e-08	2.43e-11	NA	NA
5. P	A4XSC7	Pyridoxine 5'-phosphate synthase	2.27e-08	1.63e-08	NA	NA
5. P	A1AV74	Imidazole glycerol phosphate synthase subunit HisF	5.34e-10	1.04e-02	NA	NA
5. P	Q2P0U0	N-(5'-phosphoribosyl)anthranilate isomerase	2.58e-06	2.70e-02	NA	NA
5. P	Q14FN3	Tryptophan synthase alpha chain	2.14e-09	1.17e-04	NA	NA
5. P	A9M276	Pyridoxine 5'-phosphate synthase	1.36e-08	2.80e-06	NA	NA
5. P	Q0C1A2	Indole-3-glycerol phosphate synthase	2.19e-10	2.21e-09	NA	NA
5. P	Q3V8B3	Pyridoxine 5'-phosphate synthase	2.21e-08	9.81e-09	NA	NA
5. P	Q7UKJ7	Indole-3-glycerol phosphate synthase	1.50e-10	3.82e-10	NA	NA
5. P	B5BJQ9	Thiazole synthase	1.50e-09	9.89e-06	NA	NA
5. P	Q722Y6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.86e-08	1.80e-04	NA	NA
5. P	Q5E8W6	Thiazole synthase	2.22e-09	4.67e-07	NA	NA
5. P	Q0I824	Orotidine 5'-phosphate decarboxylase	2.53e-08	4.61e-03	NA	NA
5. P	Q9PDK3	Tryptophan synthase alpha chain	1.84e-06	2.09e-07	NA	NA
5. P	Q2IWU8	Pyridoxine 5'-phosphate synthase	1.23e-08	1.54e-10	NA	NA
5. P	Q4UZF8	Indole-3-glycerol phosphate synthase	1.72e-10	4.94e-09	NA	NA
5. P	P59948	Thiazole synthase	2.20e-09	7.73e-08	NA	NA
5. P	C0Q9S7	Pyridoxine 5'-phosphate synthase	1.34e-08	1.34e-08	NA	NA
5. P	A5VQR5	Indole-3-glycerol phosphate synthase	4.95e-10	9.52e-08	NA	NA
5. P	B5FF70	Thiazole synthase	2.24e-09	4.67e-07	NA	NA
5. P	Q6KHA7	Deoxyribose-phosphate aldolase	2.13e-10	2.58e-08	NA	NA
5. P	Q04U62	Tryptophan synthase alpha chain	1.16e-06	7.72e-06	NA	NA
5. P	B9K256	Thiazole synthase	6.11e-09	1.73e-05	NA	NA
5. P	A1R5S7	Indole-3-glycerol phosphate synthase	5.32e-09	1.77e-09	NA	NA
5. P	Q9Z2Y8	Pyridoxal phosphate homeostasis protein	9.21e-04	2.04e-02	NA	NA
5. P	A8IEY6	Thiazole synthase	4.05e-09	9.04e-08	NA	NA
5. P	A0QHH8	Phosphoribosyl isomerase A	4.67e-07	4.22e-07	NA	NA
5. P	Q8R9N0	Tryptophan synthase alpha chain	1.33e-09	3.66e-03	NA	NA
5. P	A1ATI1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.28e-07	4.07e-08	NA	NA
5. P	Q7V9A2	Thiazole synthase	1.09e-08	2.09e-06	NA	NA
5. P	O28673	Tryptophan synthase alpha chain	7.83e-11	8.61e-05	NA	NA
5. P	Q8U094	Tryptophan synthase alpha chain	5.47e-10	3.21e-07	NA	NA
5. P	Q0AP83	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.57e-06	2.34e-07	NA	NA
5. P	O58851	Geranylgeranylglyceryl phosphate synthase	1.57e-10	5.70e-08	NA	NA
5. P	B8D116	Imidazole glycerol phosphate synthase subunit HisF	8.86e-08	8.43e-04	NA	NA
5. P	A4WUS8	Imidazole glycerol phosphate synthase subunit HisF	2.80e-10	8.00e-05	NA	NA
5. P	Q63Q73	Thiazole synthase	1.20e-08	1.39e-05	NA	NA
5. P	B1W0M4	Phosphoribosyl isomerase A	2.60e-07	7.98e-09	NA	NA
5. P	B2IKL7	Indole-3-glycerol phosphate synthase	8.53e-10	1.02e-07	NA	NA
5. P	C5A0T1	Thiazole synthase	1.49e-09	3.71e-06	NA	NA
5. P	Q8A0V3	Pyridoxine 5'-phosphate synthase	1.32e-08	2.47e-08	NA	NA
5. P	Q2YQW7	Tryptophan synthase alpha chain	1.78e-08	2.19e-04	NA	NA
5. P	Q5SJC0	Tryptophan synthase alpha chain	1.87e-08	5.31e-05	NA	NA
5. P	B7LUF5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.40e-08	7.28e-07	NA	NA
5. P	Q1LKN4	Pyridoxine 5'-phosphate synthase	6.31e-08	7.79e-06	NA	NA
5. P	Q7VHY5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.63e-06	2.20e-08	NA	NA
5. P	B5ERP0	Thiamine-phosphate synthase	3.03e-10	1.83e-06	NA	NA
5. P	B1YSF5	Indole-3-glycerol phosphate synthase	1.50e-10	1.24e-09	NA	NA
5. P	Q4A049	Imidazole glycerol phosphate synthase subunit HisF	7.28e-10	5.25e-03	NA	NA
5. P	Q62GE5	Imidazole glycerol phosphate synthase subunit HisF	1.08e-09	9.24e-03	NA	NA
5. P	B2V6T1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.71e-09	9.07e-07	NA	NA
5. P	Q893R2	Thiazole synthase	8.68e-09	2.58e-08	NA	NA
5. P	Q0HUN5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.20e-09	1.07e-07	NA	NA
5. P	O84123	Ribulose-phosphate 3-epimerase	3.57e-09	5.48e-04	NA	NA
5. P	Q8UJA9	Tryptophan synthase alpha chain	8.62e-05	6.70e-03	NA	NA
5. P	Q7MAS1	Imidazole glycerol phosphate synthase subunit HisF	2.36e-07	8.43e-04	NA	NA
5. P	Q5WWJ5	Thiazole synthase	3.88e-06	4.94e-04	NA	NA
5. P	Q8CN30	Thiazole synthase	3.06e-09	2.70e-07	NA	NA
5. P	A2BX94	Pyridoxine 5'-phosphate synthase	1.07e-08	5.45e-09	NA	NA
5. P	C5CQK0	Imidazole glycerol phosphate synthase subunit HisF	6.41e-10	3.78e-02	NA	NA
5. P	Q2YRR4	Indole-3-glycerol phosphate synthase	5.84e-10	2.46e-07	NA	NA
5. P	B3PIG8	Thiazole synthase	4.31e-06	2.43e-04	NA	NA
5. P	Q3YUZ4	Thiazole synthase	1.65e-09	1.15e-06	NA	NA
5. P	B8H661	Tryptophan synthase alpha chain	8.33e-05	7.29e-04	NA	NA
5. P	P62003	Triosephosphate isomerase	1.01e-10	1.14e-14	NA	NA
5. P	C1ATY9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.44e-07	2.15e-06	NA	NA
5. P	O27695	N-(5'-phosphoribosyl)anthranilate isomerase	8.43e-07	9.42e-05	NA	NA
5. P	B4EYU5	Thiazole synthase	2.35e-09	9.26e-04	NA	NA
5. P	Q8Z2Y1	Putative epimerase LsrE	7.68e-08	1.00e-03	NA	NA
5. P	B2TYF5	Imidazole glycerol phosphate synthase subunit HisF	1.18e-07	4.48e-02	NA	NA
5. P	Q47QR3	Tryptophan synthase alpha chain	1.02e-07	4.62e-08	NA	NA
5. P	Q6AIT8	3-dehydroquinate dehydratase	1.10e-07	3.84e-02	NA	NA
5. P	Q3V7S9	Pyridoxine 5'-phosphate synthase	3.08e-08	1.40e-07	NA	NA
5. P	B2A6X0	Imidazole glycerol phosphate synthase subunit HisF	3.19e-07	6.98e-04	NA	NA
5. P	B3QLK3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.10e-09	3.37e-04	NA	NA
5. P	P9WMM4	Phosphoribosyl isomerase A	5.47e-07	1.01e-06	NA	NA
5. P	Q49VB7	3-hexulose-6-phosphate synthase 3	2.47e-09	1.32e-06	NA	NA
5. P	A4XG66	Thiamine-phosphate synthase	3.45e-10	2.63e-05	NA	NA
5. P	A7GMV0	Imidazole glycerol phosphate synthase subunit HisF	2.39e-10	1.02e-03	NA	NA
5. P	Q2S1Z5	Indole-3-glycerol phosphate synthase	5.90e-10	1.51e-09	NA	NA
5. P	Q5JDB0	Orotidine 5'-phosphate decarboxylase	2.64e-09	1.42e-05	NA	NA
5. P	A5VT42	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.15e-06	1.80e-04	NA	NA
5. P	Q8D249	Thiazole synthase	1.63e-09	6.20e-08	NA	NA
5. P	Q0HUN4	Imidazole glycerol phosphate synthase subunit HisF	1.07e-07	1.05e-03	NA	NA
5. P	Q3IT31	Geranylgeranylglyceryl phosphate synthase	2.19e-05	1.83e-09	NA	NA
5. P	Q8DTR2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.77e-10	3.14e-06	NA	NA
5. P	Q8PXE2	Triosephosphate isomerase	6.88e-11	3.44e-13	NA	NA
5. P	Q9K6E4	Probable transaldolase	1.57e-08	4.15e-02	NA	NA
5. P	B2A3J5	Probable transaldolase	1.09e-08	3.64e-02	NA	NA
5. P	B7JBC0	Indole-3-glycerol phosphate synthase	3.60e-11	4.43e-09	NA	NA
5. P	Q5E317	Pyridoxine 5'-phosphate synthase	1.82e-08	1.77e-10	NA	NA
5. P	Q9UWN5	Triosephosphate isomerase	7.90e-11	1.41e-09	NA	NA
5. P	Q6LPE7	Orotidine 5'-phosphate decarboxylase	7.88e-06	3.81e-02	NA	NA
5. P	B5R0R3	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.94e-08	1.33e-10	NA	NA
5. P	Q9PNL3	Thiamine-phosphate synthase	2.39e-09	1.34e-07	NA	NA
5. P	B2RIJ5	Pyridoxine 5'-phosphate synthase	4.04e-08	4.67e-08	NA	NA
5. P	C3K2K2	Thiamine-phosphate synthase	6.10e-07	1.14e-03	NA	NA
5. P	Q216G8	Thiazole synthase	5.10e-06	7.73e-07	NA	NA
5. P	Q13E40	Imidazole glycerol phosphate synthase subunit HisF	1.98e-10	3.60e-03	NA	NA
5. P	A0T103	Thiazole synthase	7.60e-06	1.65e-05	NA	NA
5. P	Q92B82	Tryptophan synthase alpha chain	5.07e-09	1.38e-03	NA	NA
5. P	B2SL03	Indole-3-glycerol phosphate synthase	1.61e-10	1.18e-08	NA	NA
5. P	Q6N3W7	Thiazole synthase	4.22e-05	1.07e-05	NA	NA
5. P	Q5F6P1	Pyridoxine 5'-phosphate synthase	1.91e-08	3.28e-07	NA	NA
5. P	A9MZG7	Putative epimerase LsrE	8.40e-08	1.17e-03	NA	NA
5. P	Q5WHF4	Deoxyribose-phosphate aldolase	7.66e-10	1.54e-05	NA	NA
5. P	B1ZX57	Imidazole glycerol phosphate synthase subunit HisF	1.20e-07	3.85e-05	NA	NA
5. P	P55607	Uncharacterized protein y4oV	9.25e-08	3.99e-02	NA	NA
5. P	B0CEU2	Indole-3-glycerol phosphate synthase	1.17e-09	2.61e-05	NA	NA
5. P	B2HQ02	Thiazole synthase	4.56e-09	4.96e-06	NA	NA
5. P	P51361	Thiazole synthase	6.53e-09	9.52e-06	NA	NA
5. P	Q9HSC1	Indole-3-glycerol phosphate synthase	3.49e-10	1.49e-08	NA	NA
5. P	Q830V2	Copper homeostasis protein CutC	8.44e-09	9.39e-03	NA	NA
5. P	A5FY58	Tryptophan synthase alpha chain	5.57e-09	4.84e-03	NA	NA
5. P	Q49YV0	Heptaprenylglyceryl phosphate synthase	1.54e-05	2.13e-07	NA	NA
5. P	Q9HN14	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.10e-07	9.54e-07	NA	NA
5. P	B2V6U1	Pyridoxine 5'-phosphate synthase	5.92e-08	1.79e-07	NA	NA
5. P	A1W068	Thiamine-phosphate synthase	2.83e-09	1.87e-06	NA	NA
5. P	Q04SA6	Imidazole glycerol phosphate synthase subunit HisF	1.07e-10	4.37e-04	NA	NA
5. P	Q38ZM1	Thiamine-phosphate synthase	1.36e-09	2.08e-03	NA	NA
5. P	B2HQX9	Tryptophan synthase alpha chain	6.32e-06	6.19e-06	NA	NA
5. P	Q8XS01	Indole-3-glycerol phosphate synthase 2	2.90e-10	3.41e-07	NA	NA
5. P	Q0W0J3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.75e-08	1.97e-05	NA	NA
5. P	Q2NT53	Tryptophan synthase alpha chain	4.09e-09	5.17e-07	NA	NA
5. P	Q88CS6	Thiazole synthase	2.94e-09	1.26e-06	NA	NA
5. P	A1BHS2	Tryptophan synthase alpha chain	1.57e-06	1.13e-08	NA	NA
5. P	Q0VP22	Pyridoxine 5'-phosphate synthase	2.08e-08	7.89e-08	NA	NA
5. P	Q8NTC4	Deoxyribose-phosphate aldolase	1.93e-10	7.50e-06	NA	NA
5. P	A5FS82	Pyridoxal 5'-phosphate synthase subunit PdxS	5.78e-09	1.90e-02	NA	NA
5. P	B5BKK4	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.97e-08	1.33e-10	NA	NA
5. P	A0LTK3	Thiamine-phosphate synthase	7.30e-09	6.98e-04	NA	NA
5. P	Q3ATG0	Imidazole glycerol phosphate synthase subunit HisF	1.37e-07	2.63e-03	NA	NA
5. P	Q65H59	Deoxyribose-phosphate aldolase 1	8.06e-10	2.57e-07	NA	NA
5. P	Q9F812	Thiazole synthase	5.09e-09	1.53e-05	NA	NA
5. P	B0T694	Tryptophan synthase alpha chain	8.59e-05	3.17e-04	NA	NA
5. P	Q83CG2	Tryptophan synthase alpha chain	3.78e-10	6.08e-03	NA	NA
5. P	Q82AA1	Phosphoribosyl isomerase A	3.24e-07	1.47e-07	NA	NA
5. P	Q62GC6	Thiazole synthase	1.08e-08	1.39e-05	NA	NA
5. P	B0KK35	Indole-3-glycerol phosphate synthase	2.97e-10	1.33e-07	NA	NA
5. P	B2SZ04	Indole-3-glycerol phosphate synthase	1.64e-10	2.02e-08	NA	NA
5. P	Q5WGS0	Tryptophan synthase alpha chain	2.28e-09	3.61e-04	NA	NA
5. P	Q8Y6Q4	Indole-3-glycerol phosphate synthase	3.48e-11	2.95e-09	NA	NA
5. P	A6Q4V9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.76e-09	1.38e-07	NA	NA
5. P	A9AJ43	Indole-3-glycerol phosphate synthase	1.70e-10	1.34e-09	NA	NA
5. P	Q57FG5	Thiazole synthase	3.16e-06	7.73e-08	NA	NA
5. P	Q5F8N0	3-dehydroquinate dehydratase	5.15e-08	1.87e-02	NA	NA
5. P	C1DMY6	Thiamine-phosphate synthase	7.14e-07	4.49e-04	NA	NA
5. P	Q8FY07	Imidazole glycerol phosphate synthase subunit HisF	3.45e-10	1.17e-04	NA	NA
5. P	A8Z5Y2	Tryptophan synthase alpha chain	9.80e-07	6.72e-07	NA	NA
5. P	Q9HSF8	Geranylgeranylglyceryl phosphate synthase	1.78e-05	3.11e-05	NA	NA
5. P	B7UQK5	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.58e-08	1.15e-11	NA	NA
5. P	A4SWX7	Tryptophan synthase alpha chain	3.64e-09	2.51e-07	NA	NA
5. P	Q5KX02	Deoxyribose-phosphate aldolase	7.35e-10	2.51e-06	NA	NA
5. P	B4S2W0	Thiazole synthase	2.58e-09	1.62e-04	NA	NA
5. P	Q4UYA4	Thiamine-phosphate synthase	3.80e-09	8.15e-05	NA	NA
5. P	A5CVQ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.38e-06	1.09e-06	NA	NA
5. P	B5YU80	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.37e-08	4.10e-07	NA	NA
5. P	C3LLL5	Tryptophan synthase alpha chain	1.91e-09	1.07e-03	NA	NA
5. P	P64362	Imidazole glycerol phosphate synthase subunit HisF	2.46e-10	1.63e-03	NA	NA
5. P	Q2SQL5	Thiazole synthase	5.71e-09	8.99e-06	NA	NA
5. P	A7ZZJ6	Tryptophan synthase alpha chain	2.93e-09	5.90e-06	NA	NA
5. P	A1JII4	Thiazole synthase	2.85e-09	2.86e-05	NA	NA
5. P	P07344	Tryptophan synthase alpha chain	5.10e-05	4.77e-07	NA	NA
5. P	Q845U8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.13e-06	8.29e-07	NA	NA
5. P	B5FDB6	Tryptophan synthase alpha chain	2.29e-09	2.78e-05	NA	NA
5. P	C1CG44	Indole-3-glycerol phosphate synthase	1.87e-08	4.43e-10	NA	NA
5. P	O35006	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.41e-07	4.80e-05	NA	NA
5. P	A5W8E9	Pyridoxine 5'-phosphate synthase	3.11e-08	4.88e-09	NA	NA
5. P	A2RYI3	Indole-3-glycerol phosphate synthase	9.35e-11	2.00e-08	NA	NA
5. P	B7LY16	Tryptophan synthase alpha chain	3.10e-09	6.68e-06	NA	NA
5. P	Q971Z6	Tryptophan synthase alpha chain	4.58e-10	6.13e-06	NA	NA
5. P	Q8ECU9	Tryptophan synthase alpha chain	2.59e-09	1.38e-03	NA	NA
5. P	O25514	Thiamine-phosphate synthase	5.64e-09	1.21e-06	NA	NA
5. P	B4STP1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.68e-10	9.98e-06	NA	NA
5. P	Q1Q803	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.83e-06	6.79e-07	NA	NA
5. P	Q9JVD1	N-(5'-phosphoribosyl)anthranilate isomerase	1.97e-06	1.46e-02	NA	NA
5. P	Q0W6M2	Deoxyribose-phosphate aldolase	2.51e-10	5.36e-06	NA	NA
5. P	B2I669	Pyridoxine 5'-phosphate synthase	1.24e-06	1.50e-07	NA	NA
5. P	B7JET1	Tryptophan synthase alpha chain	2.00e-09	1.18e-08	NA	NA
5. P	A1US08	Thiazole synthase	3.59e-05	3.60e-03	NA	NA
5. P	Q3V7I6	Pyridoxine 5'-phosphate synthase	1.78e-08	8.25e-11	NA	NA
5. P	A5ISQ5	Tryptophan synthase alpha chain	1.40e-08	4.14e-09	NA	NA
5. P	B2VKT1	Tryptophan synthase alpha chain	2.75e-09	1.21e-06	NA	NA
5. P	P20578	Indole-3-glycerol phosphate synthase	3.26e-10	3.45e-07	NA	NA
5. P	Q0HJ08	Thiazole synthase	2.70e-09	2.31e-05	NA	NA
5. P	Q46DH3	(5-formylfuran-3-yl)methyl phosphate synthase	8.48e-09	1.62e-02	NA	NA
5. P	Q8ZN19	Pyridoxine 5'-phosphate synthase	1.10e-08	6.09e-10	NA	NA
5. P	Q03JC2	Tryptophan synthase alpha chain	4.85e-08	4.36e-07	NA	NA
5. P	B7MU99	Tryptophan synthase alpha chain	2.85e-09	3.24e-06	NA	NA
5. P	A7GNS8	Deoxyribose-phosphate aldolase	7.68e-10	4.14e-09	NA	NA
5. P	B6YQ29	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.10e-07	2.25e-07	NA	NA
5. P	B1YKT7	Deoxyribose-phosphate aldolase	5.54e-10	9.08e-06	NA	NA
5. P	Q1LIB1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.84e-06	2.30e-06	NA	NA
5. P	A6UZF2	Indole-3-glycerol phosphate synthase	1.98e-10	4.72e-08	NA	NA
5. P	Q6D406	Imidazole glycerol phosphate synthase subunit HisF	2.19e-07	1.73e-02	NA	NA
5. P	B2SWK7	Thiazole synthase	2.34e-09	3.79e-09	NA	NA
5. P	B2UEE6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.13e-06	8.25e-06	NA	NA
5. P	P75522	Ribulose-phosphate 3-epimerase	3.94e-05	1.18e-02	NA	NA
5. P	A8LHX5	Imidazole glycerol phosphate synthase subunit HisF	2.62e-10	1.39e-06	NA	NA
5. P	A5G6M1	Tryptophan synthase alpha chain	1.20e-09	2.19e-04	NA	NA
5. P	A9VJW3	Tryptophan synthase alpha chain	9.70e-10	7.98e-08	NA	NA
5. P	A0QLT3	Thiazole synthase	3.28e-09	2.99e-07	NA	NA
5. P	Q57H64	Thiazole synthase	1.69e-09	9.08e-06	NA	NA
5. P	Q7NRL4	Thiazole synthase	3.29e-09	4.67e-05	NA	NA
5. P	P94327	Indole-3-glycerol phosphate synthase	5.17e-10	1.10e-07	NA	NA
5. P	Q3SHM0	Tryptophan synthase alpha chain	8.87e-09	4.81e-04	NA	NA
5. P	C6E7F5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.59e-07	4.94e-09	NA	NA
5. P	Q2JW90	N-(5'-phosphoribosyl)anthranilate isomerase	2.86e-07	3.21e-03	NA	NA
5. P	B6JCG4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.57e-06	3.20e-05	NA	NA
5. P	Q1QJD6	Thiazole synthase	4.42e-05	3.41e-07	NA	NA
5. P	P70938	N-(5'-phosphoribosyl)anthranilate isomerase	1.29e-06	2.13e-04	NA	NA
5. P	B2UVZ8	Pyridoxine 5'-phosphate synthase	6.31e-07	1.90e-05	NA	NA
5. P	Q5HQR7	3-dehydroquinate dehydratase	1.55e-06	1.11e-03	NA	NA
5. P	A5WHT5	Imidazole glycerol phosphate synthase subunit HisF	4.38e-10	4.68e-03	NA	NA
5. P	B5R3P3	Tryptophan synthase alpha chain	3.54e-09	3.78e-07	NA	NA
5. P	Q8G6F7	Imidazole glycerol phosphate synthase subunit HisF	3.58e-10	5.47e-03	NA	NA
5. P	Q1IKB2	Imidazole glycerol phosphate synthase subunit HisF	4.92e-07	1.43e-02	NA	NA
5. P	Q9ZHE1	Imidazole glycerol phosphate synthase subunit HisF	1.13e-07	1.52e-02	NA	NA
5. P	Q9A808	Pyridoxine 5'-phosphate synthase	7.25e-08	1.60e-05	NA	NA
5. P	A7I4T3	Tryptophan synthase alpha chain	1.69e-07	5.89e-08	NA	NA
5. P	Q8FH42	3-dehydroquinate dehydratase	2.43e-08	5.82e-04	NA	NA
5. P	B8E6P4	Deoxyribose-phosphate aldolase	3.34e-09	3.75e-03	NA	NA
5. P	A1U0X2	Tryptophan synthase alpha chain	8.59e-07	2.97e-06	NA	NA
5. P	A4T9N2	Imidazole glycerol phosphate synthase subunit HisF	2.84e-10	4.08e-03	NA	NA
5. P	B1LE43	3-dehydroquinate dehydratase	2.42e-08	6.69e-04	NA	NA
5. P	Q7NDC1	Imidazole glycerol phosphate synthase subunit HisF	2.26e-10	3.30e-02	NA	NA
5. P	A5WAD7	Thiazole synthase	2.33e-09	1.26e-06	NA	NA
5. P	Q11PM4	Pyridoxine 5'-phosphate synthase	2.41e-08	4.69e-10	NA	NA
5. P	B7UYW9	Pyridoxine 5'-phosphate synthase	2.62e-08	1.05e-08	NA	NA
5. P	A1V8H4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.80e-09	2.65e-07	NA	NA
5. P	P9WFY0	Tryptophan synthase alpha chain	7.36e-06	1.43e-05	NA	NA
5. P	Q48DP2	Thiamine-phosphate synthase	8.80e-07	1.10e-04	NA	NA
5. P	Q2KUI1	Thiazole synthase	2.38e-09	3.40e-06	NA	NA
5. P	B8FA37	Tryptophan synthase alpha chain	4.68e-07	2.09e-06	NA	NA
5. P	Q8XXY2	Tryptophan synthase alpha chain	4.86e-09	2.47e-09	NA	NA
5. P	O29276	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.83e-07	1.49e-08	NA	NA
5. P	C5C9E5	Deoxyribose-phosphate aldolase	6.76e-10	2.09e-07	NA	NA
5. P	B9E9B4	Thiazole synthase	5.51e-09	1.10e-07	NA	NA
5. P	P0DA62	Deoxyribose-phosphate aldolase	4.42e-08	1.22e-06	NA	NA
5. P	C1CMD2	Tryptophan synthase alpha chain	6.00e-08	1.74e-05	NA	NA
5. P	Q5X6S0	Indole-3-glycerol phosphate synthase	1.21e-10	4.07e-08	NA	NA
5. P	A2SQR0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-10	1.01e-05	NA	NA
5. P	A5UY52	Imidazole glycerol phosphate synthase subunit HisF	1.84e-10	4.11e-03	NA	NA
5. P	Q7CYR2	Indole-3-glycerol phosphate synthase	2.55e-07	7.41e-08	NA	NA
5. P	Q39SS2	Tryptophan synthase alpha chain	2.70e-09	1.83e-05	NA	NA
5. P	Q64RT1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.55e-10	3.17e-05	NA	NA
5. P	A4XLM3	Tryptophan synthase alpha chain	1.02e-05	2.46e-11	NA	NA
5. P	A7NRF7	Thiamine-phosphate synthase	9.24e-10	5.05e-09	NA	NA
5. P	Q5NPJ8	Thiazole synthase	2.66e-09	3.78e-08	NA	NA
5. P	Q8F9R5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.36e-10	5.07e-05	NA	NA
5. P	Q39K86	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.51e-07	1.91e-07	NA	NA
5. P	P9WFY1	Tryptophan synthase alpha chain	7.14e-06	1.43e-05	NA	NA
5. P	A9BHQ2	Tryptophan synthase alpha chain	4.95e-07	6.62e-06	NA	NA
5. P	Q7TV44	Indole-3-glycerol phosphate synthase	7.87e-10	6.46e-07	NA	NA
5. P	Q3SFU7	Thiamine-phosphate synthase	9.49e-11	1.37e-03	NA	NA
5. P	B6IWI7	Imidazole glycerol phosphate synthase subunit HisF	3.02e-10	1.65e-03	NA	NA
5. P	B8CR54	Imidazole glycerol phosphate synthase subunit HisF	1.37e-07	4.76e-02	NA	NA
5. P	P66982	Tryptophan synthase alpha chain	1.87e-08	4.14e-09	NA	NA
5. P	Q5FNT5	Thiazole synthase	3.98e-09	2.18e-05	NA	NA
5. P	Q8K940	Ribulose-phosphate 3-epimerase	1.42e-08	1.29e-04	NA	NA
5. P	C3P3T9	N-(5'-phosphoribosyl)anthranilate isomerase	2.17e-06	4.08e-02	NA	NA
5. P	Q5H0A3	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.49e-07	4.31e-02	NA	NA
5. P	Q3V7R4	Pyridoxine 5'-phosphate synthase	1.23e-08	8.16e-10	NA	NA
5. P	A6WVK9	Thiazole synthase	4.55e-09	5.55e-07	NA	NA
5. P	B7JA18	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.08e-07	2.06e-08	NA	NA
5. P	Q9KST7	Tryptophan synthase alpha chain	2.28e-09	1.07e-03	NA	NA
5. P	P14637	Tryptophan synthase alpha chain	2.41e-09	9.93e-03	NA	NA
5. P	Q3AZD9	Orotidine 5'-phosphate decarboxylase	1.78e-08	2.91e-02	NA	NA
5. P	B4U6B2	Thiamine-phosphate synthase	4.51e-07	1.65e-05	NA	NA
5. P	Q9HIQ4	Thiamine-phosphate synthase	7.52e-09	2.12e-03	NA	NA
5. P	A6Q117	Imidazole glycerol phosphate synthase subunit HisF	1.44e-07	6.52e-04	NA	NA
5. P	Q478V2	Thiamine-phosphate synthase	3.02e-07	1.11e-04	NA	NA
5. P	Q7V5Y2	Orotidine 5'-phosphate decarboxylase	3.19e-08	2.36e-02	NA	NA
5. P	Q5QZ42	Orotidine 5'-phosphate decarboxylase	6.38e-08	1.97e-02	NA	NA
5. P	B7HH00	N-(5'-phosphoribosyl)anthranilate isomerase	1.31e-06	2.49e-02	NA	NA
5. P	A1WYL4	Thiamine-phosphate synthase	6.65e-09	9.83e-04	NA	NA
5. P	A9BNH8	Tryptophan synthase alpha chain	2.33e-06	1.87e-07	NA	NA
5. P	A4T2R5	Thiamine-phosphate synthase	4.07e-09	2.54e-05	NA	NA
5. P	B1XDU7	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.54e-08	1.15e-11	NA	NA
5. P	A6L7N0	N-(5'-phosphoribosyl)anthranilate isomerase	1.49e-06	2.09e-02	NA	NA
5. P	Q8XV85	Imidazole glycerol phosphate synthase subunit HisF	1.30e-09	3.56e-02	NA	NA
5. P	Q88R41	Imidazole glycerol phosphate synthase subunit HisF	3.81e-10	2.95e-04	NA	NA
5. P	Q1QDK2	Tryptophan synthase alpha chain	1.63e-06	3.05e-05	NA	NA
5. P	Q7MM57	Tryptophan synthase alpha chain	2.19e-09	2.78e-05	NA	NA
5. P	A0QLT6	Thiamine-phosphate synthase	2.79e-09	3.30e-06	NA	NA
5. P	B0T410	Orotidine 5'-phosphate decarboxylase	9.47e-08	1.82e-03	NA	NA
5. P	B7JES8	Indole-3-glycerol phosphate synthase	2.63e-08	3.55e-11	NA	NA
5. P	O87007	3-dehydroquinate dehydratase	2.66e-08	9.69e-03	NA	NA
5. P	Q2FH63	Tryptophan synthase alpha chain	9.89e-09	6.21e-09	NA	NA
5. P	B0S8V2	Imidazole glycerol phosphate synthase subunit HisF	1.26e-10	9.00e-05	NA	NA
5. P	Q3K6C1	Thiamine-phosphate synthase	5.99e-07	1.85e-03	NA	NA
5. P	Q476U3	Thiazole synthase	9.72e-06	2.49e-06	NA	NA
5. P	B7IUW3	Heptaprenylglyceryl phosphate synthase	6.65e-06	1.39e-10	NA	NA
5. P	B2TWH8	Thiazole synthase	1.63e-09	1.15e-06	NA	NA
5. P	A1VK41	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.79e-07	5.98e-05	NA	NA
5. P	A5F207	Tryptophan synthase alpha chain	2.63e-09	1.07e-03	NA	NA
5. P	Q9X0C6	Imidazole glycerol phosphate synthase subunit HisF	1.05e-07	2.63e-04	NA	NA
5. P	P73761	Orotidine 5'-phosphate decarboxylase	2.78e-08	3.84e-02	NA	NA
5. P	Q4ZLQ2	Imidazole glycerol phosphate synthase subunit HisF	3.94e-10	3.19e-04	NA	NA
5. P	B7UT61	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.53e-08	2.46e-07	NA	NA
5. P	Q6AF68	Indole-3-glycerol phosphate synthase	1.11e-11	9.07e-07	NA	NA
5. P	P62357	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.09e-10	7.58e-05	NA	NA
5. P	Q5HBN7	Pyridoxine 5'-phosphate synthase	5.69e-09	3.00e-11	NA	NA
5. P	A7IM59	Pyridoxine 5'-phosphate synthase	5.46e-09	4.58e-10	NA	NA
5. P	Q8CPX1	3-dehydroquinate dehydratase	1.27e-06	1.11e-03	NA	NA
5. P	Q57CZ8	Indole-3-glycerol phosphate synthase	5.58e-10	2.46e-07	NA	NA
5. P	Q2GG30	Pyridoxine 5'-phosphate synthase	7.18e-09	3.33e-10	NA	NA
5. P	Q6G9I6	Tryptophan synthase alpha chain	1.37e-08	6.21e-09	NA	NA
5. P	B1W0M6	Imidazole glycerol phosphate synthase subunit HisF	1.05e-09	1.34e-02	NA	NA
5. P	Q4L678	N-(5'-phosphoribosyl)anthranilate isomerase	1.22e-06	4.14e-03	NA	NA
5. P	A1KWF0	Thiazole synthase	9.49e-09	5.56e-05	NA	NA
5. P	B9L7G2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.29e-10	4.52e-08	NA	NA
5. P	Q7M831	Indole-3-glycerol phosphate synthase	8.37e-12	3.70e-07	NA	NA
5. P	Q1H4R2	Imidazole glycerol phosphate synthase subunit HisF	3.85e-10	1.67e-04	NA	NA
5. P	Q6CQL7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.05e-07	1.91e-04	NA	NA
5. P	Q3V7K1	Pyridoxine 5'-phosphate synthase	2.36e-08	5.95e-10	NA	NA
5. P	Q1BVA7	Deoxyribose-phosphate aldolase	9.37e-10	1.63e-07	NA	NA
5. P	A8LX58	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.21e-07	8.43e-09	NA	NA
5. P	Q89WM4	Imidazole glycerol phosphate synthase subunit HisF	2.28e-10	3.57e-03	NA	NA
5. P	Q11YI1	Thiazole synthase	2.00e-09	9.26e-07	NA	NA
5. P	C3K3L7	Thiazole synthase	1.79e-09	5.30e-08	NA	NA
5. P	B5EDR5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.76e-07	6.21e-09	NA	NA
5. P	B9JXW8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.95e-07	1.63e-05	NA	NA
5. P	B5XPE3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.97e-08	1.93e-06	NA	NA
5. P	Q5X5Q1	Tryptophan synthase alpha chain	1.33e-06	2.19e-03	NA	NA
5. P	A9N936	Pyridoxine 5'-phosphate synthase	2.51e-08	4.33e-09	NA	NA
5. P	A5FYE5	Imidazole glycerol phosphate synthase subunit HisF	1.25e-07	6.55e-05	NA	NA
5. P	A0PXP7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.65e-08	1.41e-06	NA	NA
5. P	B2S5Z1	Indole-3-glycerol phosphate synthase	5.62e-10	2.46e-07	NA	NA
5. P	B7US32	3-dehydroquinate dehydratase	2.32e-08	5.82e-04	NA	NA
5. P	Q5R5Y2	Ribulose-phosphate 3-epimerase	5.31e-08	2.47e-04	NA	NA
5. P	B3R703	Indole-3-glycerol phosphate synthase	2.80e-10	6.72e-07	NA	NA
5. P	Q9V1G3	Indole-3-glycerol phosphate synthase	6.68e-08	1.90e-10	NA	NA
5. P	C3L9P7	Imidazole glycerol phosphate synthase subunit HisF	1.28e-10	1.44e-03	NA	NA
5. P	A2SSK1	Geranylgeranylglyceryl phosphate synthase	8.94e-06	4.57e-08	NA	NA
5. P	A0LCF3	Imidazole glycerol phosphate synthase subunit HisF	4.94e-10	1.77e-02	NA	NA
5. P	Q6GBR7	3-hexulose-6-phosphate synthase	2.03e-09	2.41e-07	NA	NA
5. P	B7NQG6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.60e-08	2.87e-07	NA	NA
5. P	C5D4J0	Heptaprenylglyceryl phosphate synthase	7.51e-06	4.33e-09	NA	NA
5. P	B5ZPY7	Indole-3-glycerol phosphate synthase	5.90e-10	3.41e-07	NA	NA
5. P	Q1MGE1	Indole-3-glycerol phosphate synthase	2.15e-07	1.36e-06	NA	NA
5. P	Q9JTR9	3-dehydroquinate dehydratase	4.71e-08	1.41e-02	NA	NA
5. P	B1I7S9	Indole-3-glycerol phosphate synthase	1.67e-08	4.28e-09	NA	NA
5. P	Q9FT25	Pyridoxal 5'-phosphate synthase subunit PDX1	2.75e-06	3.24e-02	NA	NA
5. P	A1AY12	Thiazole synthase	2.81e-06	9.95e-05	NA	NA
5. P	Q8THC4	3-dehydroquinate dehydratase	9.17e-08	3.75e-02	NA	NA
5. P	A1VCV9	Pyridoxine 5'-phosphate synthase	1.30e-08	5.25e-10	NA	NA
5. P	A9N7S1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.14e-08	3.89e-06	NA	NA
5. P	B8GHM9	Geranylgeranylglyceryl phosphate synthase	1.29e-05	1.86e-10	NA	NA
5. P	Q2VYI9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.67e-07	3.67e-05	NA	NA
5. P	B6EJ92	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.60e-08	1.11e-07	NA	NA
5. P	Q5M348	Indole-3-glycerol phosphate synthase	2.12e-08	5.08e-10	NA	NA
5. P	Q3ICF4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.24e-07	9.14e-08	NA	NA
5. P	B1JJK2	Thiazole synthase	4.87e-09	3.49e-03	NA	NA
5. P	B0VUS0	Indole-3-glycerol phosphate synthase	7.14e-10	3.45e-07	NA	NA
5. P	Q21XI7	Tryptophan synthase alpha chain	1.40e-08	1.12e-06	NA	NA
5. P	A9B5I3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.59e-10	8.15e-04	NA	NA
5. P	A6WX52	Imidazole glycerol phosphate synthase subunit HisF	2.16e-10	3.74e-05	NA	NA
5. P	A0KWB1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.44e-09	1.15e-07	NA	NA
5. P	Q7WEK6	Indole-3-glycerol phosphate synthase	9.04e-11	2.39e-06	NA	NA
5. P	P74061	Ribulose-phosphate 3-epimerase	3.89e-09	1.16e-04	NA	NA
5. P	Q2LVE9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.09e-06	6.55e-05	NA	NA
5. P	Q8FAI9	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.60e-08	1.98e-11	NA	NA
5. P	Q4KJS4	Imidazole glycerol phosphate synthase subunit HisF	3.88e-10	3.94e-04	NA	NA
5. P	Q0K6I0	Indole-3-glycerol phosphate synthase	1.96e-10	3.67e-07	NA	NA
5. P	C0RFZ2	Tryptophan synthase alpha chain	1.70e-08	2.22e-04	NA	NA
5. P	B5F7D7	3-dehydroquinate dehydratase	2.51e-08	5.17e-03	NA	NA
5. P	Q7M9N9	Thiamine-phosphate synthase	6.73e-09	7.56e-03	NA	NA
5. P	A4YJI7	N-(5'-phosphoribosyl)anthranilate isomerase	2.03e-07	2.68e-02	NA	NA
5. P	B1VH82	Tryptophan synthase alpha chain	9.65e-08	5.83e-08	NA	NA
5. P	Q46LD2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.68e-07	5.31e-05	NA	NA
5. P	P57205	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.16e-06	3.85e-05	NA	NA
5. P	B3PGA3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.02e-08	1.84e-05	NA	NA
5. P	B7JUK2	Tryptophan synthase alpha chain	1.14e-09	7.97e-07	NA	NA
5. P	O67328	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.86e-10	6.63e-04	NA	NA
5. P	Q5F645	Indole-3-glycerol phosphate synthase	8.62e-10	1.23e-05	NA	NA
5. P	Q2YAN9	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.58e-05	2.01e-02	NA	NA
5. P	A5IWA0	Imidazole glycerol phosphate synthase subunit HisF	4.56e-10	1.63e-03	NA	NA
5. P	A9VLH7	Imidazole glycerol phosphate synthase subunit HisF	2.06e-10	1.93e-02	NA	NA
5. P	Q83BL1	Pyridoxine 5'-phosphate synthase	1.64e-08	4.33e-09	NA	NA
5. P	Q7NHI0	Indole-3-glycerol phosphate synthase	6.97e-10	7.29e-04	NA	NA
5. P	Q1QRX1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.24e-09	9.51e-05	NA	NA
5. P	O68602	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.89e-07	1.20e-09	NA	NA
5. P	B7HHG4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.00e-08	1.21e-05	NA	NA
5. P	B0RLF1	Pyridoxine 5'-phosphate synthase	5.79e-07	1.09e-06	NA	NA
5. P	C1ANM7	Imidazole glycerol phosphate synthase subunit HisF	3.28e-10	1.31e-02	NA	NA
5. P	C1EQH0	Deoxyribose-phosphate aldolase	1.06e-09	9.62e-08	NA	NA
5. P	Q050D2	Imidazole glycerol phosphate synthase subunit HisF	1.26e-10	4.37e-04	NA	NA
5. P	B3R795	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.20e-06	9.54e-07	NA	NA
5. P	A5IK84	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	1.93e-03	7.79e-05	NA	NA
5. P	A6WX30	Tryptophan synthase alpha chain	1.64e-08	4.08e-04	NA	NA
5. P	Q3A7P5	Thiazole synthase 1	1.51e-09	3.32e-02	NA	NA
5. P	B8DUB2	Imidazole glycerol phosphate synthase subunit HisF	3.24e-10	3.87e-04	NA	NA
5. P	C3P3T8	Indole-3-glycerol phosphate synthase	2.60e-08	3.55e-11	NA	NA
5. P	A8GF83	Tryptophan synthase alpha chain	2.68e-09	3.23e-05	NA	NA
5. P	B8JH75	Thiazole synthase	2.60e-09	1.59e-08	NA	NA
5. P	Q8Y0H8	Pyridoxine 5'-phosphate synthase	4.26e-08	3.16e-08	NA	NA
5. P	Q10X41	Pyridoxine 5'-phosphate synthase	8.05e-09	2.10e-12	NA	NA
5. P	Q72RH2	N-(5'-phosphoribosyl)anthranilate isomerase	3.95e-06	3.84e-04	NA	NA
5. P	Q1GHT0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1	1.07e-06	2.44e-09	NA	NA
5. P	B7NTQ2	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.57e-08	1.98e-11	NA	NA
5. P	P62355	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.33e-08	5.56e-10	NA	NA
5. P	A1U5H5	Imidazole glycerol phosphate synthase subunit HisF	2.21e-10	8.30e-05	NA	NA
5. P	A3PFF2	Thiazole synthase	6.97e-05	8.29e-07	NA	NA
5. P	Q5NXQ3	3-methyl-2-oxobutanoate hydroxymethyltransferase	2.64e-05	4.08e-02	NA	NA
5. P	A5UEU6	Tryptophan synthase alpha chain	4.50e-09	4.96e-06	NA	NA
5. P	Q8ZEH0	Tryptophan synthase alpha chain	2.70e-09	2.37e-06	NA	NA
5. P	Q3AD48	Imidazole glycerol phosphate synthase subunit HisF	1.88e-07	1.97e-02	NA	NA
5. P	Q975W8	Geranylgeranylglyceryl phosphate synthase	6.43e-07	5.61e-07	NA	NA
5. P	B7JM94	Heptaprenylglyceryl phosphate synthase	6.68e-06	8.95e-11	NA	NA
5. P	A9A5X1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.48e-09	3.67e-05	NA	NA
5. P	Q7W049	Thiamine-phosphate synthase	1.49e-09	4.97e-07	NA	NA
5. P	B4E641	Imidazole glycerol phosphate synthase subunit HisF	2.37e-09	1.81e-02	NA	NA
5. P	Q07NF6	Indole-3-glycerol phosphate synthase	2.69e-07	8.34e-09	NA	NA
5. P	B7MWU3	Imidazole glycerol phosphate synthase subunit HisF	1.18e-07	4.87e-02	NA	NA
5. P	B6IBD3	3-dehydroquinate dehydratase	2.45e-08	5.87e-04	NA	NA
5. P	Q4J8X3	Indole-3-glycerol phosphate synthase	7.59e-11	6.63e-09	NA	NA
5. P	Q66FP9	Thiazole synthase	3.85e-09	2.40e-03	NA	NA
5. P	Q38X91	3-dehydroquinate dehydratase	2.99e-07	2.17e-02	NA	NA
5. P	C5D7N8	Imidazole glycerol phosphate synthase subunit HisF	1.11e-07	3.59e-02	NA	NA
5. P	B9JG44	Tryptophan synthase alpha chain	6.56e-05	1.00e-03	NA	NA
5. P	B8F671	Deoxyribose-phosphate aldolase	5.50e-09	4.12e-02	NA	NA
5. P	B6J1X5	Thiazole synthase	4.20e-06	6.26e-05	NA	NA
5. P	B1YAF0	Geranylgeranylglyceryl phosphate synthase	7.33e-08	7.67e-04	NA	NA
5. P	A8ER78	Thiazole synthase	7.51e-09	2.46e-07	NA	NA
5. P	Q8FB81	Thiazole synthase	1.50e-09	5.73e-06	NA	NA
5. P	A6VJ52	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.08e-10	4.18e-05	NA	NA
5. P	C6E5P6	Pyridoxine 5'-phosphate synthase	1.25e-08	4.85e-10	NA	NA
5. P	B0TG92	Thiazole synthase	4.37e-09	2.34e-08	NA	NA
5. P	Q2NHB3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.03e-11	9.98e-06	NA	NA
5. P	P58790	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.01e-06	1.04e-04	NA	NA
5. P	B5EK17	Tryptophan synthase alpha chain	2.20e-06	1.06e-07	NA	NA
5. P	B7HIT0	Deoxyribose-phosphate aldolase	5.96e-10	1.08e-07	NA	NA
5. P	B0UHR5	Imidazole glycerol phosphate synthase subunit HisF	3.90e-10	6.03e-04	NA	NA
5. P	A5N7P1	Tryptophan synthase alpha chain	4.96e-07	1.06e-04	NA	NA
5. P	Q81TL7	Tryptophan synthase alpha chain	2.05e-09	2.06e-08	NA	NA
5. P	Q2NB00	Thiamine-phosphate synthase	2.50e-06	8.65e-06	NA	NA
5. P	A5GU97	Pyridoxine 5'-phosphate synthase	1.32e-08	6.23e-10	NA	NA
5. P	Q8EEE1	Thiazole synthase	1.71e-09	2.61e-06	NA	NA
5. P	Q01997	Tryptophan synthase alpha chain	2.14e-08	1.81e-07	NA	NA
5. P	A7ZV66	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.58e-08	1.98e-11	NA	NA
5. P	Q8R9M8	N-(5'-phosphoribosyl)anthranilate isomerase	8.02e-07	3.57e-03	NA	NA
5. P	B7VH29	Orotidine 5'-phosphate decarboxylase	4.33e-06	2.91e-02	NA	NA
5. P	Q9RUG0	Indole-3-glycerol phosphate synthase	1.17e-09	7.29e-06	NA	NA
5. P	B3Q604	N-(5'-phosphoribosyl)anthranilate isomerase	1.62e-07	7.38e-03	NA	NA
5. P	P17166	Tryptophan synthase alpha chain	2.78e-09	1.04e-05	NA	NA
5. P	B5R9E3	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.87e-08	1.33e-10	NA	NA
5. P	Q8TYA2	Tryptophan synthase alpha chain	3.47e-09	3.64e-05	NA	NA
5. P	A2RK21	Indole-3-glycerol phosphate synthase	1.85e-08	2.43e-11	NA	NA
5. P	A6L646	Thiazole synthase	2.15e-09	3.45e-07	NA	NA
5. P	A7ZES8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.33e-06	2.17e-06	NA	NA
5. P	C1AK93	Thiazole synthase	2.08e-09	7.73e-08	NA	NA
5. P	Q162Q1	Imidazole glycerol phosphate synthase subunit HisF	2.46e-10	9.54e-03	NA	NA
5. P	Q9UW83	Pyridoxal 5'-phosphate synthase subunit pyroA	3.04e-06	2.68e-03	NA	NA
5. P	Q0AFV0	Thiamine-phosphate synthase	1.34e-10	1.40e-07	NA	NA
5. P	Q24QJ4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.21e-06	7.31e-05	NA	NA
5. P	Q82WI1	Tryptophan synthase alpha chain	3.16e-09	3.40e-04	NA	NA
5. P	A5V9V9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.46e-07	8.23e-08	NA	NA
5. P	Q3AD49	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.26e-09	2.31e-05	NA	NA
5. P	B8HY50	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.95e-07	2.82e-04	NA	NA
5. P	Q7NRS9	Deoxyribose-phosphate aldolase	9.98e-09	4.68e-03	NA	NA
5. P	Q5ZVY3	Tryptophan synthase alpha chain	1.38e-09	1.16e-02	NA	NA
5. P	A0RNS2	Pyridoxine 5'-phosphate synthase	2.43e-08	1.23e-08	NA	NA
5. P	B8DA61	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.00e-08	1.04e-03	NA	NA
5. P	Q62AJ6	Tryptophan synthase alpha chain	1.01e-08	4.58e-07	NA	NA
5. P	B1VZU6	Thiazole synthase	6.47e-09	1.49e-05	NA	NA
5. P	A8FEK0	Indole-3-glycerol phosphate synthase	1.37e-10	1.14e-10	NA	NA
5. P	Q7NPF2	Pyridoxine 5'-phosphate synthase	1.09e-08	7.05e-10	NA	NA
5. P	Q7TU64	Indole-3-glycerol phosphate synthase	8.52e-10	6.95e-06	NA	NA
5. P	Q32AG3	Thiazole synthase	1.43e-09	3.37e-06	NA	NA
5. P	Q3MF82	Deoxyribose-phosphate aldolase	2.34e-10	2.06e-06	NA	NA
5. P	Q8XV84	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.91e-07	2.01e-05	NA	NA
5. P	Q1ILG3	Thiamine-phosphate synthase	2.98e-08	6.85e-09	NA	NA
5. P	Q0B004	N-(5'-phosphoribosyl)anthranilate isomerase	1.11e-06	4.12e-02	NA	NA
5. P	A0AFC5	Thiamine-phosphate synthase	2.36e-09	7.57e-08	NA	NA
5. P	C5D3D3	Tryptophan synthase alpha chain	1.64e-09	4.11e-08	NA	NA
5. P	A4Y6R6	Thiazole synthase	1.83e-09	1.07e-05	NA	NA
5. P	Q56319	Indole-3-glycerol phosphate synthase	2.22e-10	8.07e-09	NA	NA
5. P	A4WX67	Indole-3-glycerol phosphate synthase	4.69e-10	1.91e-08	NA	NA
5. P	Q0BPX3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.17e-07	1.01e-06	NA	NA
5. P	A4SF78	N-(5'-phosphoribosyl)anthranilate isomerase	1.32e-06	2.88e-03	NA	NA
5. P	A1KB60	Thiamine-phosphate synthase	1.92e-09	1.66e-03	NA	NA
5. P	B7L492	Tryptophan synthase alpha chain	2.92e-09	2.64e-06	NA	NA
5. P	B9MDV7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.06e-06	6.79e-07	NA	NA
5. P	A6UP16	N-(5'-phosphoribosyl)anthranilate isomerase	1.20e-07	1.99e-02	NA	NA
5. P	Q8VEE0	Ribulose-phosphate 3-epimerase	5.73e-08	6.37e-05	NA	NA
5. P	Q9KCA9	Tryptophan synthase alpha chain	1.05e-06	1.28e-05	NA	NA
5. P	Q4UWD4	N-(5'-phosphoribosyl)anthranilate isomerase	2.69e-06	2.57e-02	NA	NA
5. P	B9DIP1	Imidazole glycerol phosphate synthase subunit HisF	2.04e-09	1.87e-02	NA	NA
5. P	A9KL43	Indole-3-glycerol phosphate synthase	1.66e-11	3.71e-06	NA	NA
5. P	Q5ZW91	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.65e-10	4.26e-05	NA	NA
5. P	Q8PYC0	Geranylgeranylglyceryl phosphate synthase	1.20e-07	6.37e-06	NA	NA
5. P	Q6LZC1	(5-formylfuran-3-yl)methyl phosphate synthase	1.55e-09	1.62e-02	NA	NA
5. P	Q0TNQ8	Deoxyribose-phosphate aldolase	4.30e-10	1.12e-08	NA	NA
5. P	Q9JVE0	Tryptophan synthase alpha chain	9.70e-07	9.92e-09	NA	NA
5. P	B1MBX3	Imidazole glycerol phosphate synthase subunit HisF	3.35e-10	5.68e-04	NA	NA
5. P	D0ZLR2	2-dehydro-3-deoxy-phosphogluconate aldolase	1.11e-04	2.53e-02	NA	NA
5. P	A4YVD6	Indole-3-glycerol phosphate synthase	5.24e-10	1.66e-08	NA	NA
5. P	B9K9S2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.25e-05	1.93e-07	NA	NA
5. P	Q5KY94	3-dehydroquinate dehydratase	6.65e-08	3.60e-03	NA	NA
5. P	B3E693	Pyridoxine 5'-phosphate synthase	3.00e-08	5.76e-09	NA	NA
5. P	Q1CR25	Pyridoxine 5'-phosphate synthase	7.13e-07	4.55e-06	NA	NA
5. P	B2FNZ5	N-(5'-phosphoribosyl)anthranilate isomerase	2.53e-06	2.59e-03	NA	NA
5. P	Q5GXE5	Thiazole synthase	2.31e-09	3.79e-09	NA	NA
5. P	Q9TLW8	Tryptophan synthase alpha chain	6.38e-09	1.01e-06	NA	NA
5. P	B9E152	Tryptophan synthase alpha chain	4.55e-07	1.06e-04	NA	NA
5. P	O34557	Ribulose-phosphate 3-epimerase	9.47e-09	6.86e-04	NA	NA
5. P	Q6HLE4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.50e-08	1.18e-04	NA	NA
5. P	Q55508	Indole-3-glycerol phosphate synthase	1.02e-09	6.92e-05	NA	NA
5. P	B7M8V6	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.26e-08	1.15e-11	NA	NA
5. P	A0JC77	2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase	3.26e-09	3.77e-04	NA	NA
5. P	P62352	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.61e-08	4.22e-04	NA	NA
5. P	Q8NXX1	3-hexulose-6-phosphate synthase	1.89e-09	2.41e-07	NA	NA
5. P	Q494D7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.68e-06	2.39e-08	NA	NA
5. P	B4TGJ6	3-dehydroquinate dehydratase	2.46e-08	2.07e-02	NA	NA
5. P	P05324	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.23e-10	2.22e-07	NA	NA
5. P	A0QQK7	Thiamine-phosphate synthase	7.64e-07	3.84e-09	NA	NA
5. P	Q2KE60	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.40e-06	3.14e-05	NA	NA
5. P	Q2NHA5	Orotidine 5'-phosphate decarboxylase	4.87e-07	1.14e-06	NA	NA
5. P	A4G4G3	Tryptophan synthase alpha chain	2.20e-09	2.45e-08	NA	NA
5. P	B7INA3	Imidazole glycerol phosphate synthase subunit HisF	2.44e-10	4.25e-03	NA	NA
5. P	A9WD26	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.78e-10	6.69e-04	NA	NA
5. P	A5V9W7	Tryptophan synthase alpha chain	7.95e-09	1.29e-04	NA	NA
5. P	Q9UXX2	Triosephosphate isomerase	8.72e-11	1.10e-14	NA	NA
5. P	Q2LQ82	Orotidine 5'-phosphate decarboxylase	4.74e-09	1.57e-02	NA	NA
5. P	B9MN52	Thiamine-phosphate synthase	3.20e-07	1.53e-05	NA	NA
5. P	Q1D4M4	Imidazole glycerol phosphate synthase subunit HisF	2.06e-07	3.57e-03	NA	NA
5. P	B8GU31	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.66e-09	8.55e-07	NA	NA
5. P	B1ZT49	Tryptophan synthase alpha chain	2.98e-07	1.00e-06	NA	NA
5. P	Q13TQ9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.25e-09	6.19e-04	NA	NA
5. P	B7MVG9	3-dehydroquinate dehydratase	2.38e-08	5.82e-04	NA	NA
5. P	C6C1D3	N-(5'-phosphoribosyl)anthranilate isomerase	1.58e-06	2.65e-03	NA	NA
5. P	Q6M1A9	Geranylgeranylglyceryl phosphate synthase	1.72e-06	5.49e-07	NA	NA
5. P	O26652	Geranylgeranylglyceryl phosphate synthase	1.02e-07	1.34e-07	NA	NA
5. P	Q8FSJ0	Deoxyribose-phosphate aldolase	2.37e-09	1.50e-04	NA	NA
5. P	A8FMU3	Pyridoxine 5'-phosphate synthase	3.97e-08	5.93e-04	NA	NA
5. P	Q3J6Q2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.24e-07	1.30e-07	NA	NA
5. P	Q0W358	Imidazole glycerol phosphate synthase subunit HisF	2.75e-10	4.79e-02	NA	NA
5. P	Q5WGS3	Indole-3-glycerol phosphate synthase	7.47e-08	6.66e-10	NA	NA
5. P	C1CG41	Tryptophan synthase alpha chain	5.70e-08	7.57e-06	NA	NA
5. P	Q3Z9H3	Pyridoxal 5'-phosphate synthase subunit PdxS	5.52e-09	1.67e-02	NA	NA
5. P	A6LU95	N-(5'-phosphoribosyl)anthranilate isomerase	2.99e-06	7.68e-03	NA	NA
5. P	B5ERI2	Indole-3-glycerol phosphate synthase	3.49e-11	4.43e-09	NA	NA
5. P	Q66AK5	Tryptophan synthase alpha chain	2.65e-09	3.47e-06	NA	NA
5. P	Q9JVH4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.39e-06	2.20e-07	NA	NA
5. P	B7HGZ9	Indole-3-glycerol phosphate synthase	1.48e-08	1.60e-11	NA	NA
5. P	Q8ZTX5	Geranylgeranylglyceryl phosphate synthase	6.50e-08	2.18e-05	NA	NA
5. P	Q0TA75	Thiazole synthase	1.66e-09	6.20e-07	NA	NA
5. P	Q89WM5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.89e-06	9.92e-04	NA	NA
5. P	C3P786	Deoxyribose-phosphate aldolase	1.06e-09	9.62e-08	NA	NA
5. P	B0CGT9	Indole-3-glycerol phosphate synthase	5.84e-10	1.91e-07	NA	NA
5. P	Q9HFV5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.77e-06	7.18e-05	NA	NA
5. P	B9KMV0	Indole-3-glycerol phosphate synthase	3.94e-10	5.53e-08	NA	NA
5. P	B2JHI8	Indole-3-glycerol phosphate synthase	1.32e-10	2.72e-08	NA	NA
5. P	Q5HPG9	Tryptophan synthase alpha chain	1.10e-08	1.24e-06	NA	NA
5. P	C1L005	3-dehydroquinate dehydratase	1.95e-08	4.12e-02	NA	NA
5. P	Q5MI53	Tryptophan synthase alpha chain	2.16e-06	7.56e-09	NA	NA
5. P	B3ED41	Thiamine-phosphate synthase	1.67e-09	4.81e-04	NA	NA
5. P	A0K458	Indole-3-glycerol phosphate synthase	1.58e-10	4.19e-09	NA	NA
5. P	Q8KCB0	Imidazole glycerol phosphate synthase subunit HisF	1.35e-07	3.82e-03	NA	NA
5. P	B1IZ50	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.33e-08	4.21e-06	NA	NA
5. P	A8Z245	Tryptophan synthase alpha chain	1.09e-08	6.21e-09	NA	NA
5. P	B6JCP3	Tryptophan synthase alpha chain	1.48e-08	2.24e-04	NA	NA
5. P	Q2YQY8	Imidazole glycerol phosphate synthase subunit HisF	2.86e-10	1.17e-04	NA	NA
5. P	P74561	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.47e-07	8.95e-04	NA	NA
5. P	A5TZK6	Deoxyribose-phosphate aldolase	1.38e-10	8.95e-03	NA	NA
5. P	B1IT10	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.55e-08	1.98e-11	NA	NA
5. P	Q9KF39	Heptaprenylglyceryl phosphate synthase	1.12e-05	1.66e-08	NA	NA
5. P	Q931N1	Heptaprenylglyceryl phosphate synthase	1.29e-05	1.19e-06	NA	NA
5. P	Q2P0J5	Thiazole synthase	2.36e-09	3.79e-09	NA	NA
5. P	Q7N485	Tryptophan synthase alpha chain	2.09e-09	2.85e-04	NA	NA
5. P	B4SLE8	Indole-3-glycerol phosphate synthase	3.39e-10	1.19e-08	NA	NA
5. P	Q5N3I3	Thiazole synthase	1.07e-04	7.57e-08	NA	NA
5. P	B5Z8S2	Tryptophan synthase alpha chain	9.50e-07	8.90e-09	NA	NA
5. P	B8EA59	Thiazole synthase	1.91e-09	7.08e-06	NA	NA
5. P	A3PI62	Imidazole glycerol phosphate synthase subunit HisF	3.30e-10	3.67e-04	NA	NA
5. P	C3PI20	Deoxyribose-phosphate aldolase	4.74e-10	5.46e-05	NA	NA
5. P	B7UPE5	Thiazole synthase	1.80e-09	1.11e-05	NA	NA
5. P	Q9CB45	Deoxyribose-phosphate aldolase	1.86e-10	9.16e-06	NA	NA
5. P	Q3JQ80	Pyridoxine 5'-phosphate synthase	3.52e-08	9.52e-08	NA	NA
5. P	A2BPR2	Imidazole glycerol phosphate synthase subunit HisF	1.27e-07	4.01e-03	NA	NA
5. P	B9LR64	Deoxyribose-phosphate aldolase	2.33e-07	1.52e-03	NA	NA
5. P	Q5FA22	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.71e-06	1.65e-07	NA	NA
5. P	Q89WE4	Tryptophan synthase alpha chain	2.07e-08	3.24e-03	NA	NA
5. P	B3E617	Imidazole glycerol phosphate synthase subunit HisF	2.23e-10	2.27e-03	NA	NA
5. P	A1BDS2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.49e-07	9.77e-05	NA	NA
5. P	Q83L15	3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase	2.28e-08	4.08e-02	NA	NA
5. P	P59520	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.63e-09	2.30e-04	NA	NA
5. P	A7X435	Heptaprenylglyceryl phosphate synthase	1.25e-05	1.19e-06	NA	NA
5. P	D5BCE4	Geranylgeranylglyceryl phosphate synthase	6.52e-09	5.43e-04	NA	NA
5. P	A1SL57	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.56e-07	2.70e-11	NA	NA
5. P	Q6HLU3	Tryptophan synthase alpha chain	1.66e-09	1.58e-08	NA	NA
5. P	A4ISR3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.28e-06	2.04e-04	NA	NA
5. P	B9KEI4	Imidazole glycerol phosphate synthase subunit HisF	2.17e-10	8.73e-03	NA	NA
5. P	Q1Q835	Imidazole glycerol phosphate synthase subunit HisF	4.53e-10	6.75e-03	NA	NA
5. P	Q1GK79	N-(5'-phosphoribosyl)anthranilate isomerase	1.14e-07	1.39e-02	NA	NA
5. P	Q5JHL2	Uncharacterized protein TK2179	2.28e-09	2.27e-03	NA	NA
5. P	Q81HQ5	Thiazole synthase	2.36e-05	4.63e-07	NA	NA
5. P	A9KKR5	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	1.99e-04	6.92e-03	NA	NA
5. P	O80448	Pyridoxal 5'-phosphate synthase subunit PDX1.1	2.34e-06	4.65e-02	NA	NA
5. P	Q3V7P0	Pyridoxine 5'-phosphate synthase	1.61e-08	3.29e-10	NA	NA
5. P	A4JAW8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.07e-09	1.72e-07	NA	NA
5. P	Q03JB9	Indole-3-glycerol phosphate synthase	2.00e-08	2.74e-10	NA	NA
5. P	Q3B5P7	Pyridoxine 5'-phosphate synthase	1.31e-08	1.63e-08	NA	NA
5. P	Q4QKF6	Tryptophan synthase alpha chain	5.15e-09	3.97e-06	NA	NA
5. P	B7IM77	Tryptophan synthase alpha chain	1.24e-09	2.16e-07	NA	NA
5. P	Q04W72	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.87e-10	1.89e-03	NA	NA
5. P	Q7MT73	Thiazole synthase	3.43e-09	9.43e-08	NA	NA
5. P	P26939	Indole-3-glycerol phosphate synthase	7.85e-08	3.88e-09	NA	NA
5. P	A3MUU3	Geranylgeranylglyceryl phosphate synthase	1.04e-07	1.93e-03	NA	NA
5. P	Q5F9X5	N-(5'-phosphoribosyl)anthranilate isomerase	1.17e-06	2.14e-02	NA	NA
5. P	C5D3D6	Indole-3-glycerol phosphate synthase	4.01e-08	1.61e-08	NA	NA
5. P	Q0C643	Imidazole glycerol phosphate synthase subunit HisF	2.09e-10	4.21e-03	NA	NA
5. P	Q5LBZ2	Tryptophan synthase alpha chain	4.47e-06	3.11e-05	NA	NA
5. P	Q92TB3	Imidazole glycerol phosphate synthase subunit HisF	3.90e-10	9.17e-05	NA	NA
5. P	A5E8E8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.27e-06	2.19e-04	NA	NA
5. P	Q9K192	Indole-3-glycerol phosphate synthase	2.22e-10	2.09e-06	NA	NA
5. P	A1RU26	Deoxyribose-phosphate aldolase	1.06e-08	3.57e-05	NA	NA
5. P	Q82XI7	Thiazole synthase	2.52e-09	5.52e-06	NA	NA
5. P	Q3B2Q6	Imidazole glycerol phosphate synthase subunit HisF	1.18e-07	1.08e-02	NA	NA
5. P	Q7VWW0	Pyridoxine 5'-phosphate synthase	2.26e-08	3.78e-07	NA	NA
5. P	A0JYP1	Thiamine-phosphate synthase	8.26e-09	3.32e-05	NA	NA
5. P	Q9L0Z5	Ribulose-phosphate 3-epimerase	1.83e-08	1.09e-02	NA	NA
5. P	O19904	Uncharacterized protein ycf23	2.01e-11	9.34e-12	NA	NA
5. P	Q8YNQ6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.60e-07	1.97e-05	NA	NA
5. P	A3CTK2	Geranylgeranylglyceryl phosphate synthase	1.00e-05	8.15e-11	NA	NA
5. P	Q87UG3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.48e-06	9.93e-07	NA	NA
5. P	B0K628	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.37e-10	1.34e-06	NA	NA
5. P	Q4FPZ3	Imidazole glycerol phosphate synthase subunit HisF	4.52e-10	7.94e-04	NA	NA
5. P	A6QID4	Heptaprenylglyceryl phosphate synthase	1.60e-05	1.70e-06	NA	NA
5. P	A8Z1D4	3-dehydroquinate dehydratase	9.02e-07	1.41e-02	NA	NA
5. P	A4SEP8	Thiamine-phosphate synthase	6.61e-10	3.30e-06	NA	NA
5. P	B8G5G4	Tryptophan synthase alpha chain	1.05e-08	2.26e-06	NA	NA
5. P	Q7P0F0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.54e-09	2.58e-05	NA	NA
5. P	B9JZC0	Orotidine 5'-phosphate decarboxylase	2.77e-08	1.50e-02	NA	NA
5. P	P44756	Ribulose-phosphate 3-epimerase	1.87e-08	8.45e-05	NA	NA
5. P	O67506	2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase	9.70e-10	4.61e-02	NA	NA
5. P	Q9XBM3	Indole-3-glycerol phosphate synthase	4.68e-10	6.79e-07	NA	NA
5. P	Q9KD67	Deoxyribose-phosphate aldolase	1.61e-09	1.76e-06	NA	NA
5. P	Q3J8N5	Orotidine 5'-phosphate decarboxylase	2.36e-08	4.90e-02	NA	NA
5. P	B0TQY9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.80e-09	1.63e-07	NA	NA
5. P	Q0I9E5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.27e-07	9.00e-05	NA	NA
5. P	Q8ZGH4	Deoxyribose-phosphate aldolase 1	9.68e-10	5.72e-07	NA	NA
5. P	C0RFX3	Imidazole glycerol phosphate synthase subunit HisF	3.30e-10	9.59e-05	NA	NA
5. P	Q49UF2	Thiazole synthase	3.70e-09	5.76e-08	NA	NA
5. P	P10372	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.74e-08	3.89e-06	NA	NA
5. P	A9M072	Thiazole synthase	8.93e-09	8.73e-04	NA	NA
5. P	Q92NT6	Pyridoxine 5'-phosphate synthase	5.97e-07	3.36e-09	NA	NA
5. P	Q47XB4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.87e-06	3.35e-05	NA	NA
5. P	A0QLL2	Deoxyribose-phosphate aldolase	6.62e-11	2.39e-04	NA	NA
5. P	Q5KVC9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.64e-07	3.25e-04	NA	NA
5. P	A2SE08	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.33e-09	2.63e-05	NA	NA
5. P	Q8SRP6	Ribulose-phosphate 3-epimerase	1.15e-06	1.71e-02	NA	NA
5. P	Q8F150	Tryptophan synthase alpha chain	1.26e-06	2.82e-06	NA	NA
5. P	Q5MZR5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.58e-07	2.83e-05	NA	NA
5. P	Q63EC9	Indole-3-glycerol phosphate synthase	3.82e-11	4.18e-11	NA	NA
5. P	B8I0V0	Indole-3-glycerol phosphate synthase	1.58e-11	2.33e-09	NA	NA
5. P	O66107	Ribulose-phosphate 3-epimerase	5.24e-06	1.53e-04	NA	NA
5. P	C4ZTV3	Tryptophan synthase alpha chain	3.27e-09	5.90e-06	NA	NA
5. P	Q0K8N6	Pyridoxine 5'-phosphate synthase	4.30e-08	2.84e-07	NA	NA
5. P	A0LXW0	Pyridoxine 5'-phosphate synthase	2.24e-08	4.22e-07	NA	NA
5. P	Q500R5	Tryptophan synthase alpha chain	4.34e-05	5.87e-05	NA	NA
5. P	Q2S296	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.59e-09	6.74e-04	NA	NA
5. P	A2SPJ9	Pyridoxal 5'-phosphate synthase subunit PdxS	2.32e-06	3.51e-03	NA	NA
5. P	B7N473	Tryptophan synthase alpha chain	2.91e-09	8.65e-06	NA	NA
5. P	Q8X5X7	3-dehydroquinate dehydratase	2.23e-08	1.03e-03	NA	NA
5. P	C3P0L4	Thiazole synthase	2.51e-05	4.91e-06	NA	NA
5. P	B2URE7	Pyridoxine 5'-phosphate synthase	6.89e-09	1.53e-10	NA	NA
5. P	Q9I5G5	Pyridoxine 5'-phosphate synthase	1.93e-08	1.77e-08	NA	NA
5. P	A5VT61	Tryptophan synthase alpha chain	2.26e-08	5.56e-05	NA	NA
5. P	C4LC88	Tryptophan synthase alpha chain	2.83e-09	1.43e-06	NA	NA
5. P	A5UNQ5	(5-formylfuran-3-yl)methyl phosphate synthase	1.11e-09	8.15e-04	NA	NA
5. P	Q73A11	Deoxyribose-phosphate aldolase	1.02e-09	1.52e-07	NA	NA
5. P	Q59649	N-(5'-phosphoribosyl)anthranilate isomerase	8.09e-07	8.39e-03	NA	NA
5. P	Q3YUF2	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.63e-08	1.98e-11	NA	NA
5. P	Q73BQ6	Tryptophan synthase alpha chain	1.26e-09	7.18e-08	NA	NA
5. P	Q81G03	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.69e-08	3.44e-05	NA	NA
5. P	B7IM74	Indole-3-glycerol phosphate synthase	1.39e-08	1.05e-11	NA	NA
5. P	Q6GDD1	Imidazole glycerol phosphate synthase subunit HisF	3.18e-10	1.25e-03	NA	NA
5. P	Q2IYP6	Thiazole synthase	6.70e-05	1.39e-06	NA	NA
5. P	B7M404	Imidazole glycerol phosphate synthase subunit HisF	1.16e-07	4.48e-02	NA	NA
5. P	A2BZ50	Thiazole synthase	7.03e-09	4.13e-06	NA	NA
5. P	Q1BSD2	Indole-3-glycerol phosphate synthase	9.07e-11	4.19e-09	NA	NA
5. P	Q6NKI6	Thiazole synthase	7.30e-09	7.65e-05	NA	NA
5. P	Q8KPR0	Pyridoxine 5'-phosphate synthase	1.34e-08	1.31e-08	NA	NA
5. P	Q9PKR7	Ribulose-phosphate 3-epimerase	3.56e-09	9.51e-05	NA	NA
5. P	A8FMD4	Thiamine-phosphate synthase	3.00e-09	1.87e-06	NA	NA
5. P	A7NMZ8	Indole-3-glycerol phosphate synthase	9.36e-11	7.43e-07	NA	NA
5. P	Q5NPZ7	Tryptophan synthase alpha chain	1.47e-06	4.30e-05	NA	NA
5. P	B7J9K4	Pyridoxine 5'-phosphate synthase	4.02e-08	1.84e-10	NA	NA
5. P	A6VWY4	N-(5'-phosphoribosyl)anthranilate isomerase	9.66e-07	4.69e-04	NA	NA
5. P	B7VGU8	Tryptophan synthase alpha chain	1.78e-09	2.81e-05	NA	NA
5. P	P9WI51	Ribulose-phosphate 3-epimerase	2.31e-08	2.15e-02	NA	NA
5. P	B2TL86	Deoxyribose-phosphate aldolase	1.40e-07	7.34e-08	NA	NA
5. P	B7KEI6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.89e-07	4.94e-04	NA	NA
5. P	Q6NDN7	N-(5'-phosphoribosyl)anthranilate isomerase	1.47e-07	7.44e-03	NA	NA
5. P	A5VX76	Imidazole glycerol phosphate synthase subunit HisF	3.92e-10	2.95e-04	NA	NA
5. P	A9VFL4	Thiazole synthase	2.30e-05	9.54e-07	NA	NA
5. P	A6WP22	Imidazole glycerol phosphate synthase subunit HisF	1.24e-07	1.57e-02	NA	NA
5. P	Q6GII7	3-dehydroquinate dehydratase	7.73e-07	3.99e-02	NA	NA
5. P	A0AJ79	Tryptophan synthase alpha chain	5.38e-09	2.26e-04	NA	NA
5. P	B7NGD0	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.58e-08	5.11e-11	NA	NA
5. P	A4VIX8	Pyridoxine 5'-phosphate synthase	2.23e-08	2.16e-05	NA	NA
5. P	Q31ZV3	Tryptophan synthase alpha chain	2.85e-09	7.94e-06	NA	NA
5. P	Q3ATB8	Pyridoxine 5'-phosphate synthase	1.49e-08	2.51e-07	NA	NA
5. P	Q7WF72	Thiamine-phosphate synthase	7.28e-10	8.05e-07	NA	NA
5. P	Q64TA0	Thiazole synthase	2.09e-09	1.68e-03	NA	NA
5. P	B1HVQ1	Imidazole glycerol phosphate synthase subunit HisF	1.04e-10	2.92e-04	NA	NA
5. P	Q6LUH4	Deoxyribose-phosphate aldolase	3.34e-09	7.20e-03	NA	NA
5. P	A8FWD1	Imidazole glycerol phosphate synthase subunit HisF	1.41e-07	8.80e-04	NA	NA
5. P	C1EMQ7	Imidazole glycerol phosphate synthase subunit HisF	2.15e-10	3.11e-03	NA	NA
5. P	Q2W010	Tryptophan synthase alpha chain	4.54e-05	9.68e-05	NA	NA
5. P	A8A9K6	Geranylgeranylglyceryl phosphate synthase	2.06e-06	3.22e-09	NA	NA
5. P	Q3SPS2	Thiazole synthase	4.09e-05	1.31e-05	NA	NA
5. P	Q2FFI9	Heptaprenylglyceryl phosphate synthase	1.63e-05	1.95e-06	NA	NA
5. P	B7HDF2	Thiazole synthase	2.76e-09	6.08e-07	NA	NA
5. P	Q28NK0	Imidazole glycerol phosphate synthase subunit HisF	3.47e-10	1.86e-04	NA	NA
5. P	Q85G31	Thiazole synthase	4.06e-09	1.48e-06	NA	NA
5. P	Q97EF4	N-(5'-phosphoribosyl)anthranilate isomerase	5.19e-08	8.66e-03	NA	NA
5. P	Q136W2	Pyridoxine 5'-phosphate synthase	1.37e-08	3.25e-09	NA	NA
5. P	C3P506	Imidazole glycerol phosphate synthase subunit HisF	2.03e-10	1.44e-03	NA	NA
5. P	B5EHA6	Pyridoxine 5'-phosphate synthase	8.92e-09	1.54e-10	NA	NA
5. P	B7I441	Indole-3-glycerol phosphate synthase	1.16e-09	2.13e-07	NA	NA
5. P	Q2NI84	Imidazole glycerol phosphate synthase subunit HisF	4.66e-07	4.76e-03	NA	NA
5. P	O26232	Orotidine 5'-phosphate decarboxylase	1.14e-06	4.92e-07	NA	NA
5. P	B7LS20	Tryptophan synthase alpha chain	2.92e-09	6.25e-06	NA	NA
5. P	A5E8J8	Orotidine 5'-phosphate decarboxylase	5.12e-08	8.73e-03	NA	NA
5. P	B7JFZ5	Imidazole glycerol phosphate synthase subunit HisF	1.89e-10	1.02e-03	NA	NA
5. P	Q4QN70	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.28e-09	9.26e-07	NA	NA
5. P	Q5XA31	Deoxyribose-phosphate aldolase	4.18e-08	1.22e-06	NA	NA
5. P	Q48L25	N-(5'-phosphoribosyl)anthranilate isomerase	8.34e-07	1.69e-02	NA	NA
5. P	Q0HXQ4	Deoxyribose-phosphate aldolase	3.13e-09	6.08e-03	NA	NA
5. P	B3PGA4	Imidazole glycerol phosphate synthase subunit HisF	3.15e-10	1.15e-02	NA	NA
5. P	A0QHG8	Tryptophan synthase alpha chain	2.04e-04	7.89e-07	NA	NA
5. P	A7MQQ2	Thiazole synthase	1.98e-09	8.98e-07	NA	NA
5. P	C3N6C8	Pyridoxal 5'-phosphate synthase subunit PdxS	2.16e-06	4.87e-02	NA	NA
5. P	B0SUK3	Thiamine-phosphate synthase	6.60e-07	2.83e-05	NA	NA
5. P	Q3AR00	Tryptophan synthase alpha chain	1.31e-06	7.21e-07	NA	NA
5. P	Q6B8L2	Tryptophan synthase alpha chain	1.08e-06	8.74e-10	NA	NA
5. P	Q7W3U2	Thiamine-phosphate synthase	9.98e-10	4.97e-07	NA	NA
5. P	Q3A137	Imidazole glycerol phosphate synthase subunit HisF	2.30e-07	1.16e-04	NA	NA
5. P	Q8EFB5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.51e-09	1.77e-07	NA	NA
5. P	B4TJK9	Tryptophan synthase alpha chain	3.20e-09	3.78e-07	NA	NA
5. P	Q2N8I7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.35e-09	1.61e-08	NA	NA
5. P	B7NC64	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.91e-08	3.08e-07	NA	NA
5. P	Q3V7M2	Pyridoxine 5'-phosphate synthase	3.13e-08	1.05e-07	NA	NA
5. P	A6UW70	Geranylgeranylglyceryl phosphate synthase	1.72e-06	2.65e-10	NA	NA
5. P	A4IJY4	Heptaprenylglyceryl phosphate synthase	8.14e-06	2.15e-08	NA	NA
5. P	Q043A6	Orotidine 5'-phosphate decarboxylase	9.25e-08	3.37e-02	NA	NA
5. P	A5UY50	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.85e-10	1.35e-03	NA	NA
5. P	B8GWN0	Thiazole synthase	2.79e-05	5.14e-10	NA	NA
5. P	B9LI75	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.78e-10	6.69e-04	NA	NA
5. P	Q46WU7	Indole-3-glycerol phosphate synthase	2.31e-10	2.11e-07	NA	NA
5. P	Q98CN6	Tryptophan synthase alpha chain	1.32e-08	3.60e-03	NA	NA
5. P	C5BV99	Imidazole glycerol phosphate synthase subunit HisF	2.63e-10	1.07e-04	NA	NA
5. P	Q6BUV9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.03e-06	2.59e-02	NA	NA
5. P	Q0HJ98	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.34e-09	2.22e-07	NA	NA
5. P	A2SHS3	Tryptophan synthase alpha chain	5.81e-09	8.00e-05	NA	NA
5. P	Q5FNS8	Orotidine 5'-phosphate decarboxylase	1.60e-08	3.22e-02	NA	NA
5. P	P62451	Imidazole glycerol phosphate synthase subunit HisF	1.74e-10	1.35e-02	NA	NA
5. P	A7Z615	Tryptophan synthase alpha chain	1.45e-09	1.06e-04	NA	NA
5. P	A5FFX7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.61e-07	6.40e-08	NA	NA
5. P	Q99SY1	Heptaprenylglyceryl phosphate synthase	1.17e-05	2.04e-06	NA	NA
5. P	Q0VPJ0	Tryptophan synthase alpha chain	6.51e-07	3.99e-08	NA	NA
5. P	B8IPW1	Tryptophan synthase alpha chain	5.57e-05	3.63e-03	NA	NA
5. P	Q9PN59	Pyridoxine 5'-phosphate synthase	3.30e-08	5.47e-03	NA	NA
5. P	Q3B533	N-(5'-phosphoribosyl)anthranilate isomerase	8.68e-07	1.18e-03	NA	NA
5. P	Q7VGA8	Tryptophan synthase alpha chain	2.73e-08	7.48e-09	NA	NA
5. P	C3LAV9	N-(5'-phosphoribosyl)anthranilate isomerase	1.62e-06	4.08e-02	NA	NA
5. P	Q603K3	Imidazole glycerol phosphate synthase subunit HisF	2.78e-10	2.82e-04	NA	NA
5. P	A6QFB2	3-dehydroquinate dehydratase	9.27e-07	1.41e-02	NA	NA
5. P	C4ZYF5	3-dehydroquinate dehydratase	2.50e-08	6.69e-04	NA	NA
5. P	Q4JVZ5	Thiazole synthase	7.11e-09	9.34e-06	NA	NA
5. P	A4SKT0	Tryptophan synthase alpha chain	1.34e-09	2.71e-05	NA	NA
5. P	Q5L912	Pyridoxine 5'-phosphate synthase	2.43e-08	4.99e-09	NA	NA
5. P	B9IV00	Imidazole glycerol phosphate synthase subunit HisF	2.21e-10	9.18e-04	NA	NA
5. P	C1CJT2	Deoxyribose-phosphate aldolase	7.30e-10	3.30e-06	NA	NA
5. P	A4YJV4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.85e-06	2.26e-04	NA	NA
5. P	Q2YXZ6	Tryptophan synthase alpha chain	1.28e-08	3.29e-08	NA	NA
5. P	Q81GG7	Indole-3-glycerol phosphate synthase	1.43e-08	2.67e-11	NA	NA
5. P	Q7W3P5	Thiazole synthase	2.24e-09	5.66e-07	NA	NA
5. P	O68906	Tryptophan synthase alpha chain	7.65e-08	3.47e-06	NA	NA
5. P	A7FI34	Tryptophan synthase alpha chain	2.78e-09	3.47e-06	NA	NA
5. P	B1JE34	Indole-3-glycerol phosphate synthase	2.74e-10	1.79e-05	NA	NA
5. P	B3QFS7	Thiazole synthase	4.41e-05	2.10e-05	NA	NA
5. P	A8H728	Deoxyribose-phosphate aldolase	4.40e-09	3.29e-03	NA	NA
5. P	Q9CCP9	Ribulose-phosphate 3-epimerase	4.34e-08	5.21e-03	NA	NA
5. P	B2JHY0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.81e-07	1.08e-05	NA	NA
5. P	B0V8R7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.75e-06	1.54e-05	NA	NA
5. P	A6T377	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.46e-09	6.86e-05	NA	NA
5. P	C6BV77	Pyridoxine 5'-phosphate synthase	1.45e-08	2.96e-07	NA	NA
5. P	A7IA09	Thiamine-phosphate synthase	2.73e-09	2.26e-04	NA	NA
5. P	B8J160	Tryptophan synthase alpha chain	1.04e-07	7.08e-06	NA	NA
5. P	C3LAV7	Tryptophan synthase alpha chain	1.66e-09	2.06e-08	NA	NA
5. P	Q2J2G5	Tryptophan synthase alpha chain	2.26e-08	1.30e-03	NA	NA
5. P	Q319J2	Indole-3-glycerol phosphate synthase	6.01e-10	1.46e-05	NA	NA
5. P	A5WDG7	Tryptophan synthase alpha chain	1.73e-08	9.31e-03	NA	NA
5. P	Q4L680	Tryptophan synthase alpha chain	7.59e-09	2.30e-06	NA	NA
5. P	B4S3G9	Pyridoxine 5'-phosphate synthase	3.51e-08	5.76e-09	NA	NA
5. P	A9MPY6	Tryptophan synthase alpha chain	2.78e-09	5.24e-08	NA	NA
5. P	P31204	Tryptophan synthase alpha chain	1.85e-09	1.22e-07	NA	NA
5. P	A7ZUK5	Thiazole synthase	1.56e-09	2.17e-06	NA	NA
5. P	Q7V6Q5	Pyridoxine 5'-phosphate synthase	2.93e-08	3.90e-11	NA	NA
5. P	Q92TB2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.29e-09	5.03e-05	NA	NA
5. P	Q7N6I4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1	1.30e-08	6.07e-06	NA	NA
5. P	B0KJV8	Thiamine-phosphate synthase	5.47e-07	1.14e-04	NA	NA
5. P	Q47QR5	Indole-3-glycerol phosphate synthase	4.79e-09	2.11e-09	NA	NA
5. P	B2U984	Pyridoxine 5'-phosphate synthase	3.24e-08	4.82e-06	NA	NA
5. P	A6L6Z1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.07e-09	1.85e-04	NA	NA
5. P	A6Q3Y6	Pyridoxine 5'-phosphate synthase	1.58e-07	2.11e-06	NA	NA
5. P	A3PCK5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.45e-07	4.81e-04	NA	NA
5. P	A7HSH0	Imidazole glycerol phosphate synthase subunit HisF	9.68e-10	4.58e-05	NA	NA
5. P	B7VBQ7	N-(5'-phosphoribosyl)anthranilate isomerase	7.67e-07	6.86e-03	NA	NA
5. P	Q07UH0	Tryptophan synthase alpha chain	5.59e-06	8.19e-03	NA	NA
5. P	Q9ZBL5	Thiamine-phosphate synthase	6.10e-09	6.88e-06	NA	NA
5. P	Q3YYV2	Pyridoxine 5'-phosphate synthase	1.90e-08	4.99e-11	NA	NA
5. P	Q5LCA6	Thiazole synthase	2.15e-09	1.68e-03	NA	NA
5. P	Q3V7G1	Pyridoxine 5'-phosphate synthase	3.47e-08	1.02e-07	NA	NA
5. P	Q31JD2	Thiazole synthase	4.18e-05	3.71e-05	NA	NA
5. P	A4JB67	Indole-3-glycerol phosphate synthase	1.40e-10	1.83e-09	NA	NA
5. P	B4TMR9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.70e-08	3.89e-06	NA	NA
5. P	A9L4C0	Imidazole glycerol phosphate synthase subunit HisF	3.02e-07	1.57e-02	NA	NA
5. P	O74110	Orotidine 5'-phosphate decarboxylase	1.25e-09	1.37e-03	NA	NA
5. P	Q3JCY8	Pyridoxine 5'-phosphate synthase	2.52e-08	1.53e-10	NA	NA
5. P	Q2LUE0	Tryptophan synthase alpha chain	4.52e-07	6.68e-06	NA	NA
5. P	Q8ZKP8	Putative epimerase LsrE	8.40e-08	1.17e-03	NA	NA
5. P	Q5SJ28	Deoxyribose-phosphate aldolase	3.97e-10	1.72e-07	NA	NA
5. P	B4RPF1	Indole-3-glycerol phosphate synthase	7.28e-10	2.63e-05	NA	NA
5. P	A2S138	Tryptophan synthase alpha chain	9.10e-09	4.58e-07	NA	NA
5. P	B3QPB1	Tryptophan synthase alpha chain	1.87e-06	4.47e-09	NA	NA
5. P	A0K3V7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.41e-09	6.82e-08	NA	NA
5. P	Q46EN8	Geranylgeranylglyceryl phosphate synthase	1.14e-07	1.63e-06	NA	NA
5. P	P64361	Imidazole glycerol phosphate synthase subunit HisF	2.71e-10	1.63e-03	NA	NA
5. P	P12289	N-(5'-phosphoribosyl)anthranilate isomerase	2.56e-07	2.65e-03	NA	NA
5. P	A6WRB8	Deoxyribose-phosphate aldolase	3.99e-09	3.75e-03	NA	NA
5. P	Q31E64	Imidazole glycerol phosphate synthase subunit HisF	6.77e-10	1.32e-02	NA	NA
5. P	Q6DAM4	Thiazole synthase	2.39e-09	8.68e-05	NA	NA
5. P	Q12X87	Orotidine 5'-phosphate decarboxylase	1.72e-09	2.67e-07	NA	NA
5. P	B2A2Z7	Pyridoxal 5'-phosphate synthase subunit PdxS	1.72e-06	1.08e-02	NA	NA
5. P	B1YJ15	Heptaprenylglyceryl phosphate synthase	6.78e-06	6.82e-08	NA	NA
5. P	B3R113	Tryptophan synthase alpha chain	7.61e-09	3.26e-05	NA	NA
5. P	Q2QD12	Ribulose-phosphate 3-epimerase-like protein 1	4.80e-08	6.40e-04	NA	NA
5. P	A9BS06	Indole-3-glycerol phosphate synthase	1.88e-10	2.51e-06	NA	NA
5. P	O34790	Heptaprenylglyceryl phosphate synthase	8.79e-06	4.58e-10	NA	NA
5. P	Q8DMP6	Thiazole synthase	1.04e-04	6.28e-09	NA	NA
5. P	P06562	Tryptophan synthase alpha chain	1.29e-09	2.32e-03	NA	NA
5. P	C1KVS7	Indole-3-glycerol phosphate synthase	3.32e-11	4.57e-09	NA	NA
5. P	Q9RML6	Pyridoxine 5'-phosphate synthase	1.74e-08	4.40e-07	NA	NA
5. P	Q8YI24	Pyridoxine 5'-phosphate synthase	7.31e-07	8.15e-08	NA	NA
5. P	A0RQL2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.21e-09	9.92e-09	NA	NA
5. P	Q21U92	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.57e-09	1.63e-06	NA	NA
5. P	Q3AIG3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.95e-07	1.17e-04	NA	NA
5. P	B7V9E0	Thiamine-phosphate synthase	7.79e-07	4.65e-04	NA	NA
5. P	Q126M0	Tryptophan synthase alpha chain	1.46e-08	2.02e-06	NA	NA
5. P	B0JXU3	Tryptophan synthase alpha chain	9.89e-10	6.26e-05	NA	NA
5. P	B7IS29	Pyridoxal 5'-phosphate synthase subunit PdxS	1.84e-06	4.90e-02	NA	NA
5. P	Q3JN02	Imidazole glycerol phosphate synthase subunit HisF	1.26e-09	7.14e-03	NA	NA
5. P	Q3Z0G1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.20e-08	7.07e-07	NA	NA
5. P	Q328K1	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.56e-08	1.73e-12	NA	NA
5. P	B0SBH6	Pyridoxine 5'-phosphate synthase	6.75e-07	9.67e-10	NA	NA
5. P	B2U6Z0	N-(5'-phosphoribosyl)anthranilate isomerase	1.82e-06	6.98e-04	NA	NA
5. P	A4VRV9	Imidazole glycerol phosphate synthase subunit HisF	3.62e-10	2.57e-03	NA	NA
5. P	Q3MEF5	Imidazole glycerol phosphate synthase subunit HisF	1.41e-07	1.79e-03	NA	NA
5. P	Q9S2T7	Imidazole glycerol phosphate synthase subunit HisF	2.47e-10	4.11e-03	NA	NA
5. P	A9BJZ9	Imidazole glycerol phosphate synthase subunit HisF	2.37e-10	7.26e-03	NA	NA
5. P	B7KSK7	Tryptophan synthase alpha chain	1.16e-04	3.03e-03	NA	NA
5. P	A5CVK4	Tryptophan synthase alpha chain	3.86e-07	1.24e-06	NA	NA
5. P	A1JPY2	Tryptophan synthase alpha chain	2.63e-09	1.29e-06	NA	NA
5. P	O26244	(5-formylfuran-3-yl)methyl phosphate synthase	3.96e-09	2.96e-02	NA	NA
5. P	Q1CJ29	Tryptophan synthase alpha chain	2.66e-09	2.37e-06	NA	NA
5. P	Q72JE9	Deoxyribose-phosphate aldolase	3.62e-10	4.97e-07	NA	NA
5. P	A5EPQ3	Thiazole synthase	6.39e-05	4.18e-07	NA	NA
5. P	Q6NDN5	Tryptophan synthase alpha chain	2.41e-08	1.60e-02	NA	NA
5. P	Q9Z4X0	Indole-3-glycerol phosphate synthase 2	7.91e-09	3.88e-09	NA	NA
5. P	Q2SUA7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.58e-09	2.03e-07	NA	NA
5. P	P19867	Tryptophan synthase alpha chain	1.79e-09	4.39e-03	NA	NA
5. P	B9DJG9	3-dehydroquinate dehydratase	1.33e-06	1.44e-02	NA	NA
5. P	Q65RC0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.92e-09	1.45e-06	NA	NA
5. P	A9GZW9	Imidazole glycerol phosphate synthase subunit HisF	1.51e-07	4.94e-04	NA	NA
5. P	B7GQ51	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.39e-07	1.74e-05	NA	NA
5. P	B9MDL9	Tryptophan synthase alpha chain	2.37e-06	1.04e-06	NA	NA
5. P	A9A8T4	Geranylgeranylglyceryl phosphate synthase	2.73e-06	9.49e-09	NA	NA
5. P	A0M4T5	Tryptophan synthase alpha chain	1.93e-08	1.17e-05	NA	NA
5. P	Q87DR8	Tryptophan synthase alpha chain	1.10e-06	8.58e-08	NA	NA
5. P	Q8THB0	Triosephosphate isomerase	5.11e-11	4.88e-13	NA	NA
5. P	B1YRW0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.23e-07	3.90e-08	NA	NA
5. P	A9N0K2	Thiazole synthase	1.50e-09	1.63e-06	NA	NA
5. P	Q21SE8	Indole-3-glycerol phosphate synthase	1.86e-10	3.70e-08	NA	NA
5. P	A4YI34	Imidazole glycerol phosphate synthase subunit HisF	2.23e-10	1.90e-02	NA	NA
5. P	B2V9M8	Imidazole glycerol phosphate synthase subunit HisF	2.07e-10	2.40e-02	NA	NA
5. P	Q8A767	Probable transaldolase	4.39e-08	3.00e-02	NA	NA
5. P	Q5P083	Pyridoxine 5'-phosphate synthase	3.16e-08	8.90e-06	NA	NA
5. P	Q7NJM5	Thiazole synthase	1.04e-08	3.29e-08	NA	NA
5. P	Q2IKW1	Thiazole synthase	2.73e-09	2.32e-08	NA	NA
5. P	Q92RN8	Probable 2-dehydro-3-deoxy-6-phosphogalactonate aldolase	2.24e-09	2.19e-03	NA	NA
5. P	P0A795	Pyridoxine 5'-phosphate synthase	1.79e-08	2.73e-11	NA	NA
5. P	Q4JW52	Imidazole glycerol phosphate synthase subunit HisF	2.79e-10	4.76e-03	NA	NA
5. P	B9E0D7	3-dehydroquinate dehydratase	3.22e-08	9.46e-03	NA	NA
5. P	Q48NP7	Indole-3-glycerol phosphate synthase	2.72e-10	1.55e-07	NA	NA
5. P	A4QFA8	Thiazole synthase	6.71e-09	1.53e-05	NA	NA
5. P	Q0BIM8	Indole-3-glycerol phosphate synthase	1.53e-10	2.23e-09	NA	NA
5. P	Q1ICS3	N-(5'-phosphoribosyl)anthranilate isomerase	1.28e-06	2.68e-03	NA	NA
5. P	A6U1J5	Tryptophan synthase alpha chain	1.62e-08	4.14e-09	NA	NA
5. P	Q8RG85	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	2.43e-04	3.96e-02	NA	NA
5. P	A6UEK4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.03e-09	7.24e-05	NA	NA
5. P	Q6G827	Heptaprenylglyceryl phosphate synthase	1.58e-05	1.70e-06	NA	NA
5. P	A0QQL0	Thiazole synthase	2.03e-09	1.55e-07	NA	NA
5. P	Q65M66	3-dehydroquinate dehydratase	1.31e-08	2.02e-03	NA	NA
5. P	P62353	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.78e-07	2.95e-04	NA	NA
5. P	Q6FPN5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.06e-06	5.17e-05	NA	NA
5. P	B3EM61	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.89e-10	1.70e-03	NA	NA
5. P	Q7W2Y0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.97e-07	8.21e-07	NA	NA
5. P	P9WG72	Thiazole synthase	2.31e-09	7.73e-08	NA	NA
5. P	P60667	Imidazole glycerol phosphate synthase subunit HisF	2.08e-10	4.53e-04	NA	NA
5. P	A8FAP9	Heptaprenylglyceryl phosphate synthase	7.98e-06	8.34e-11	NA	NA
5. P	C0RFX2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.06e-06	1.80e-04	NA	NA
5. P	P39364	Putative sgc region protein SgcQ	5.94e-09	1.35e-04	NA	NA
5. P	Q5P5J1	Thiazole synthase	2.21e-09	7.98e-08	NA	NA
5. P	A8HQ60	Tryptophan synthase alpha chain	2.20e-08	6.98e-05	NA	NA
5. P	A3NDZ3	Indole-3-glycerol phosphate synthase	8.09e-11	8.52e-09	NA	NA
5. P	A2BV90	Imidazole glycerol phosphate synthase subunit HisF	2.41e-07	2.94e-02	NA	NA
5. P	A7ZL78	Tryptophan synthase alpha chain	3.04e-09	6.07e-06	NA	NA
5. P	B7IY02	Thiazole synthase	2.25e-05	6.08e-07	NA	NA
5. P	B0C904	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.07e-07	6.20e-05	NA	NA
5. P	B0KFW2	Tryptophan synthase alpha chain	4.53e-05	3.35e-03	NA	NA
5. P	A1VEV5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.79e-07	2.95e-04	NA	NA
5. P	B2SVN5	Tryptophan synthase alpha chain	5.62e-09	6.31e-06	NA	NA
5. P	A6WPX2	Tryptophan synthase alpha chain	3.44e-09	5.34e-04	NA	NA
5. P	O27398	Imidazole glycerol phosphate synthase subunit HisF	4.47e-07	2.49e-02	NA	NA
5. P	P58638	Orotidine 5'-phosphate decarboxylase	2.51e-08	1.69e-02	NA	NA
5. P	Q7A774	3-hexulose-6-phosphate synthase	2.02e-09	1.07e-07	NA	NA
5. P	Q2P3J9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.57e-10	2.12e-05	NA	NA
5. P	P0AG09	Ribulose-phosphate 3-epimerase	1.52e-08	7.38e-05	NA	NA
5. P	Q5HTM5	Pyridoxine 5'-phosphate synthase	4.15e-08	3.66e-03	NA	NA
5. P	Q2SU89	Thiazole synthase	1.10e-08	8.99e-06	NA	NA
5. P	B8FJ89	Pyridoxine 5'-phosphate synthase	7.66e-09	2.62e-07	NA	NA
5. P	Q47EF4	Pyridoxine 5'-phosphate synthase	2.60e-08	7.08e-09	NA	NA
5. P	P59457	Tryptophan synthase alpha chain	4.13e-07	9.71e-11	NA	NA
5. P	B5Y6I1	Thiamine-phosphate synthase	2.61e-10	5.89e-08	NA	NA
5. P	A9N159	3-dehydroquinate dehydratase	2.40e-08	2.07e-02	NA	NA
5. P	Q82A84	Indole-3-glycerol phosphate synthase	5.25e-09	4.19e-09	NA	NA
5. P	B7MT10	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.54e-08	1.15e-11	NA	NA
5. P	Q48EV6	Pyridoxine 5'-phosphate synthase	3.55e-08	1.15e-08	NA	NA
5. P	Q5LBD6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.81e-10	9.16e-06	NA	NA
5. P	A6T7W5	Tryptophan synthase alpha chain	2.56e-09	3.54e-05	NA	NA
5. P	B8E2C8	Imidazole glycerol phosphate synthase subunit HisF	2.81e-10	1.46e-04	NA	NA
5. P	C1KW59	Heptaprenylglyceryl phosphate synthase	1.17e-05	8.38e-07	NA	NA
5. P	B1KCV0	Deoxyribose-phosphate aldolase	1.01e-09	1.63e-07	NA	NA
5. P	B5ED95	Thiazole synthase	1.85e-09	2.28e-10	NA	NA
5. P	Q0TG63	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.32e-08	3.48e-07	NA	NA
5. P	Q02PS6	N-(5'-phosphoribosyl)anthranilate isomerase	8.90e-07	5.51e-03	NA	NA
5. P	A6Q1C9	Thiazole synthase	3.28e-09	6.56e-09	NA	NA
5. P	Q5FJB3	Orotidine 5'-phosphate decarboxylase	1.22e-07	1.51e-02	NA	NA
5. P	Q9LAG8	Tryptophan synthase alpha chain	4.56e-08	1.27e-04	NA	NA
5. P	Q6F7A5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.16e-08	4.96e-06	NA	NA
5. P	Q87AE8	Thiazole synthase	2.32e-09	1.09e-08	NA	NA
5. P	Q8AAD8	Tryptophan synthase alpha chain	2.08e-06	1.58e-07	NA	NA
5. P	A3CTR9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.52e-10	2.11e-06	NA	NA
5. P	A6TVU7	Thiazole synthase	2.04e-09	1.43e-08	NA	NA
5. P	Q2GJT4	Pyridoxine 5'-phosphate synthase	5.88e-09	6.61e-11	NA	NA
5. P	Q87VY6	Thiamine-phosphate synthase	7.55e-07	2.07e-04	NA	NA
5. P	B3EK52	Thiazole synthase	2.16e-09	1.44e-03	NA	NA
5. P	A4WKQ6	N-(5'-phosphoribosyl)anthranilate isomerase	3.34e-07	1.26e-02	NA	NA
5. P	Q6AF66	Tryptophan synthase alpha chain	4.84e-09	1.60e-06	NA	NA
5. P	B6JG29	Indole-3-glycerol phosphate synthase	3.04e-10	3.51e-08	NA	NA
5. P	A4XBL2	Thiamine-phosphate synthase	1.30e-05	1.26e-02	NA	NA
5. P	Q0I131	Thiamine-phosphate synthase	1.59e-09	6.34e-08	NA	NA
5. P	Q2KXM4	Pyridoxine 5'-phosphate synthase	1.77e-08	5.10e-09	NA	NA
5. P	Q02EM5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.11e-06	7.79e-05	NA	NA
5. P	P50857	N-(5'-phosphoribosyl)anthranilate isomerase	8.39e-07	3.57e-06	NA	NA
5. P	A8HYT7	Imidazole glycerol phosphate synthase subunit HisF	2.32e-10	1.72e-03	NA	NA
5. P	A6VQW4	Deoxyribose-phosphate aldolase	2.69e-07	9.70e-09	NA	NA
5. P	B3WED2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.97e-07	7.38e-05	NA	NA
5. P	Q9LBW4	3-hexulose-6-phosphate synthase	1.75e-10	4.85e-10	NA	NA
5. P	A4J707	Imidazole glycerol phosphate synthase subunit HisF	1.57e-10	2.05e-04	NA	NA
5. P	Q9JWI4	Thiazole synthase	9.51e-09	2.65e-04	NA	NA
5. P	Q82A81	Tryptophan synthase alpha chain	5.49e-06	3.01e-09	NA	NA
5. P	C0Z4C0	Heptaprenylglyceryl phosphate synthase	7.11e-06	4.44e-07	NA	NA
5. P	C3MW86	Pyridoxal 5'-phosphate synthase subunit PdxS	2.64e-06	4.87e-02	NA	NA
5. P	Q1QS34	Tryptophan synthase alpha chain	1.70e-08	2.05e-04	NA	NA
5. P	Q7MNH9	Copper homeostasis protein CutC	1.36e-08	1.20e-02	NA	NA
5. P	A1SVD0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.44e-09	5.24e-08	NA	NA
5. P	Q8ZY14	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.39e-07	5.36e-05	NA	NA
5. P	A5D4K1	Thiazole synthase	3.64e-09	1.16e-07	NA	NA
5. P	Q9CG48	Thiamine-phosphate synthase	4.98e-07	5.16e-04	NA	NA
5. P	Q9V1G7	N-(5'-phosphoribosyl)anthranilate isomerase	1.11e-07	7.56e-03	NA	NA
5. P	A1BHP6	Imidazole glycerol phosphate synthase subunit HisF	1.15e-07	3.79e-03	NA	NA
5. P	A0LA39	Indole-3-glycerol phosphate synthase	3.72e-10	1.09e-09	NA	NA
5. P	Q1AX07	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.00e-07	1.63e-04	NA	NA
5. P	B8ZRB4	Imidazole glycerol phosphate synthase subunit HisF	2.89e-10	1.08e-02	NA	NA
5. P	A7Z618	Indole-3-glycerol phosphate synthase	1.90e-10	8.44e-11	NA	NA
5. P	Q11HU1	Indole-3-glycerol phosphate synthase	1.02e-07	2.75e-08	NA	NA
5. P	Q4ZNA1	Thiamine-phosphate synthase	7.47e-07	1.88e-04	NA	NA
5. P	B8DNB4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.09e-09	1.43e-03	NA	NA
5. P	Q5QWQ6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.45e-06	2.13e-06	NA	NA
5. P	Q9EYV3	Orotidine 5'-phosphate decarboxylase	4.79e-08	4.32e-03	NA	NA
5. P	A6T376	Imidazole glycerol phosphate synthase subunit HisF	5.39e-10	6.43e-03	NA	NA
5. P	A6WZX2	Pyridoxine 5'-phosphate synthase	4.74e-07	6.40e-08	NA	NA
5. P	Q1ISJ1	Indole-3-glycerol phosphate synthase	8.72e-11	6.52e-07	NA	NA
5. P	Q12UK2	Triosephosphate isomerase	7.72e-11	1.65e-10	NA	NA
5. P	Q0A5D2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.99e-07	4.89e-05	NA	NA
5. P	Q5V4J7	Triosephosphate isomerase	4.16e-10	1.37e-08	NA	NA
5. P	P40545	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.04e-06	6.37e-05	NA	NA
5. P	Q1RCA7	Tryptophan synthase alpha chain	2.96e-09	3.57e-06	NA	NA
5. P	O66567	Imidazole glycerol phosphate synthase subunit HisF	2.89e-10	4.19e-04	NA	NA
5. P	A1KRV4	Indole-3-glycerol phosphate synthase	6.89e-10	1.47e-05	NA	NA
5. P	B8EM84	Imidazole glycerol phosphate synthase subunit HisF	1.69e-10	2.27e-07	NA	NA
5. P	A4VNJ1	Tryptophan synthase alpha chain	2.72e-06	2.89e-05	NA	NA
5. P	C4XSN4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.86e-07	5.44e-07	NA	NA
5. P	P72966	Photosystem I biogenesis protein BtpA	7.25e-09	3.30e-02	NA	NA
5. P	Q13E39	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.73e-07	7.08e-06	NA	NA
5. P	Q8FP55	Thiamine-phosphate synthase	1.07e-07	2.46e-07	NA	NA
5. P	A5VWL2	Tryptophan synthase alpha chain	7.23e-09	4.32e-03	NA	NA
5. P	Q311P4	Thiazole synthase	4.30e-09	6.85e-09	NA	NA
5. P	Q39YP3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.23e-09	4.88e-09	NA	NA
5. P	B5F4M3	Tryptophan synthase alpha chain	3.76e-09	3.78e-07	NA	NA
5. P	Q9X0C7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.25e-05	6.61e-08	NA	NA
5. P	Q058A3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.71e-06	3.41e-05	NA	NA
5. P	A5VX75	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.90e-08	6.15e-05	NA	NA
5. P	A1RH87	Deoxyribose-phosphate aldolase	5.12e-09	4.35e-03	NA	NA
5. P	P57603	Ribulose-phosphate 3-epimerase	5.11e-06	7.04e-04	NA	NA
5. P	P40117	Ribulose-phosphate 3-epimerase 1	1.34e-08	1.48e-04	NA	NA
5. P	Q73EM5	Heptaprenylglyceryl phosphate synthase	7.77e-06	8.64e-11	NA	NA
5. P	Q9K6Z5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.40e-09	3.85e-03	NA	NA
5. P	P22095	Tryptophan synthase alpha chain	1.67e-09	5.77e-05	NA	NA
5. P	B3QMD7	Thiazole synthase	1.80e-09	6.18e-03	NA	NA
5. P	Q49XH9	Tryptophan synthase alpha chain	5.12e-09	4.63e-05	NA	NA
5. P	B8HKL1	Pyridoxine 5'-phosphate synthase	7.97e-09	6.30e-11	NA	NA
5. P	A6WX53	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.92e-09	4.90e-04	NA	NA
5. P	Q1B7G8	Phosphoribosyl isomerase A	7.68e-07	2.87e-08	NA	NA
5. P	C1DJD2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.99e-09	8.43e-04	NA	NA
5. P	Q7UZJ9	Thiazole synthase	6.88e-09	3.61e-04	NA	NA
5. P	Q63QH0	Indole-3-glycerol phosphate synthase	1.52e-10	1.22e-08	NA	NA
5. P	O29828	Uncharacterized protein AF_0419	1.69e-09	1.81e-08	NA	NA
5. P	Q39NL8	Deoxyribose-phosphate aldolase	6.66e-10	5.90e-07	NA	NA
5. P	B8H623	Pyridoxine 5'-phosphate synthase	7.30e-08	1.60e-05	NA	NA
5. P	Q31CA5	Imidazole glycerol phosphate synthase subunit HisF	1.22e-07	3.16e-03	NA	NA
5. P	Q740P2	Tryptophan synthase alpha chain	7.87e-08	1.76e-06	NA	NA
5. P	A3P028	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.54e-09	2.65e-07	NA	NA
5. P	B8GU32	Imidazole glycerol phosphate synthase subunit HisF	2.26e-10	1.65e-03	NA	NA
5. P	A7ZMF8	3-dehydroquinate dehydratase	2.44e-08	4.98e-04	NA	NA
5. P	Q57AE9	N-(5'-phosphoribosyl)anthranilate isomerase	9.40e-07	2.89e-02	NA	NA
5. P	B4SDS5	Pyridoxine 5'-phosphate synthase	2.54e-08	1.53e-08	NA	NA
5. P	B2TYF6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.38e-08	4.14e-07	NA	NA
5. P	Q9HK02	Indole-3-glycerol phosphate synthase	2.29e-05	3.11e-07	NA	NA
5. P	Q31R79	N-(5'-phosphoribosyl)anthranilate isomerase	7.67e-08	3.45e-02	NA	NA
5. P	B7MLK1	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.57e-08	1.15e-11	NA	NA
5. P	Q5FTN3	Imidazole glycerol phosphate synthase subunit HisF	1.39e-10	4.04e-04	NA	NA
5. P	Q2KTT2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.79e-07	2.44e-07	NA	NA
5. P	Q2Y7R3	N-(5'-phosphoribosyl)anthranilate isomerase	8.36e-07	7.74e-03	NA	NA
5. P	B0R333	Tryptophan synthase alpha chain	1.97e-09	8.45e-05	NA	NA
5. P	B9KPC9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.13e-07	1.50e-07	NA	NA
5. P	B0KI45	Imidazole glycerol phosphate synthase subunit HisF	3.21e-10	3.71e-04	NA	NA
5. P	Q49W41	3-dehydroquinate dehydratase	4.25e-07	4.79e-02	NA	NA
5. P	A0KWB0	Imidazole glycerol phosphate synthase subunit HisF	1.04e-07	2.14e-03	NA	NA
5. P	Q8TLP6	N-(5'-phosphoribosyl)anthranilate isomerase	2.69e-08	1.62e-05	NA	NA
5. P	Q9S5G4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.34e-08	4.10e-07	NA	NA
5. P	B5F3B2	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.85e-08	1.33e-10	NA	NA
5. P	Q9K0H3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.29e-06	1.11e-06	NA	NA
5. P	Q13TW4	Indole-3-glycerol phosphate synthase	9.69e-11	2.84e-08	NA	NA
5. P	Q2NTX5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.15e-08	4.73e-06	NA	NA
5. P	A1S474	Deoxyribose-phosphate aldolase	3.79e-09	9.11e-04	NA	NA
5. P	B8GLE3	Thiamine-phosphate synthase	1.06e-07	5.26e-05	NA	NA
5. P	A4IQ81	Tryptophan synthase alpha chain	1.19e-09	7.35e-04	NA	NA
5. P	Q1IWD2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.05e-09	4.19e-04	NA	NA
5. P	Q214J9	Pyridoxine 5'-phosphate synthase	1.49e-08	2.51e-06	NA	NA
5. P	A1K4B0	Tryptophan synthase alpha chain	9.97e-09	2.27e-05	NA	NA
5. P	B3QLY7	Indole-3-glycerol phosphate synthase	2.01e-11	3.70e-07	NA	NA
5. P	A5N7R0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.61e-08	1.43e-03	NA	NA
5. P	Q5NPZ5	N-(5'-phosphoribosyl)anthranilate isomerase	4.78e-08	5.51e-03	NA	NA
5. P	Q98KL6	Pyridoxine 5'-phosphate synthase	4.47e-07	1.15e-07	NA	NA
5. P	A2C1N4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.98e-07	1.23e-04	NA	NA
5. P	A9MWR3	Tryptophan synthase alpha chain	3.60e-09	3.78e-07	NA	NA
5. P	Q8XXX9	N-(5'-phosphoribosyl)anthranilate isomerase	1.95e-06	5.11e-04	NA	NA
5. P	B6I851	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.38e-08	5.84e-07	NA	NA
5. P	B7UR66	Tryptophan synthase alpha chain	2.99e-09	4.05e-06	NA	NA
5. P	A4VHK1	Indole-3-glycerol phosphate synthase	2.48e-10	1.36e-06	NA	NA
5. P	C1ELF1	Tryptophan synthase alpha chain	1.56e-09	1.14e-08	NA	NA
5. P	Q3JYQ4	Deoxyribose-phosphate aldolase	4.81e-08	1.53e-07	NA	NA
5. P	A0LJ55	Tryptophan synthase alpha chain	5.58e-10	6.33e-07	NA	NA
5. P	Q215B9	Indole-3-glycerol phosphate synthase	3.28e-10	1.24e-08	NA	NA
5. P	B6YQ30	Imidazole glycerol phosphate synthase subunit HisF	2.73e-10	2.98e-02	NA	NA
5. P	A8G6A7	Indole-3-glycerol phosphate synthase	1.40e-09	5.16e-06	NA	NA
5. P	A1AXM7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.95e-07	2.09e-06	NA	NA
5. P	P58262	Thiazole synthase	1.02e-08	2.36e-07	NA	NA
5. P	Q82AF9	Thiamine-phosphate synthase	3.29e-09	9.42e-05	NA	NA
5. P	B5YGR4	Pyridoxine 5'-phosphate synthase	1.34e-08	3.34e-11	NA	NA
5. P	Q0TIB0	Tryptophan synthase alpha chain	3.20e-09	6.88e-06	NA	NA
5. P	Q8TLP4	Tryptophan synthase alpha chain	2.88e-09	4.57e-09	NA	NA
5. P	B1KHI0	Thiazole synthase	2.10e-09	2.61e-04	NA	NA
5. P	P58791	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.63e-08	3.27e-06	NA	NA
5. P	P00929	Tryptophan synthase alpha chain	2.23e-09	2.78e-07	NA	NA
5. P	B0K2T8	Tryptophan synthase alpha chain	5.18e-07	3.37e-04	NA	NA
5. P	A1KJ19	Phosphoribosyl isomerase A	6.38e-07	3.11e-07	NA	NA
5. P	Q723F8	3-dehydroquinate dehydratase	1.62e-08	2.76e-02	NA	NA
5. P	Q5YNP9	Thiamine-phosphate synthase	8.28e-09	2.78e-08	NA	NA
5. P	A2CB59	Indole-3-glycerol phosphate synthase	7.26e-10	7.21e-07	NA	NA
5. P	A0RB62	Indole-3-glycerol phosphate synthase	2.45e-08	2.70e-11	NA	NA
5. P	P32719	D-allulose-6-phosphate 3-epimerase	2.48e-05	7.68e-03	NA	NA
5. P	Q67KH9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.61e-07	4.61e-03	NA	NA
5. P	B7NTU3	3-dehydroquinate dehydratase	2.52e-08	5.48e-04	NA	NA
5. P	P45455	Ribulose-phosphate 3-epimerase	9.02e-09	4.71e-05	NA	NA
5. P	Q8PV88	Orotidine 5'-phosphate decarboxylase	1.54e-09	1.67e-04	NA	NA
5. P	Q0VSP5	Thiamine-phosphate synthase	2.84e-07	1.60e-05	NA	NA
5. P	Q8FZT6	Pyridoxine 5'-phosphate synthase	8.79e-07	1.07e-07	NA	NA
5. P	Q7UA46	Thiazole synthase	1.01e-04	4.42e-06	NA	NA
5. P	A8AY24	Imidazole glycerol phosphate synthase subunit HisF	2.03e-10	1.26e-03	NA	NA
5. P	A8H5E4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.06e-09	3.89e-06	NA	NA
5. P	A1SL56	Imidazole glycerol phosphate synthase subunit HisF	2.18e-10	1.29e-02	NA	NA
5. P	A1BE95	Pyridoxine 5'-phosphate synthase	1.85e-08	5.22e-09	NA	NA
5. P	C0QR82	Thiamine-phosphate synthase	4.73e-07	3.32e-03	NA	NA
5. P	Q0STA1	Thiamine-phosphate synthase	1.93e-09	5.07e-04	NA	NA
5. P	P26720	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.70e-07	3.67e-04	NA	NA
5. P	A0RYM1	Geranylgeranylglyceryl phosphate synthase	1.58e-10	2.50e-03	NA	NA
5. P	Q9KVS4	Thiazole synthase	1.57e-09	1.16e-05	NA	NA
5. P	B1WQE4	Indole-3-glycerol phosphate synthase	6.46e-10	1.83e-05	NA	NA
5. P	Q92TD0	N-(5'-phosphoribosyl)anthranilate isomerase	9.59e-07	5.56e-03	NA	NA
5. P	A4G9I7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.17e-09	8.49e-06	NA	NA
5. P	B5Z2K2	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.59e-08	1.98e-11	NA	NA
5. P	B6INN5	Thiamine-phosphate synthase	8.39e-07	4.50e-06	NA	NA
5. P	B2HPZ9	Thiamine-phosphate synthase	3.77e-09	7.89e-07	NA	NA
5. P	P9WMM3	Imidazole glycerol phosphate synthase subunit HisF	3.32e-10	2.85e-02	NA	NA
5. P	O66540	Deoxyribose-phosphate aldolase	2.86e-11	1.38e-07	NA	NA
5. P	Q2J340	Imidazole glycerol phosphate synthase subunit HisF	2.06e-10	1.69e-03	NA	NA
5. P	C6BSE3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.40e-07	7.89e-08	NA	NA
5. P	A9GB86	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.76e-07	6.37e-05	NA	NA
5. P	Q112X4	Thiazole synthase	2.25e-08	2.61e-06	NA	NA
5. P	Q5E624	Tryptophan synthase alpha chain	1.97e-09	4.07e-05	NA	NA
5. P	Q87XG4	Pyridoxine 5'-phosphate synthase	2.43e-08	5.63e-09	NA	NA
5. P	A4G086	Pyridoxal 5'-phosphate synthase subunit PdxS	1.79e-06	4.72e-02	NA	NA
5. P	Q2SMB2	Imidazole glycerol phosphate synthase subunit HisF	1.77e-10	8.00e-03	NA	NA
5. P	B7JFZ4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.54e-08	5.71e-05	NA	NA
5. P	P66988	Indole-3-glycerol phosphate synthase	5.57e-10	2.46e-07	NA	NA
5. P	A7IHN9	Imidazole glycerol phosphate synthase subunit HisF	3.90e-10	1.52e-03	NA	NA
5. P	A8EQW5	Imidazole glycerol phosphate synthase subunit HisF	1.79e-07	4.63e-05	NA	NA
5. P	B9DP52	N-(5'-phosphoribosyl)anthranilate isomerase	8.10e-07	2.96e-03	NA	NA
5. P	Q5PDP7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.70e-08	3.05e-06	NA	NA
5. P	A1AXS3	Tryptophan synthase alpha chain	3.31e-07	1.65e-05	NA	NA
5. P	Q8X7B5	Tryptophan synthase alpha chain	2.91e-09	2.69e-06	NA	NA
5. P	Q01ZU6	Imidazole glycerol phosphate synthase subunit HisF	3.01e-07	5.79e-03	NA	NA
5. P	Q2RT91	Pyridoxine 5'-phosphate synthase	1.95e-08	1.39e-08	NA	NA
5. P	Q9X4E8	Tryptophan synthase alpha chain	5.72e-05	5.66e-07	NA	NA
5. P	A9M9U0	Tryptophan synthase alpha chain	1.57e-08	1.81e-04	NA	NA
5. P	Q39YP2	Imidazole glycerol phosphate synthase subunit HisF	2.16e-10	3.18e-03	NA	NA
5. P	Q58647	Geranylgeranylglyceryl phosphate synthase	9.98e-07	7.80e-10	NA	NA
5. P	B9KMG7	Tryptophan synthase alpha chain	5.27e-05	1.02e-06	NA	NA
5. P	Q8ZY16	Imidazole glycerol phosphate synthase subunit HisF	1.87e-10	1.31e-03	NA	NA
5. P	A5IG82	Indole-3-glycerol phosphate synthase	1.83e-10	5.76e-08	NA	NA
5. P	Q9A230	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.17e-07	7.43e-07	NA	NA
5. P	Q8XIR2	Deoxyribose-phosphate aldolase	4.05e-10	1.22e-08	NA	NA
5. P	B3EKW7	Imidazole glycerol phosphate synthase subunit HisF	1.14e-07	7.10e-04	NA	NA
5. P	Q87C33	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.43e-07	3.84e-04	NA	NA
5. P	A1TRP8	Thiazole synthase	4.15e-05	1.53e-03	NA	NA
5. P	B8ZU92	Thiazole synthase	3.40e-09	3.02e-06	NA	NA
5. P	B2I9J3	Tryptophan synthase alpha chain	1.45e-06	8.58e-08	NA	NA
5. P	Q9RRJ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.67e-10	3.91e-04	NA	NA
5. P	A1T8W5	Phosphoribosyl isomerase A	7.44e-07	9.33e-08	NA	NA
5. P	A7FU82	Imidazole glycerol phosphate synthase subunit HisF	2.77e-10	1.19e-02	NA	NA
5. P	B9LAE4	Pyridoxine 5'-phosphate synthase	7.20e-08	2.08e-10	NA	NA
5. P	Q8DC73	Pyridoxine 5'-phosphate synthase	1.78e-08	1.07e-10	NA	NA
5. P	Q4FNT7	Imidazole glycerol phosphate synthase subunit HisF	1.53e-10	1.03e-02	NA	NA
5. P	A9M342	N-(5'-phosphoribosyl)anthranilate isomerase	1.59e-06	1.62e-02	NA	NA
5. P	Q01999	Indole-3-glycerol phosphate synthase	2.14e-08	8.86e-13	NA	NA
5. P	Q8CX42	Imidazole glycerol phosphate synthase subunit HisF	1.03e-07	4.57e-03	NA	NA
5. P	Q970Z2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.75e-09	1.51e-02	NA	NA
5. P	Q21NH6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.39e-09	4.82e-08	NA	NA
5. P	B3QQ93	Pyridoxine 5'-phosphate synthase	9.50e-09	6.15e-09	NA	NA
5. P	Q8KZ93	Tryptophan synthase alpha chain	2.10e-09	6.92e-05	NA	NA
5. P	Q4V0R7	Pyridoxine 5'-phosphate synthase	5.65e-07	1.09e-06	NA	NA
5. P	A1ACN6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.35e-08	3.59e-07	NA	NA
5. P	C4KHU3	Pyridoxal 5'-phosphate synthase subunit PdxS	2.73e-06	4.87e-02	NA	NA
5. P	Q5R146	Thiazole synthase	2.03e-09	1.11e-05	NA	NA
5. P	Q1I4H6	Thiamine-phosphate synthase	6.04e-07	6.32e-05	NA	NA
5. P	A6L9J8	Tryptophan synthase alpha chain	2.98e-06	1.17e-05	NA	NA
5. P	C3PKY7	Tryptophan synthase alpha chain	1.03e-09	1.85e-06	NA	NA
5. P	Q8EHK4	Deoxyribose-phosphate aldolase	3.19e-09	3.91e-03	NA	NA
5. P	O58974	Uncharacterized protein PH1209	1.60e-09	2.41e-04	NA	NA
5. P	P9WMM2	Imidazole glycerol phosphate synthase subunit HisF	3.32e-10	2.85e-02	NA	NA
5. P	Q3ZZ14	Indole-3-glycerol phosphate synthase	7.00e-11	5.82e-09	NA	NA
5. P	B4T9N8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.65e-08	3.89e-06	NA	NA
5. P	A6VTA6	Imidazole glycerol phosphate synthase subunit HisF	8.29e-10	9.77e-03	NA	NA
5. P	Q5WDI2	Imidazole glycerol phosphate synthase subunit HisF	1.93e-07	2.41e-04	NA	NA
5. P	Q8DKM1	Pyridoxine 5'-phosphate synthase	8.69e-09	3.29e-10	NA	NA
5. P	Q757J9	N-(5'-phosphoribosyl)anthranilate isomerase	9.06e-07	1.70e-02	NA	NA
5. P	B1IQ63	3-dehydroquinate dehydratase	2.40e-08	5.07e-04	NA	NA
5. P	A9A5X0	Imidazole glycerol phosphate synthase subunit HisF	1.94e-07	2.82e-02	NA	NA
5. P	O27694	Indole-3-glycerol phosphate synthase	3.51e-08	7.73e-07	NA	NA
5. P	A8LX37	Tryptophan synthase alpha chain	3.76e-06	4.25e-06	NA	NA
5. P	A8AEK0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.42e-08	8.85e-08	NA	NA
5. P	Q8P632	Thiazole synthase	2.31e-09	2.31e-09	NA	NA
5. P	C1D702	Tryptophan synthase alpha chain	1.35e-06	4.96e-06	NA	NA
5. P	B8CNW1	Thiazole synthase	2.98e-09	7.36e-06	NA	NA
5. P	Q492D2	Pyridoxine 5'-phosphate synthase	3.28e-08	3.01e-09	NA	NA
5. P	C1DCM3	Thiamine-phosphate synthase	2.89e-09	1.19e-06	NA	NA
5. P	A8G7G9	Thiazole synthase	6.68e-05	8.02e-06	NA	NA
5. P	Q8ZXK7	Deoxyribose-phosphate aldolase	1.29e-08	2.00e-04	NA	NA
5. P	Q7VSY7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.94e-07	8.21e-07	NA	NA
5. P	A8GC75	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.91e-08	5.21e-06	NA	NA
5. P	C4Z135	Tryptophan synthase alpha chain	8.64e-09	3.90e-08	NA	NA
5. P	Q8R885	Imidazole glycerol phosphate synthase subunit HisF	1.27e-07	4.41e-02	NA	NA
5. P	B1XNB2	N-(5'-phosphoribosyl)anthranilate isomerase	9.49e-08	1.11e-02	NA	NA
5. P	A6SUR1	Thiamine-phosphate synthase	1.07e-10	1.00e-03	NA	NA
5. P	B1XSV2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.96e-06	1.32e-06	NA	NA
5. P	B2K3W1	Tryptophan synthase alpha chain	2.75e-09	3.47e-06	NA	NA
5. P	A5CZ74	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.90e-07	3.96e-05	NA	NA
5. P	Q39UG0	Pyridoxine 5'-phosphate synthase	1.16e-08	3.61e-10	NA	NA
5. P	Q0ATJ7	N-(5'-phosphoribosyl)anthranilate isomerase	3.01e-07	2.44e-03	NA	NA
5. P	A8G3E4	Imidazole glycerol phosphate synthase subunit HisF	1.43e-07	7.20e-03	NA	NA
5. P	A7GKI9	Heptaprenylglyceryl phosphate synthase	7.94e-06	5.59e-08	NA	NA
5. P	B2J448	Pyridoxine 5'-phosphate synthase	1.21e-08	1.90e-10	NA	NA
5. P	Q02TB5	Indole-3-glycerol phosphate synthase	1.97e-10	2.81e-08	NA	NA
5. P	Q6HP96	Heptaprenylglyceryl phosphate synthase	8.17e-06	1.33e-10	NA	NA
5. P	Q8KD79	Thiamine-phosphate synthase	2.42e-09	4.94e-04	NA	NA
5. P	Q8RI63	Thiazole synthase	4.00e-09	8.81e-07	NA	NA
5. P	P61412	Thiamine-phosphate synthase	3.53e-09	5.06e-06	NA	NA
5. P	P63586	3-dehydroquinate dehydratase	8.98e-07	1.91e-02	NA	NA
5. P	P46212	Pyridoxine 5'-phosphate synthase (Fragment)	1.47e-08	1.19e-08	NA	NA
5. P	A6WC91	Indole-3-glycerol phosphate synthase	1.98e-08	6.82e-08	NA	NA
5. P	B0UHR6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.72e-06	7.11e-08	NA	NA
5. P	B7HII3	Pyridoxal 5'-phosphate synthase subunit PdxS	1.80e-06	3.81e-02	NA	NA
5. P	A3MBU6	Tryptophan synthase alpha chain	8.25e-09	4.58e-07	NA	NA
5. P	Q58328	Indole-3-glycerol phosphate synthase	6.92e-09	2.32e-07	NA	NA
5. P	Q9SE42	Ribulose-phosphate 3-epimerase, cytoplasmic isoform	1.77e-08	7.97e-07	NA	NA
5. P	A5WDP0	Thiamine-phosphate synthase	5.80e-09	1.92e-05	NA	NA
5. P	A9M9U3	N-(5'-phosphoribosyl)anthranilate isomerase	8.48e-07	2.89e-02	NA	NA
5. P	Q97KH8	Imidazole glycerol phosphate synthase subunit HisF	2.63e-10	1.00e-02	NA	NA
5. P	Q4UWD0	Tryptophan synthase alpha chain	2.14e-06	1.15e-07	NA	NA
5. P	Q2G002	3-dehydroquinate dehydratase	9.17e-07	1.41e-02	NA	NA
5. P	Q8PQ47	Indole-3-glycerol phosphate synthase	1.60e-10	2.93e-08	NA	NA
5. P	A6VAK3	Pyridoxine 5'-phosphate synthase	3.17e-08	4.99e-09	NA	NA
5. P	A6QGS5	Tryptophan synthase alpha chain	1.04e-08	6.21e-09	NA	NA
5. P	B4SCY8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.41e-09	6.19e-04	NA	NA
5. P	Q0HLF0	Deoxyribose-phosphate aldolase	3.38e-09	6.59e-03	NA	NA
5. P	Q2SUI0	Indole-3-glycerol phosphate synthase	8.22e-11	3.40e-08	NA	NA
5. P	B2FSD0	Thiazole synthase	2.12e-09	1.38e-09	NA	NA
5. P	B2U764	Thiazole synthase	7.38e-05	1.24e-05	NA	NA
5. P	A6VHZ5	Geranylgeranylglyceryl phosphate synthase	1.90e-06	1.77e-08	NA	NA
5. P	Q9K0D4	Tryptophan synthase alpha chain	5.20e-07	3.19e-08	NA	NA
5. P	B7L9Q2	Imidazole glycerol phosphate synthase subunit HisF	1.29e-07	4.48e-02	NA	NA
5. P	A0RB65	Tryptophan synthase alpha chain	1.59e-09	1.14e-08	NA	NA
5. P	Q8P7S0	Tryptophan synthase alpha chain	2.48e-06	1.15e-07	NA	NA
5. P	Q8Z169	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.99e-08	4.09e-10	NA	NA
5. P	A8FHR0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.06e-06	1.05e-02	NA	NA
5. P	Q3JMY2	Thiazole synthase	1.20e-08	1.39e-05	NA	NA
5. P	Q2FYR6	Indole-3-glycerol phosphate synthase	6.26e-11	7.00e-09	NA	NA
5. P	A9WD80	Imidazole glycerol phosphate synthase subunit HisF	2.09e-10	2.15e-02	NA	NA
5. P	B5BFB6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.52e-08	3.05e-06	NA	NA
5. P	Q2RT48	Indole-3-glycerol phosphate synthase	1.99e-10	4.25e-06	NA	NA
5. P	P64360	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.37e-09	1.22e-07	NA	NA
5. P	Q8NUI2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.31e-09	5.64e-08	NA	NA
5. P	A7Z259	Heptaprenylglyceryl phosphate synthase	1.23e-05	5.02e-10	NA	NA
5. P	Q8CRT8	Heptaprenylglyceryl phosphate synthase	1.49e-05	1.05e-06	NA	NA
5. P	B3PWI0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.75e-06	4.96e-03	NA	NA
5. P	Q8NXI0	3-dehydroquinate dehydratase	9.33e-07	1.90e-02	NA	NA
5. P	Q1GEZ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2	3.06e-07	2.87e-07	NA	NA
5. P	Q1AU93	N-(5'-phosphoribosyl)anthranilate isomerase	6.40e-08	2.02e-03	NA	NA
5. P	A0L8S5	Pyridoxine 5'-phosphate synthase	1.91e-08	1.38e-07	NA	NA
5. P	P00912	N-(5'-phosphoribosyl)anthranilate isomerase	2.73e-03	1.40e-04	NA	NA
5. P	P65761	Ribulose-phosphate 3-epimerase	2.39e-08	2.15e-02	NA	NA
5. P	Q8ZCP4	Pyridoxine 5'-phosphate synthase	2.05e-08	3.15e-10	NA	NA
5. P	A0PP18	Phosphoribosyl isomerase A	7.02e-07	1.29e-06	NA	NA
5. P	A9KGN4	Thiazole synthase	4.25e-06	6.26e-05	NA	NA
5. P	Q0VM71	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.75e-09	4.36e-07	NA	NA
5. P	Q4ZM55	Thiazole synthase	2.27e-09	2.13e-08	NA	NA
5. P	A9VRG1	Heptaprenylglyceryl phosphate synthase	9.56e-06	8.90e-09	NA	NA
5. P	B4S6H5	Tryptophan synthase alpha chain	1.90e-06	4.07e-08	NA	NA
5. P	Q0AEU2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.36e-07	5.17e-07	NA	NA
5. P	C0QU74	Pyridoxine 5'-phosphate synthase	2.88e-08	1.14e-07	NA	NA
5. P	P60580	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.85e-09	4.19e-09	NA	NA
5. P	Q7N966	Thiazole synthase	1.88e-05	7.31e-05	NA	NA
5. P	Q8DTR3	Imidazole glycerol phosphate synthase subunit HisF	2.46e-10	2.57e-03	NA	NA
5. P	Q4L3P8	3-hexulose-6-phosphate synthase	2.44e-09	8.85e-08	NA	NA
5. P	B5FDA3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.78e-08	7.73e-08	NA	NA
5. P	B1GZC0	Indole-3-glycerol phosphate synthase	2.01e-11	1.04e-07	NA	NA
5. P	Q9HX40	Thiamine-phosphate synthase	7.90e-07	5.03e-04	NA	NA
5. P	Q2J341	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.26e-07	1.63e-05	NA	NA
5. P	Q47AM2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-09	1.08e-06	NA	NA
5. P	A5FFX6	Imidazole glycerol phosphate synthase subunit HisF	1.26e-07	1.78e-02	NA	NA
5. P	Q8P5R7	Thiamine-phosphate synthase	3.77e-09	8.15e-05	NA	NA
5. P	A7INK2	Indole-3-glycerol phosphate synthase	4.20e-10	9.39e-09	NA	NA
5. P	A6GWS0	Thiazole synthase	2.61e-09	1.57e-06	NA	NA
5. P	B8CR53	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.24e-09	9.44e-07	NA	NA
5. P	A4SG77	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.05e-07	5.20e-04	NA	NA
5. P	Q2RNA7	Imidazole glycerol phosphate synthase subunit HisF	4.49e-10	2.09e-04	NA	NA
5. P	C1DQS7	Pyridoxine 5'-phosphate synthase	2.77e-08	1.27e-08	NA	NA
5. P	Q3AR47	Thiazole synthase	1.61e-09	5.30e-04	NA	NA
5. P	A9BX71	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.69e-09	5.11e-06	NA	NA
5. P	Q5HCM4	Imidazole glycerol phosphate synthase subunit HisF	2.38e-10	2.12e-03	NA	NA
5. P	Q3AHU2	Orotidine 5'-phosphate decarboxylase	1.56e-08	3.30e-02	NA	NA
5. P	Q186A6	3-dehydroquinate dehydratase	2.13e-08	2.80e-02	NA	NA
5. P	B1JUA4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.47e-09	1.30e-07	NA	NA
5. P	Q3SH10	Thiazole synthase	1.89e-09	2.32e-07	NA	NA
5. P	Q8GEI4	Thiazole synthase	3.66e-09	7.50e-06	NA	NA
5. P	Q7WF21	Thiazole synthase	2.76e-09	7.89e-07	NA	NA
5. P	B0CJK6	Tryptophan synthase alpha chain	1.50e-08	2.65e-04	NA	NA
5. P	A6U558	Imidazole glycerol phosphate synthase subunit HisF	4.42e-10	1.63e-03	NA	NA
5. P	Q8Y9G5	Imidazole glycerol phosphate synthase subunit HisF	9.08e-11	1.91e-02	NA	NA
5. P	A9BAZ9	Pyridoxine 5'-phosphate synthase	1.69e-08	4.83e-09	NA	NA
5. P	Q4K5I7	Thiamine-phosphate synthase	6.26e-07	2.29e-02	NA	NA
5. P	Q2P9L0	Pyridoxine 5'-phosphate synthase	5.43e-07	2.54e-07	NA	NA
5. P	Q2JPT2	N-(5'-phosphoribosyl)anthranilate isomerase	2.58e-07	1.51e-02	NA	NA
5. P	Q9PQW2	Triosephosphate isomerase	1.37e-03	4.45e-04	NA	NA
5. P	Q58923	Triosephosphate isomerase	3.68e-11	4.81e-11	NA	NA
5. P	B6I9X4	Tryptophan synthase alpha chain	3.25e-09	6.68e-06	NA	NA
5. P	B0CJI5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.19e-06	1.80e-04	NA	NA
5. P	P58264	Thiazole synthase	5.41e-09	3.57e-06	NA	NA
5. P	Q5KXV2	Tryptophan synthase alpha chain	1.12e-09	3.20e-02	NA	NA
5. P	Q57HD7	Putative epimerase LsrE	8.22e-08	1.17e-03	NA	NA
5. P	Q7VTF0	Tryptophan synthase alpha chain	3.35e-09	1.43e-05	NA	NA
5. P	Q18C71	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.56e-07	1.06e-03	NA	NA
5. P	Q96AT9	Ribulose-phosphate 3-epimerase	6.16e-08	3.08e-04	NA	NA
5. P	P62449	Imidazole glycerol phosphate synthase subunit HisF	2.08e-10	7.56e-03	NA	NA
5. P	A0B7W4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.21e-10	7.58e-07	NA	NA
5. P	Q6GJ99	3-hexulose-6-phosphate synthase	2.24e-09	2.41e-07	NA	NA
5. P	A8FNR3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.54e-06	1.35e-05	NA	NA
5. P	B7GWQ5	Tryptophan synthase alpha chain	4.17e-09	1.47e-05	NA	NA
5. P	A8A0N9	3-dehydroquinate dehydratase	2.38e-08	5.07e-04	NA	NA
5. P	B8IPH3	Imidazole glycerol phosphate synthase subunit HisF	1.19e-09	4.39e-03	NA	NA
5. P	B7VJR1	Copper homeostasis protein CutC	4.76e-08	3.42e-02	NA	NA
5. P	Q9JXF5	Thiazole synthase	9.56e-09	5.56e-05	NA	NA
5. P	A0LCF2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.87e-09	1.17e-04	NA	NA
5. P	B4T6X2	Tryptophan synthase alpha chain	3.80e-09	3.78e-07	NA	NA
5. P	A6VHY8	Imidazole glycerol phosphate synthase subunit HisF	1.48e-06	3.40e-02	NA	NA
5. P	Q46K45	Pyridoxine 5'-phosphate synthase	1.92e-08	8.93e-10	NA	NA
5. P	A7GWX9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.21e-09	1.36e-08	NA	NA
5. P	Q9L9J1	Thiazole synthase	1.51e-09	7.87e-06	NA	NA
5. P	Q5M351	Tryptophan synthase alpha chain	6.22e-08	3.05e-07	NA	NA
5. P	A5FJK8	Geranylgeranylglyceryl phosphate synthase	2.79e-09	1.09e-04	NA	NA
5. P	Q02SE4	Thiamine-phosphate synthase	4.41e-07	9.18e-04	NA	NA
5. P	Q3V891	Pyridoxine 5'-phosphate synthase	1.32e-08	5.25e-10	NA	NA
5. P	Q5ZX99	Indole-3-glycerol phosphate synthase	1.16e-10	4.07e-08	NA	NA
5. P	Q8FNZ9	Imidazole glycerol phosphate synthase subunit HisF	2.84e-10	3.66e-03	NA	NA
5. P	Q18FF3	Deoxyribose-phosphate aldolase	6.03e-07	1.73e-05	NA	NA
5. P	Q3BRL1	N-(5'-phosphoribosyl)anthranilate isomerase	2.74e-06	9.85e-03	NA	NA
5. P	Q9PBC9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.09e-07	1.59e-05	NA	NA
5. P	B1LQL6	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	3.27e-08	1.98e-11	NA	NA
5. P	Q98CT1	Imidazole glycerol phosphate synthase subunit HisF	2.39e-10	7.20e-03	NA	NA
5. P	Q9ZHE2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.70e-06	1.26e-06	NA	NA
5. P	Q7W9J7	Pyridoxine 5'-phosphate synthase	2.80e-08	3.78e-07	NA	NA
5. P	Q3AYG5	Tryptophan synthase alpha chain	2.89e-09	5.96e-06	NA	NA
5. P	A7HSH1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.07e-09	9.23e-08	NA	NA
5. P	A6LU97	Tryptophan synthase alpha chain	2.89e-07	3.29e-09	NA	NA
5. P	Q88A03	Indole-3-glycerol phosphate synthase	3.17e-10	4.07e-08	NA	NA
5. P	B7JJK4	Deoxyribose-phosphate aldolase	6.10e-10	9.62e-08	NA	NA
5. P	Q7N1X8	Pyridoxine 5'-phosphate synthase	2.12e-08	1.33e-10	NA	NA
5. P	Q57NT2	Tryptophan synthase alpha chain	3.54e-09	3.67e-07	NA	NA
5. P	Q72KG1	Pyridoxal 5'-phosphate synthase subunit PdxS	1.02e-08	1.13e-02	NA	NA
5. P	Q1GXY7	Thiazole synthase	1.97e-09	5.08e-08	NA	NA
5. P	P62453	Imidazole glycerol phosphate synthase subunit HisF	1.12e-07	9.51e-05	NA	NA
5. P	A1ABN0	3-dehydroquinate dehydratase	2.35e-08	5.82e-04	NA	NA
5. P	B6YR34	Tryptophan synthase alpha chain	2.37e-06	2.01e-07	NA	NA
5. P	Q3SH53	Pyridoxine 5'-phosphate synthase	2.28e-08	1.02e-08	NA	NA
5. P	A4XZC5	Indole-3-glycerol phosphate synthase	2.68e-10	4.92e-07	NA	NA
5. P	A1AAN0	Tryptophan synthase alpha chain	2.91e-09	3.57e-06	NA	NA
5. P	C3MBC1	Imidazole glycerol phosphate synthase subunit HisF	7.20e-10	5.56e-05	NA	NA
5. P	C0RE25	Pyridoxine 5'-phosphate synthase	7.49e-07	8.15e-08	NA	NA
5. P	B2HUU9	Thiazole synthase	2.66e-09	2.37e-08	NA	NA
5. P	Q88B60	Tryptophan synthase alpha chain	2.16e-06	2.70e-04	NA	NA
5. P	Q162Q2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.15e-07	1.48e-08	NA	NA
5. P	Q9ZJ29	Pyridoxine 5'-phosphate synthase	7.72e-07	1.09e-04	NA	NA
5. P	P66983	Tryptophan synthase alpha chain	1.86e-08	4.14e-09	NA	NA
5. P	C0QPQ6	Imidazole glycerol phosphate synthase subunit HisF	1.92e-10	8.00e-03	NA	NA
5. P	A6UP14	Tryptophan synthase alpha chain	9.33e-10	6.98e-05	NA	NA
5. P	A4VRW0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.06e-08	3.71e-04	NA	NA
5. P	B2U6Y7	Tryptophan synthase alpha chain	5.29e-09	4.99e-09	NA	NA
5. P	Q63Q91	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.56e-06	2.65e-07	NA	NA
5. P	Q72KN9	Thiazole synthase	2.27e-08	5.41e-05	NA	NA
5. P	P58641	Orotidine 5'-phosphate decarboxylase	4.92e-08	4.65e-02	NA	NA
5. P	B7NFT1	Thiazole synthase	1.34e-09	1.92e-05	NA	NA
5. P	C1ELE9	N-(5'-phosphoribosyl)anthranilate isomerase	1.61e-06	4.76e-02	NA	NA
5. P	P50846	KHG/KDPG aldolase	1.19e-12	1.53e-03	NA	NA
5. P	Q57CC2	Pyridoxine 5'-phosphate synthase	7.44e-07	8.15e-08	NA	NA
5. P	A6V0D3	Thiamine-phosphate synthase	8.07e-07	1.50e-04	NA	NA
5. P	Q978V5	Triosephosphate isomerase	1.29e-09	7.25e-11	NA	NA
5. P	B3DVI6	Orotidine 5'-phosphate decarboxylase	1.47e-06	4.08e-04	NA	NA
5. P	Q87DU4	Copper homeostasis protein CutC	4.08e-08	1.26e-03	NA	NA
5. P	Q21VV5	3-dehydroquinate dehydratase	1.93e-08	2.63e-03	NA	NA
5. P	A6LC86	Pyridoxine 5'-phosphate synthase	5.46e-08	4.43e-08	NA	NA
5. P	Q4QNC6	Thiamine-phosphate synthase	3.75e-07	1.55e-07	NA	NA
5. P	Q04H28	Orotidine 5'-phosphate decarboxylase	6.09e-08	7.56e-03	NA	NA
5. P	Q8G4S5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.04e-07	2.22e-04	NA	NA
5. P	A1VY70	Tryptophan synthase alpha chain	5.01e-05	3.33e-08	NA	NA
5. P	A6SUH5	Indole-3-glycerol phosphate synthase	2.47e-10	1.60e-07	NA	NA
5. P	B8D8Q6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.75e-06	3.85e-05	NA	NA
5. P	P19669	Transaldolase	1.63e-08	4.94e-02	NA	NA
5. P	B1Y7I2	Indole-3-glycerol phosphate synthase	3.61e-10	1.99e-07	NA	NA
5. P	Q30S57	Pyridoxine 5'-phosphate synthase	4.93e-08	4.91e-06	NA	NA
5. P	B2VH50	Deoxyribose-phosphate aldolase	4.31e-09	7.68e-03	NA	NA
5. P	A7GDQ7	Imidazole glycerol phosphate synthase subunit HisF	2.96e-10	2.59e-02	NA	NA
5. P	A6VPE0	Tryptophan synthase alpha chain	4.57e-09	4.34e-05	NA	NA
5. P	B2FPM3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.45e-10	2.68e-05	NA	NA
5. P	Q2A5V4	Tryptophan synthase alpha chain	3.14e-09	5.71e-05	NA	NA
5. P	A8IGE6	Thiamine-phosphate synthase	4.98e-09	1.19e-06	NA	NA
5. P	P0AG08	Ribulose-phosphate 3-epimerase	1.78e-08	7.38e-05	NA	NA
5. P	Q8YEZ2	Thiazole synthase	3.03e-06	3.38e-07	NA	NA
5. P	B3Q950	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-06	5.93e-05	NA	NA
5. P	Q3V7G6	Pyridoxine 5'-phosphate synthase	3.17e-08	6.14e-08	NA	NA
5. P	B7KPM8	Imidazole glycerol phosphate synthase subunit HisF	2.61e-10	8.08e-04	NA	NA
5. P	A4WN19	Indole-3-glycerol phosphate synthase	2.27e-07	3.37e-10	NA	NA
5. P	A9NB65	Thiazole synthase	4.54e-06	3.17e-05	NA	NA
5. P	Q3J5W4	Pyridoxine 5'-phosphate synthase	2.08e-08	1.13e-09	NA	NA
5. P	Q9HU43	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.38e-08	7.79e-05	NA	NA
5. P	Q0TQ02	Thiazole synthase	2.14e-09	1.34e-08	NA	NA
5. P	A3CLL9	Indole-3-glycerol phosphate synthase	1.95e-08	6.21e-09	NA	NA
5. P	C4ZSB3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.42e-08	5.84e-07	NA	NA
5. P	A5UA16	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.30e-09	9.26e-07	NA	NA
5. P	A4J708	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.25e-07	7.94e-06	NA	NA
5. P	Q7VAT3	Indole-3-glycerol phosphate synthase	5.12e-10	1.77e-04	NA	NA
5. P	A4TKK7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.08e-08	2.71e-05	NA	NA
5. P	Q4A048	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.55e-09	1.46e-06	NA	NA
5. P	Q46JD8	Orotidine 5'-phosphate decarboxylase	1.21e-07	3.17e-02	NA	NA
5. P	Q8TUZ9	(5-formylfuran-3-yl)methyl phosphate synthase	2.54e-09	3.82e-03	NA	NA
5. P	A4VRK5	Thiazole synthase	3.68e-09	1.18e-07	NA	NA
5. P	A3PPV2	N-(5'-phosphoribosyl)anthranilate isomerase	1.17e-07	6.03e-03	NA	NA
5. P	B4T3E7	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.99e-08	1.33e-10	NA	NA
5. P	Q8UCD2	Thiazole synthase	7.72e-09	2.72e-08	NA	NA
5. P	B1WW41	Deoxyribose-phosphate aldolase	3.19e-10	1.92e-05	NA	NA
5. P	C1AKF6	Deoxyribose-phosphate aldolase	1.36e-10	8.95e-03	NA	NA
5. P	Q97EF3	Indole-3-glycerol phosphate synthase	9.60e-09	9.29e-09	NA	NA
5. P	C1A0L8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.72e-07	2.72e-08	NA	NA
5. P	B1I7S6	Tryptophan synthase alpha chain	6.07e-08	1.24e-05	NA	NA
5. P	B4S9G0	Imidazole glycerol phosphate synthase subunit HisF	1.53e-07	2.00e-03	NA	NA
5. P	B0K8T7	Tryptophan synthase alpha chain	5.48e-07	8.08e-05	NA	NA
5. P	B9IU36	Indole-3-glycerol phosphate synthase	2.76e-11	5.74e-11	NA	NA
5. P	Q3SEU7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.88e-07	1.16e-05	NA	NA
5. P	Q6B924	Thiazole synthase	4.21e-06	3.17e-04	NA	NA
5. P	Q5LU99	Imidazole glycerol phosphate synthase subunit HisF	2.54e-10	7.22e-04	NA	NA
5. P	A8H562	Thiazole synthase	1.82e-09	1.07e-05	NA	NA
5. P	A1JTW2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.48e-08	7.81e-04	NA	NA
5. P	A8FYQ9	Deoxyribose-phosphate aldolase	4.14e-09	2.24e-02	NA	NA
5. P	Q5FNS2	Pyridoxine 5'-phosphate synthase	8.53e-09	1.11e-09	NA	NA
5. P	Q16C60	Thiazole synthase	5.71e-09	5.12e-05	NA	NA
5. P	P50937	Imidazole glycerol phosphate synthase subunit HisF	2.90e-10	8.65e-04	NA	NA
5. P	A6TZT3	3-dehydroquinate dehydratase	9.04e-07	1.91e-02	NA	NA
5. P	Q88DP1	Thiamine-phosphate synthase	5.88e-07	1.54e-04	NA	NA
5. P	A0AJL3	Heptaprenylglyceryl phosphate synthase	1.21e-05	6.75e-06	NA	NA
5. P	Q21CK4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.23e-06	2.63e-04	NA	NA
5. P	B2V7Q4	N-(5'-phosphoribosyl)anthranilate isomerase	1.95e-07	1.01e-02	NA	NA
5. P	A8GC74	Imidazole glycerol phosphate synthase subunit HisF	2.39e-10	3.81e-02	NA	NA
5. P	A0R904	Heptaprenylglyceryl phosphate synthase	8.09e-06	1.33e-10	NA	NA
5. P	A9IUY4	Pyridoxine 5'-phosphate synthase	2.69e-08	5.30e-08	NA	NA
5. P	A1WR24	Imidazole glycerol phosphate synthase subunit HisF	6.42e-10	2.78e-02	NA	NA
5. P	Q7MAP8	Pyridoxine 5'-phosphate synthase	5.85e-08	1.91e-06	NA	NA
5. P	B4SX45	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.70e-08	3.05e-06	NA	NA
5. P	Q2FJ70	3-hexulose-6-phosphate synthase	1.87e-09	8.95e-08	NA	NA
5. P	A0KCV5	Deoxyribose-phosphate aldolase	9.39e-10	1.63e-07	NA	NA
5. P	Q3IDK9	Pyridoxine 5'-phosphate synthase	2.62e-08	4.33e-09	NA	NA
5. P	A3PBF2	Imidazole glycerol phosphate synthase subunit HisF	1.25e-07	1.64e-02	NA	NA
5. P	A8ESJ1	Pyridoxine 5'-phosphate synthase	1.46e-07	2.32e-08	NA	NA
5. P	Q81UX4	Thiazole synthase	2.44e-05	4.91e-06	NA	NA
5. P	Q58499	(5-formylfuran-3-yl)methyl phosphate synthase	1.54e-09	1.08e-04	NA	NA
5. P	Q5UX95	Deoxyribose-phosphate aldolase	1.75e-07	3.31e-04	NA	NA
5. P	Q4JSV3	Deoxyribose-phosphate aldolase	1.25e-06	3.98e-03	NA	NA
5. P	B5RBR6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.68e-08	2.51e-06	NA	NA
5. P	A0B6K7	3-dehydroquinate dehydratase	1.32e-07	9.31e-03	NA	NA
5. P	A1WSF0	Tryptophan synthase alpha chain	1.37e-08	8.02e-06	NA	NA
5. P	Q7TV18	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.15e-07	4.22e-05	NA	NA
5. P	A0QHH6	Imidazole glycerol phosphate synthase subunit HisF	3.03e-10	4.34e-04	NA	NA
5. P	Q8XDI7	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.54e-08	1.98e-11	NA	NA
5. P	Q7VBK3	Pyridoxine 5'-phosphate synthase	1.43e-08	9.56e-10	NA	NA
5. P	A9NDN6	Tryptophan synthase alpha chain	4.62e-10	6.08e-03	NA	NA
5. P	A1K607	Pyridoxine 5'-phosphate synthase	2.37e-08	2.05e-07	NA	NA
5. P	Q4FN35	Thiamine-phosphate synthase	1.65e-09	4.26e-05	NA	NA
5. P	P16923	N-(5'-phosphoribosyl)anthranilate isomerase	5.34e-07	1.09e-04	NA	NA
5. P	O68814	Indole-3-glycerol phosphate synthase 1	6.21e-09	2.52e-08	NA	NA
5. P	A6TBC7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.94e-08	3.47e-06	NA	NA
5. P	Q892U4	Deoxyribose-phosphate aldolase	3.16e-09	1.12e-07	NA	NA
5. P	B1ILA8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.05e-08	1.11e-04	NA	NA
5. P	Q11CK7	Imidazole glycerol phosphate synthase subunit HisF	3.56e-10	1.87e-02	NA	NA
5. P	Q48C80	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.58e-09	3.64e-06	NA	NA
5. P	A3M8N2	Tryptophan synthase alpha chain	3.32e-09	1.47e-05	NA	NA
5. P	B7VMV3	Thiazole synthase	1.91e-09	5.17e-05	NA	NA
5. P	Q6FEE6	Tryptophan synthase alpha chain	4.08e-09	5.46e-06	NA	NA
5. P	B0U3A9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.29e-07	4.41e-04	NA	NA
5. P	B3QZD6	Indole-3-glycerol phosphate synthase	3.81e-11	2.55e-09	NA	NA
5. P	Q8YT31	Imidazole glycerol phosphate synthase subunit HisF	2.79e-07	1.63e-03	NA	NA
5. P	A8G5H7	Pyridoxine 5'-phosphate synthase	8.44e-09	1.66e-08	NA	NA
5. P	Q2JK82	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.74e-07	3.89e-06	NA	NA
5. P	B1L6Q8	Geranylgeranylglyceryl phosphate synthase	2.61e-10	2.58e-11	NA	NA
5. P	Q4FV61	Thiazole synthase	6.55e-09	6.08e-08	NA	NA
5. P	A8A790	Thiazole synthase	1.58e-09	1.15e-06	NA	NA
5. P	A4YZQ4	Thiazole synthase	5.91e-05	4.82e-06	NA	NA
5. P	Q8NUI3	Imidazole glycerol phosphate synthase subunit HisF	2.46e-10	2.12e-03	NA	NA
5. P	Q9YGB5	Indole-3-glycerol phosphate synthase	3.70e-08	6.50e-13	NA	NA
5. P	B1I556	Imidazole glycerol phosphate synthase subunit HisF	1.27e-07	1.64e-02	NA	NA
5. P	Q81ZG3	Heptaprenylglyceryl phosphate synthase	8.27e-06	8.95e-11	NA	NA
5. P	Q1H4R3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.95e-09	2.02e-06	NA	NA
5. P	B0UKV2	Tryptophan synthase alpha chain	6.04e-05	4.54e-05	NA	NA
5. P	A6QAX8	Pyridoxine 5'-phosphate synthase	7.93e-08	1.75e-04	NA	NA
5. P	Q5NLS8	Pyridoxine 5'-phosphate synthase	1.15e-08	6.21e-09	NA	NA
5. P	A4WUS7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.90e-07	9.23e-08	NA	NA
5. P	A5GHR6	Thiazole synthase	9.79e-05	7.81e-07	NA	NA
5. P	Q083K0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.83e-09	3.15e-07	NA	NA
5. P	Q8FY08	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.95e-06	1.14e-04	NA	NA
5. P	A7I773	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.52e-10	4.62e-09	NA	NA
5. P	A6T962	Deoxyribose-phosphate aldolase	4.72e-10	8.90e-07	NA	NA
5. P	Q8F495	N-(5'-phosphoribosyl)anthranilate isomerase	4.08e-06	3.84e-04	NA	NA
5. P	Q02YX0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.90e-07	2.33e-02	NA	NA
5. P	Q0BXD3	Thiamine-phosphate synthase	7.02e-07	9.50e-04	NA	NA
5. P	A2BIS8	Geranylgeranylglyceryl phosphate synthase	4.52e-09	1.87e-02	NA	NA
5. P	Q2G9L9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.42e-07	2.91e-09	NA	NA
5. P	Q81JC6	Pyridoxal 5'-phosphate synthase subunit PdxS	1.82e-06	3.81e-02	NA	NA
5. P	A6X0L0	Indole-3-glycerol phosphate synthase	5.68e-10	3.09e-08	NA	NA
5. P	Q62GE4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.98e-07	2.65e-07	NA	NA
5. P	Q3ABS4	Tryptophan synthase alpha chain	8.29e-07	8.46e-07	NA	NA
5. P	Q63JM0	Tryptophan synthase alpha chain	8.40e-09	1.49e-06	NA	NA
5. P	C1DJD3	Imidazole glycerol phosphate synthase subunit HisF	3.32e-10	3.98e-03	NA	NA
5. P	B2SZ59	Imidazole glycerol phosphate synthase subunit HisF	7.50e-10	1.28e-02	NA	NA
5. P	C3PH66	Thiazole synthase	4.90e-09	1.12e-04	NA	NA
5. P	A6UR91	Pyridoxal 5'-phosphate synthase subunit PdxS	2.10e-06	1.32e-02	NA	NA
5. P	Q9WYU4	Pyridoxal 5'-phosphate synthase subunit PdxS	1.57e-06	5.98e-03	NA	NA
5. P	B9DKG1	Thiazole synthase	3.46e-09	7.11e-08	NA	NA
5. P	Q5XDL5	Copper homeostasis protein CutC	4.77e-08	1.44e-04	NA	NA
5. P	Q92E88	Imidazole glycerol phosphate synthase subunit HisF	1.13e-10	1.15e-03	NA	NA
5. P	P9WP03	Deoxyribose-phosphate aldolase	4.81e-11	8.95e-03	NA	NA
5. P	Q7VF28	Thiazole synthase	7.36e-09	7.89e-10	NA	NA
5. P	B4RJU3	N-(5'-phosphoribosyl)anthranilate isomerase	1.21e-06	2.42e-02	NA	NA
5. P	Q7V0Y7	Pyridoxine 5'-phosphate synthase	1.76e-08	3.73e-10	NA	NA
5. P	A6URI9	Geranylgeranylglyceryl phosphate synthase	8.39e-07	1.39e-08	NA	NA
5. P	Q07UQ9	Imidazole glycerol phosphate synthase subunit HisF	1.68e-10	5.38e-03	NA	NA
5. P	Q7VQW5	Imidazole glycerol phosphate synthase subunit HisF	3.04e-10	2.38e-02	NA	NA
5. P	B1XV46	Tryptophan synthase alpha chain	3.18e-09	5.22e-07	NA	NA
5. P	Q87F88	Pyridoxine 5'-phosphate synthase	1.18e-06	1.50e-07	NA	NA
5. P	C3P3U1	Tryptophan synthase alpha chain	1.49e-09	2.06e-08	NA	NA
5. P	Q72EU7	Tryptophan synthase alpha chain	4.53e-08	2.72e-08	NA	NA
5. P	A5U2W9	Tryptophan synthase alpha chain	6.98e-06	1.43e-05	NA	NA
5. P	Q2RGW1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.72e-07	5.25e-03	NA	NA
5. P	Q83P27	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.49e-08	1.98e-11	NA	NA
5. P	A8FKS2	Indole-3-glycerol phosphate synthase	9.86e-12	4.91e-06	NA	NA
5. P	A4IKR6	Thiazole synthase	3.29e-09	9.26e-07	NA	NA
5. P	Q28V29	Pyridoxine 5'-phosphate synthase	8.25e-09	2.47e-10	NA	NA
5. P	B1K366	Tryptophan synthase alpha chain	5.34e-09	4.54e-05	NA	NA
5. P	A9A8U1	Imidazole glycerol phosphate synthase subunit HisF	3.02e-09	3.30e-02	NA	NA
5. P	Q8G5F6	Thiazole synthase	2.99e-09	8.95e-08	NA	NA
5. P	B4RBX5	Indole-3-glycerol phosphate synthase	4.19e-11	4.47e-09	NA	NA
5. P	C0QMA1	Tryptophan synthase alpha chain	1.20e-09	8.95e-08	NA	NA
5. P	Q8Y6Q7	Tryptophan synthase alpha chain	5.13e-09	2.59e-04	NA	NA
5. P	Q3KF16	N-(5'-phosphoribosyl)anthranilate isomerase	7.42e-07	6.19e-04	NA	NA
5. P	Q02584	Indole-3-glycerol phosphate synthase	3.25e-10	1.55e-07	NA	NA
5. P	P58315	Fructose-bisphosphate aldolase class 1	3.00e-09	6.81e-03	NA	NA
5. P	Q5X5X3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.36e-10	4.42e-05	NA	NA
5. P	Q73BQ8	N-(5'-phosphoribosyl)anthranilate isomerase	1.92e-06	2.49e-02	NA	NA
5. P	B5Z9L2	Pyridoxine 5'-phosphate synthase	7.63e-07	1.28e-04	NA	NA
5. P	A9VJW0	Indole-3-glycerol phosphate synthase	2.67e-08	1.12e-10	NA	NA
5. P	Q3A5V4	Pyridoxine 5'-phosphate synthase	1.67e-08	1.05e-10	NA	NA
5. P	A0LJA4	Thiazole synthase	1.26e-09	1.58e-06	NA	NA
5. P	Q12NT0	Imidazole glycerol phosphate synthase subunit HisF	1.35e-07	1.67e-04	NA	NA
5. P	A5U2V9	Phosphoribosyl isomerase A	6.38e-07	3.11e-07	NA	NA
5. P	B4EWH8	Tryptophan synthase alpha chain	2.15e-09	1.34e-05	NA	NA
5. P	A0RBM1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.78e-08	1.88e-05	NA	NA
5. P	A4WC73	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.39e-08	3.64e-05	NA	NA
5. P	B4E640	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.86e-09	1.30e-07	NA	NA
5. P	Q6HLE3	Imidazole glycerol phosphate synthase subunit HisF	2.11e-10	1.44e-03	NA	NA
5. P	Q8DEX2	Copper homeostasis protein CutC	1.28e-08	3.37e-02	NA	NA
5. P	Q2FUU2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.26e-09	5.64e-08	NA	NA
5. P	Q99W39	3-hexulose-6-phosphate synthase	1.91e-09	1.07e-07	NA	NA
5. P	Q7TUC8	Tryptophan synthase alpha chain	3.76e-09	2.86e-05	NA	NA
5. P	Q03X00	Indole-3-glycerol phosphate synthase	3.68e-11	1.89e-08	NA	NA
5. P	C1KVS4	Tryptophan synthase alpha chain	9.47e-09	3.37e-04	NA	NA
5. P	C1ELE8	Indole-3-glycerol phosphate synthase	2.49e-08	2.70e-11	NA	NA
5. P	Q8KEZ7	Tryptophan synthase alpha chain	2.15e-06	4.72e-07	NA	NA
5. P	Q8U088	Indole-3-glycerol phosphate synthase	5.49e-08	5.84e-12	NA	NA
5. P	A2S753	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.43e-07	2.65e-07	NA	NA
5. P	P67003	N-(5'-phosphoribosyl)anthranilate isomerase	8.76e-07	2.89e-02	NA	NA
5. P	B1VH27	Thiazole synthase	1.07e-08	2.06e-05	NA	NA
5. P	B0U6K7	Tryptophan synthase alpha chain	1.38e-06	8.58e-08	NA	NA
5. P	C5A7A2	Imidazole glycerol phosphate synthase subunit HisF	3.19e-10	2.48e-02	NA	NA
5. P	A6TKT5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.95e-07	1.31e-03	NA	NA
5. P	C0RJB1	Indole-3-glycerol phosphate synthase	5.39e-10	2.46e-07	NA	NA
5. P	P39362	Protein SgcE	1.15e-07	6.86e-04	NA	NA
5. P	B6IWI6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.16e-07	3.74e-08	NA	NA
5. P	A5UXG2	Tryptophan synthase alpha chain	3.13e-09	7.41e-08	NA	NA
5. P	C3L9P8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.82e-08	2.41e-04	NA	NA
5. P	B1JED1	Imidazole glycerol phosphate synthase subunit HisF	3.17e-10	6.74e-04	NA	NA
5. P	B2SVN9	N-(5'-phosphoribosyl)anthranilate isomerase	2.53e-06	2.70e-02	NA	NA
5. P	Q4FLS6	Pyridoxine 5'-phosphate synthase	3.98e-08	3.15e-09	NA	NA
5. P	A9KFA7	Pyridoxine 5'-phosphate synthase	2.07e-08	4.33e-09	NA	NA
5. P	B5ZV71	Tryptophan synthase alpha chain	9.33e-05	1.80e-02	NA	NA
5. P	P67004	N-(5'-phosphoribosyl)anthranilate isomerase	1.18e-06	2.89e-02	NA	NA
5. P	B9JXV7	Tryptophan synthase alpha chain	6.53e-05	1.88e-05	NA	NA
5. P	Q3KK58	Tryptophan synthase alpha chain	1.93e-06	7.79e-05	NA	NA
5. P	C3LPQ7	Thiazole synthase	2.97e-09	1.16e-05	NA	NA
5. P	A7Z963	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.99e-07	9.68e-05	NA	NA
5. P	Q5YYP5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.80e-07	6.59e-07	NA	NA
5. P	Q722Y7	Imidazole glycerol phosphate synthase subunit HisF	1.51e-10	1.14e-02	NA	NA
5. P	Q0TQV4	Thiamine-phosphate synthase	1.57e-09	4.98e-05	NA	NA
5. P	Q7NWC0	Pyridoxine 5'-phosphate synthase	2.05e-08	2.13e-08	NA	NA
5. P	A8ET36	Indole-3-glycerol phosphate synthase	5.92e-12	4.29e-08	NA	NA
5. P	A1VRR8	Tryptophan synthase alpha chain	1.64e-08	1.91e-06	NA	NA
5. P	Q4KJS5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.50e-08	3.71e-05	NA	NA
5. P	Q82AG5	Thiazole synthase	7.23e-09	4.83e-09	NA	NA
5. P	Q1QMJ9	Indole-3-glycerol phosphate synthase	2.05e-07	6.14e-07	NA	NA
5. P	Q2S371	Thiazole synthase	3.44e-06	1.21e-05	NA	NA
5. P	A7HA08	Thiazole synthase	2.85e-09	1.72e-08	NA	NA
5. P	A9A6C3	Orotidine 5'-phosphate decarboxylase	7.79e-09	9.77e-05	NA	NA
5. P	Q8PRF1	Pyridoxine 5'-phosphate synthase	6.08e-07	1.25e-07	NA	NA
5. P	A6LTL5	Thiazole synthase	3.03e-09	4.92e-08	NA	NA
5. P	Q15RU5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.24e-09	5.30e-08	NA	NA
5. P	B7HH02	Tryptophan synthase alpha chain	1.42e-09	2.73e-07	NA	NA
5. P	Q2INW2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.02e-09	6.81e-06	NA	NA
5. P	P57930	Thiamine-phosphate synthase	6.99e-07	1.97e-07	NA	NA
5. P	A4G0J0	Geranylgeranylglyceryl phosphate synthase	2.71e-06	1.36e-08	NA	NA
5. P	A9IRH0	Thiazole synthase	1.34e-06	1.91e-04	NA	NA
5. P	B0VPB7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.84e-09	4.89e-05	NA	NA
5. P	A1T8W7	Imidazole glycerol phosphate synthase subunit HisF	2.58e-10	2.87e-02	NA	NA
5. P	B2S984	Imidazole glycerol phosphate synthase subunit HisF	2.75e-10	1.17e-04	NA	NA
5. P	B5RAU8	3-dehydroquinate dehydratase	2.41e-08	2.07e-02	NA	NA
5. P	C3NET6	Pyridoxal 5'-phosphate synthase subunit PdxS	2.68e-06	4.87e-02	NA	NA
5. P	A8I836	Indole-3-glycerol phosphate synthase	1.36e-10	1.72e-07	NA	NA
5. P	A3CLM2	Tryptophan synthase alpha chain	3.74e-08	4.74e-10	NA	NA
5. P	Q81IP4	Heptaprenylglyceryl phosphate synthase	7.97e-06	1.14e-09	NA	NA
5. P	B2JQF0	Tryptophan synthase alpha chain	1.48e-08	2.25e-05	NA	NA
5. P	Q2YQW4	N-(5'-phosphoribosyl)anthranilate isomerase	8.49e-07	2.89e-02	NA	NA
5. P	A5E8A5	N-(5'-phosphoribosyl)anthranilate isomerase	1.33e-07	2.10e-02	NA	NA
5. P	A4YWD1	Pyridoxine 5'-phosphate synthase	2.11e-08	1.12e-09	NA	NA
5. P	Q3V7F6	Pyridoxine 5'-phosphate synthase	3.38e-08	1.66e-08	NA	NA
5. P	O29844	Geranylgeranylglyceryl phosphate synthase	1.11e-07	3.91e-04	NA	NA
5. P	Q8PJ29	Tryptophan synthase alpha chain	1.82e-06	1.61e-06	NA	NA
5. P	A6UEI2	Tryptophan synthase alpha chain	2.55e-08	6.18e-03	NA	NA
5. P	B1X6W1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.53e-08	5.84e-07	NA	NA
5. P	Q32GT0	Tryptophan synthase alpha chain	2.79e-09	4.33e-06	NA	NA
5. P	A8A7U2	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.55e-08	1.98e-11	NA	NA
5. P	P50936	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.79e-07	1.52e-07	NA	NA
5. P	Q48QG7	Tryptophan synthase alpha chain	7.42e-09	5.58e-04	NA	NA
5. P	Q5HT16	Triosephosphate isomerase	1.03e-06	3.17e-02	NA	NA
5. P	Q92B79	Indole-3-glycerol phosphate synthase	3.34e-11	2.64e-09	NA	NA
5. P	A8FKD8	Tryptophan synthase alpha chain	3.88e-06	5.03e-08	NA	NA
5. P	A9HY11	Indole-3-glycerol phosphate synthase	1.44e-10	3.02e-06	NA	NA
5. P	A1KJ21	Imidazole glycerol phosphate synthase subunit HisF	3.37e-10	1.31e-02	NA	NA
5. P	Q6AMR6	Tryptophan synthase alpha chain	1.57e-09	8.17e-06	NA	NA
5. P	A1KFN9	Thiazole synthase	2.02e-09	7.73e-08	NA	NA
5. P	A6QKG1	Imidazole glycerol phosphate synthase subunit HisF	2.68e-10	2.12e-03	NA	NA
5. P	Q3A136	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.37e-07	7.01e-06	NA	NA
5. P	Q7VRR1	Pyridoxine 5'-phosphate synthase	2.05e-08	2.26e-10	NA	NA
5. P	Q5V1N9	Geranylgeranylglyceryl phosphate synthase	1.89e-05	2.31e-05	NA	NA
5. P	A9R995	Tryptophan synthase alpha chain	1.51e-06	3.84e-04	NA	NA
5. P	A5UJF1	Geranylgeranylglyceryl phosphate synthase	1.39e-09	4.92e-08	NA	NA
5. P	Q65I34	N-(5'-phosphoribosyl)anthranilate isomerase	6.06e-08	1.78e-04	NA	NA
5. P	B3Q0L3	Indole-3-glycerol phosphate synthase	4.32e-10	2.00e-09	NA	NA
5. P	Q5HWB8	Tryptophan synthase alpha chain	3.86e-06	5.03e-08	NA	NA
5. P	B2S8J9	Thiazole synthase	3.07e-06	7.73e-08	NA	NA
5. P	A5IJU8	Pyridoxal 5'-phosphate synthase subunit PdxS	1.69e-06	1.78e-02	NA	NA
5. P	B0SJ25	Pyridoxine 5'-phosphate synthase	9.33e-07	9.67e-10	NA	NA
5. P	Q4KEZ9	N-(5'-phosphoribosyl)anthranilate isomerase	1.11e-06	1.19e-03	NA	NA
5. P	B2SZ60	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.55e-06	1.67e-04	NA	NA
5. P	B5FM45	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.70e-08	3.05e-06	NA	NA
5. P	Q8PWS2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.94e-10	1.67e-02	NA	NA
5. P	A8MJ87	3-dehydroquinate dehydratase	1.78e-08	2.48e-03	NA	NA
5. P	Q8E2U1	Deoxyribose-phosphate aldolase	4.59e-08	1.53e-07	NA	NA
5. P	A9N512	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.98e-08	1.33e-10	NA	NA
5. P	B1WRP7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.68e-07	8.15e-05	NA	NA
5. P	Q5HN28	Heptaprenylglyceryl phosphate synthase	1.46e-05	1.05e-06	NA	NA
5. P	Q2YP58	Thiazole synthase	3.10e-06	7.73e-08	NA	NA
5. P	A4XNC8	Tryptophan synthase alpha chain	2.79e-06	1.41e-04	NA	NA
5. P	P44435	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.79e-09	9.26e-07	NA	NA
5. P	Q39JZ7	Indole-3-glycerol phosphate synthase	1.54e-10	7.13e-10	NA	NA
5. P	A6UCC1	Deoxyribose-phosphate aldolase	3.73e-07	1.66e-06	NA	NA
5. P	Q8Z4K6	Pyridoxine 5'-phosphate synthase	2.54e-08	6.82e-10	NA	NA
5. P	B2UDK9	Indole-3-glycerol phosphate synthase	2.04e-10	2.41e-07	NA	NA
5. P	A4Y9A8	Deoxyribose-phosphate aldolase	3.36e-09	4.35e-03	NA	NA
5. P	A5UA71	Thiamine-phosphate synthase	4.31e-07	1.55e-07	NA	NA
5. P	Q6FCN1	Thiazole synthase	4.53e-09	2.27e-07	NA	NA
5. P	B2S9A3	Tryptophan synthase alpha chain	1.68e-08	2.19e-04	NA	NA
5. P	P10371	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.54e-08	5.84e-07	NA	NA
5. P	B8DFG3	Heptaprenylglyceryl phosphate synthase	1.19e-05	1.11e-07	NA	NA
5. P	Q65EG2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.32e-06	1.92e-05	NA	NA
5. P	Q87UG4	Imidazole glycerol phosphate synthase subunit HisF	3.86e-10	1.91e-04	NA	NA
5. P	B7MAQ3	3-dehydroquinate dehydratase	2.32e-08	5.82e-04	NA	NA
5. P	Q44604	Tryptophan synthase alpha chain	7.14e-07	3.66e-08	NA	NA
5. P	Q31QR1	Thiazole synthase	2.29e-08	4.27e-07	NA	NA
5. P	A4WPE1	Tryptophan synthase alpha chain	6.86e-05	4.01e-06	NA	NA
5. P	B7I0F0	Indole-3-glycerol phosphate synthase	3.39e-08	5.74e-11	NA	NA
5. P	A7GYQ7	Indole-3-glycerol phosphate synthase	9.34e-12	4.50e-06	NA	NA
5. P	Q393Y2	Tryptophan synthase alpha chain	8.73e-09	2.73e-05	NA	NA
5. P	Q6A7Y8	Imidazole glycerol phosphate synthase subunit HisF	1.09e-10	8.08e-04	NA	NA
5. P	Q1J4Z3	Deoxyribose-phosphate aldolase	5.84e-08	9.73e-07	NA	NA
5. P	B2UX20	Imidazole glycerol phosphate synthase subunit HisF	2.15e-10	1.24e-02	NA	NA
5. P	A7NKL7	Tryptophan synthase alpha chain	2.74e-09	1.33e-08	NA	NA
5. P	Q97EF6	Tryptophan synthase alpha chain	4.73e-07	2.81e-05	NA	NA
5. P	C1AT55	Indole-3-glycerol phosphate synthase	5.33e-09	3.09e-08	NA	NA
5. P	Q57AH4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.09e-06	1.80e-04	NA	NA
5. P	C3PHA6	Imidazole glycerol phosphate synthase subunit HisF	2.20e-10	9.86e-05	NA	NA
5. P	Q2YZ71	Imidazole glycerol phosphate synthase subunit HisF	2.68e-10	1.18e-03	NA	NA
5. P	Q39I70	Pyridoxine 5'-phosphate synthase	3.48e-08	6.49e-09	NA	NA
5. P	Q7VTE5	Thiazole synthase	2.64e-09	5.49e-07	NA	NA
5. P	C3KVX6	Imidazole glycerol phosphate synthase subunit HisF	2.81e-10	6.92e-03	NA	NA
5. P	B8CKI4	Deoxyribose-phosphate aldolase	4.06e-09	2.93e-03	NA	NA
5. P	Q47AC7	Indole-3-glycerol phosphate synthase	2.18e-10	1.49e-07	NA	NA
5. P	B8FBL5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.61e-07	8.49e-06	NA	NA
5. P	O68429	Tryptophan synthase alpha chain	7.40e-07	1.21e-06	NA	NA
5. P	Q5WX95	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.86e-10	3.26e-05	NA	NA
5. P	Q5PJ63	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.92e-08	1.33e-10	NA	NA
5. P	A6U311	Heptaprenylglyceryl phosphate synthase	1.60e-05	2.04e-06	NA	NA
5. P	C1ATY7	Imidazole glycerol phosphate synthase subunit HisF	2.38e-07	1.92e-03	NA	NA
5. P	A4Y084	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.78e-08	3.71e-06	NA	NA
5. P	B0BU54	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.01e-09	8.32e-08	NA	NA
5. P	P07601	Tryptophan synthase alpha chain	1.72e-09	1.44e-04	NA	NA
5. P	B2SJL8	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.49e-07	4.31e-02	NA	NA
5. P	Q3ZYM9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.70e-07	1.95e-08	NA	NA
5. P	Q97CC6	Deoxyribose-phosphate aldolase	2.01e-08	9.72e-08	NA	NA
5. P	A5IKT4	Tryptophan synthase alpha chain	2.07e-08	5.25e-04	NA	NA
5. P	Q2S1Z2	Tryptophan synthase alpha chain	5.47e-09	2.70e-03	NA	NA
5. P	Q5KVD0	Imidazole glycerol phosphate synthase subunit HisF	1.22e-07	1.84e-02	NA	NA
5. P	A9HE84	Tryptophan synthase alpha chain	3.96e-09	1.40e-05	NA	NA
5. P	A5EVG3	Indole-3-glycerol phosphate synthase	8.79e-08	2.07e-09	NA	NA
5. P	B8E358	Thiamine-phosphate synthase	1.41e-07	1.26e-06	NA	NA
5. P	A4SMQ0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.25e-08	2.54e-07	NA	NA
5. P	O28205	Thiamine-phosphate synthase	7.07e-10	1.73e-06	NA	NA
5. P	Q7TV26	Tryptophan synthase alpha chain	2.21e-09	4.98e-05	NA	NA
5. P	B2K116	Thiazole synthase	4.63e-09	2.40e-03	NA	NA
5. P	A5IR07	3-dehydroquinate dehydratase	9.02e-07	1.91e-02	NA	NA
5. P	B8ZT93	Deoxyribose-phosphate aldolase	1.98e-10	9.16e-06	NA	NA
5. P	Q7M877	Tryptophan synthase alpha chain	3.64e-07	5.07e-07	NA	NA
5. P	Q3V8C9	Pyridoxine 5'-phosphate synthase	9.60e-09	6.89e-10	NA	NA
5. P	Q9HSB9	Tryptophan synthase alpha chain	1.99e-09	8.45e-05	NA	NA
5. P	B4SQV5	N-(5'-phosphoribosyl)anthranilate isomerase	2.05e-06	2.86e-03	NA	NA
5. P	Q8NWU1	Tryptophan synthase alpha chain	9.97e-09	6.21e-09	NA	NA
5. P	Q3V8A2	Pyridoxine 5'-phosphate synthase	1.23e-08	8.61e-09	NA	NA
5. P	P0DMS0	Pyridoxal 5'-phosphate synthase subunit Pdx1	2.05e-06	2.84e-03	NA	NA
5. P	B5EQL6	Pyridoxine 5'-phosphate synthase	3.05e-08	1.84e-10	NA	NA
5. P	Q2RRL3	Thiazole synthase	1.37e-08	7.00e-07	NA	NA
5. P	Q5HU23	Thiamine-phosphate synthase	2.47e-09	1.14e-07	NA	NA
5. P	Q2J2G3	N-(5'-phosphoribosyl)anthranilate isomerase	5.21e-07	3.32e-02	NA	NA
5. P	B2U2J7	3-dehydroquinate dehydratase	2.30e-08	7.48e-04	NA	NA
5. P	Q46GE2	Orotidine 5'-phosphate decarboxylase	2.92e-09	1.81e-04	NA	NA
5. P	A3Q127	Phosphoribosyl isomerase A	7.64e-07	2.87e-08	NA	NA
5. P	A6LDI6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.86e-10	3.21e-03	NA	NA
5. P	Q9A746	Thiazole synthase	3.25e-09	5.14e-10	NA	NA
5. P	B3R1Z6	Pyridoxine 5'-phosphate synthase	5.93e-08	1.38e-07	NA	NA
5. P	Q4A5W6	Deoxyribose-phosphate aldolase	2.25e-10	5.36e-08	NA	NA
5. P	Q5LU97	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1	3.55e-07	4.77e-07	NA	NA
5. P	Q87YI1	N-(5'-phosphoribosyl)anthranilate isomerase	9.83e-07	1.44e-02	NA	NA
5. P	Q6GH35	Indole-3-glycerol phosphate synthase	7.32e-11	3.06e-08	NA	NA
5. P	Q8EH78	Pyridoxine 5'-phosphate synthase	2.54e-08	7.98e-09	NA	NA
5. P	Q03VY0	Imidazole glycerol phosphate synthase subunit HisF	5.34e-10	3.34e-04	NA	NA
5. P	C3L6K8	Deoxyribose-phosphate aldolase	5.85e-10	9.62e-08	NA	NA
5. P	B0TQ91	Deoxyribose-phosphate aldolase	4.34e-09	3.29e-03	NA	NA
5. P	B9K6Z6	Tryptophan synthase alpha chain	3.05e-08	4.80e-03	NA	NA
5. P	B7GFU9	Heptaprenylglyceryl phosphate synthase	5.44e-06	6.37e-10	NA	NA
5. P	A1B8L1	N-(5'-phosphoribosyl)anthranilate isomerase	9.37e-08	1.43e-02	NA	NA
5. P	Q5HKP2	Imidazole glycerol phosphate synthase subunit HisF	2.25e-10	2.08e-03	NA	NA
5. P	Q13TR0	Imidazole glycerol phosphate synthase subunit HisF	7.16e-10	1.88e-02	NA	NA
5. P	Q81TM0	Indole-3-glycerol phosphate synthase	2.59e-08	3.55e-11	NA	NA
5. P	P77960	Tryptophan synthase alpha chain	3.29e-10	2.27e-08	NA	NA
5. P	B4UIG2	Thiazole synthase	2.73e-09	1.59e-08	NA	NA
5. P	B7H4U6	Heptaprenylglyceryl phosphate synthase	7.96e-06	4.64e-10	NA	NA
5. P	Q2YAU9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.21e-06	2.04e-06	NA	NA
5. P	A0PP30	Tryptophan synthase alpha chain	7.17e-06	4.42e-06	NA	NA
5. P	Q92AP8	Heptaprenylglyceryl phosphate synthase	1.57e-05	1.46e-06	NA	NA
5. P	P62002	Triosephosphate isomerase	1.01e-10	1.14e-14	NA	NA
5. P	Q8Z080	Pyridoxine 5'-phosphate synthase	1.06e-08	1.58e-10	NA	NA
5. P	Q2S0U5	Pyridoxine 5'-phosphate synthase	3.84e-08	5.22e-07	NA	NA
5. P	B3EG28	Indole-3-glycerol phosphate synthase	1.46e-11	8.90e-07	NA	NA
5. P	B2S6L0	Pyridoxine 5'-phosphate synthase	6.98e-07	8.15e-08	NA	NA
5. P	Q8YE59	Tryptophan synthase alpha chain	1.28e-08	1.93e-04	NA	NA
5. P	B5EDR4	Imidazole glycerol phosphate synthase subunit HisF	2.24e-10	1.16e-02	NA	NA
5. P	C1L0J2	Imidazole glycerol phosphate synthase subunit HisF	1.52e-10	1.14e-02	NA	NA
5. P	A0RA08	Thiazole synthase	1.73e-05	4.25e-08	NA	NA
5. P	A7GLF8	Thiazole synthase	1.88e-05	9.26e-07	NA	NA
5. P	Q6GFF1	Heptaprenylglyceryl phosphate synthase	1.14e-05	1.32e-06	NA	NA
5. P	C3KVX4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.24e-08	1.95e-04	NA	NA
5. P	Q2FDI7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.32e-09	5.64e-08	NA	NA
5. P	A9B6M7	Tryptophan synthase alpha chain	4.29e-09	2.51e-06	NA	NA
5. P	Q2YZ70	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.43e-09	1.58e-07	NA	NA
5. P	A7I2Y2	Indole-3-glycerol phosphate synthase	8.23e-12	4.37e-06	NA	NA
5. P	B5E7M2	Tryptophan synthase alpha chain	6.27e-08	8.17e-06	NA	NA
5. P	B0SE83	Thiamine-phosphate synthase	1.35e-08	7.94e-06	NA	NA
5. P	C1ANN5	Tryptophan synthase alpha chain	5.88e-06	1.43e-05	NA	NA
5. P	B1XBK9	Tryptophan synthase alpha chain	2.85e-09	5.90e-06	NA	NA
5. P	Q93JX5	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.96e-07	4.65e-02	NA	NA
5. P	A1TYG6	Thiamine-phosphate synthase	9.32e-07	1.45e-03	NA	NA
5. P	A4WHP7	Deoxyribose-phosphate aldolase	1.15e-08	7.36e-06	NA	NA
5. P	Q3V7S0	Pyridoxine 5'-phosphate synthase	1.76e-08	5.88e-09	NA	NA
5. P	Q2SUA8	Imidazole glycerol phosphate synthase subunit HisF	8.86e-10	8.32e-03	NA	NA
5. P	C6DF71	Imidazole glycerol phosphate synthase subunit HisF	2.22e-07	1.23e-02	NA	NA
5. P	Q2G6R0	Indole-3-glycerol phosphate synthase	6.21e-10	8.06e-08	NA	NA
5. P	P0C882	Geranylgeranylglyceryl phosphate synthase	1.17e-07	3.08e-09	NA	NA
5. P	Q5LV87	Tryptophan synthase alpha chain	7.02e-05	2.70e-07	NA	NA
5. P	A2BSL8	Indole-3-glycerol phosphate synthase	1.00e-09	1.04e-05	NA	NA
5. P	A1UHK4	Phosphoribosyl isomerase A	7.39e-07	2.87e-08	NA	NA
5. P	Q9S2V2	Thiamine-phosphate synthase	4.02e-09	2.61e-05	NA	NA
5. P	C5D2V7	3-dehydroquinate dehydratase	1.99e-08	4.65e-04	NA	NA
5. P	Q3M7Q7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.53e-07	7.11e-05	NA	NA
5. P	A2C462	Indole-3-glycerol phosphate synthase	5.62e-10	2.86e-03	NA	NA
5. P	Q0IB11	Pyridoxine 5'-phosphate synthase	1.70e-08	1.43e-09	NA	NA
5. P	Q48KP5	Orotidine 5'-phosphate decarboxylase	3.03e-08	4.90e-02	NA	NA
5. P	P0A877	Tryptophan synthase alpha chain	2.93e-09	5.90e-06	NA	NA
5. P	Q7V958	Putative imidazole glycerol phosphate synthase subunit hisF2	1.73e-10	1.08e-05	NA	NA
5. P	Q2G348	Thiazole synthase	2.39e-09	6.08e-09	NA	NA
5. P	A4X9P7	Imidazole glycerol phosphate synthase subunit HisF	2.47e-10	2.14e-05	NA	NA
5. P	B8GBF3	Imidazole glycerol phosphate synthase subunit HisF	3.49e-10	4.88e-03	NA	NA
5. P	P70937	Indole-3-glycerol phosphate synthase	2.84e-10	3.63e-11	NA	NA
5. P	Q8PHF5	Thiazole synthase	2.21e-09	1.98e-09	NA	NA
5. P	Q5R109	Pyridoxine 5'-phosphate synthase	2.16e-08	4.73e-09	NA	NA
5. P	A1TKZ3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.05e-06	3.31e-07	NA	NA
5. P	B1H0E7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.98e-07	4.34e-05	NA	NA
5. P	B7M0P9	3-dehydroquinate dehydratase	2.65e-08	4.65e-04	NA	NA
5. P	Q31HH3	Tryptophan synthase alpha chain	7.64e-07	8.98e-07	NA	NA
5. P	Q1CRX0	Tryptophan synthase alpha chain	1.37e-06	9.49e-09	NA	NA
5. P	Q7UPT7	Deoxyribose-phosphate aldolase	4.71e-10	1.06e-05	NA	NA
5. P	B5EQF1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.48e-07	2.06e-08	NA	NA
5. P	A4TJ68	Tryptophan synthase alpha chain	2.68e-09	2.37e-06	NA	NA
5. P	Q7NMQ9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.79e-07	6.59e-03	NA	NA
5. P	P63587	3-dehydroquinate dehydratase	8.91e-07	1.91e-02	NA	NA
5. P	A4F727	Thiamine-phosphate synthase	4.68e-09	6.02e-07	NA	NA
5. P	B3QJH1	Pyridoxine 5'-phosphate synthase	1.68e-08	1.60e-09	NA	NA
5. P	C3L541	Heptaprenylglyceryl phosphate synthase	9.75e-06	8.95e-11	NA	NA
5. P	Q57893	N-(5'-phosphoribosyl)anthranilate isomerase	3.00e-08	9.73e-07	NA	NA
5. P	Q24SU9	Deoxyribose-phosphate aldolase	3.19e-09	5.06e-06	NA	NA
5. P	Q8TJ20	Geranylgeranylglyceryl phosphate synthase	7.85e-08	2.20e-05	NA	NA
5. P	Q8FF18	Pyridoxine 5'-phosphate synthase	1.30e-08	3.63e-11	NA	NA
5. P	Q8CQ69	3-hexulose-6-phosphate synthase	6.36e-07	2.13e-08	NA	NA
5. P	B9KCG6	Pyridoxine 5'-phosphate synthase	5.18e-08	6.88e-06	NA	NA
5. P	A0PVY3	Deoxyribose-phosphate aldolase	1.22e-10	1.74e-05	NA	NA
5. P	Q5P6J5	Thiamine-phosphate synthase	6.88e-07	4.92e-03	NA	NA
5. P	Q3YSI5	Pyridoxine 5'-phosphate synthase	5.45e-09	4.28e-10	NA	NA
5. P	Q7URN0	Tryptophan synthase alpha chain	5.17e-09	5.07e-07	NA	NA
5. P	Q5WKM9	3-dehydroquinate dehydratase	3.45e-08	1.05e-02	NA	NA
5. P	B1L872	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.94e-05	6.61e-08	NA	NA
5. P	Q30PY1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.26e-09	6.67e-05	NA	NA
5. P	A3M785	Indole-3-glycerol phosphate synthase	1.03e-09	2.13e-07	NA	NA
5. P	Q8KEH1	N-(5'-phosphoribosyl)anthranilate isomerase	1.23e-06	4.72e-02	NA	NA
5. P	Q2KUS6	Thiamine-phosphate synthase	1.05e-09	1.93e-05	NA	NA
5. P	C7PEQ0	Geranylgeranylglyceryl phosphate synthase	3.71e-07	1.10e-07	NA	NA
5. P	Q4FPV8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.72e-06	3.86e-07	NA	NA
5. P	Q7US84	Thiazole synthase	2.58e-04	9.33e-08	NA	NA
5. P	B7K0H0	Indole-3-glycerol phosphate synthase	4.81e-10	9.25e-06	NA	NA
5. P	B4TFD0	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.93e-08	1.33e-10	NA	NA
5. P	Q8PH45	Thiamine-phosphate synthase	2.03e-09	1.46e-05	NA	NA
5. P	Q48CL9	Thiazole synthase	3.37e-09	2.13e-08	NA	NA
5. P	Q1QY41	Tryptophan synthase alpha chain	6.25e-07	3.60e-06	NA	NA
5. P	C6DGZ4	Tryptophan synthase alpha chain	2.50e-09	9.86e-05	NA	NA
5. P	Q5JDY1	Geranylgeranylglyceryl phosphate synthase	2.08e-10	1.94e-07	NA	NA
5. P	B1L920	Pyridoxal 5'-phosphate synthase subunit PdxS	1.57e-06	5.98e-03	NA	NA
5. P	B9DP27	Tryptophan synthase alpha chain	3.91e-08	4.68e-06	NA	NA
5. P	B0TS89	Thiazole synthase	3.02e-09	1.45e-06	NA	NA
5. P	Q8KEJ1	Thiazole synthase	1.25e-09	1.48e-02	NA	NA
5. P	A3CNT1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.67e-10	1.04e-05	NA	NA
5. P	A1A1I5	Imidazole glycerol phosphate synthase subunit HisF	2.18e-10	5.38e-03	NA	NA
5. P	A4IVS5	Tryptophan synthase alpha chain	2.78e-09	9.51e-05	NA	NA
5. P	Q6GB27	3-dehydroquinate dehydratase	9.60e-07	1.90e-02	NA	NA
5. P	B1KRP8	Deoxyribose-phosphate aldolase	3.93e-09	3.59e-02	NA	NA
5. P	Q6L2N4	Geranylgeranylglyceryl phosphate synthase	1.07e-07	1.85e-09	NA	NA
5. P	A2C5C9	Thiazole synthase	1.24e-08	1.73e-05	NA	NA
5. P	P18284	Tryptophan synthase alpha chain	4.43e-09	1.97e-03	NA	NA
5. P	B2IF46	Tryptophan synthase alpha chain	5.84e-05	3.85e-05	NA	NA
5. P	Q0RRG0	Deoxyribose-phosphate aldolase	3.53e-10	4.03e-05	NA	NA
5. P	Q5HSJ0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.56e-06	1.90e-04	NA	NA
5. P	Q9HKB7	Deoxyribose-phosphate aldolase	7.24e-09	7.89e-07	NA	NA
5. P	Q2NTX6	Imidazole glycerol phosphate synthase subunit HisF	1.51e-07	4.35e-03	NA	NA
5. P	Q63Q92	Imidazole glycerol phosphate synthase subunit HisF	1.32e-09	7.14e-03	NA	NA
5. P	Q66EW0	Deoxyribose-phosphate aldolase 2	4.14e-09	1.36e-02	NA	NA
5. P	Q5N575	Indole-3-glycerol phosphate synthase	5.64e-10	1.29e-04	NA	NA
5. P	A9BBR3	Indole-3-glycerol phosphate synthase	4.33e-10	6.37e-05	NA	NA
5. P	Q7MHP1	Pyridoxine 5'-phosphate synthase	1.80e-08	1.07e-10	NA	NA
5. P	Q8TUT9	Triosephosphate isomerase	1.31e-10	1.25e-11	NA	NA
5. P	A5GLI2	Pyridoxine 5'-phosphate synthase	1.50e-08	1.01e-08	NA	NA
5. P	Q4KHS8	Pyridoxine 5'-phosphate synthase	2.94e-08	1.46e-08	NA	NA
5. P	Q8KPR4	Indole-3-glycerol phosphate synthase	5.87e-10	1.29e-04	NA	NA
5. P	Q9CFM7	Deoxyribose-phosphate aldolase	1.04e-09	1.41e-07	NA	NA
5. P	A0AZ71	Tryptophan synthase alpha chain	9.49e-09	4.54e-05	NA	NA
5. P	Q2T7G9	Tryptophan synthase alpha chain	9.79e-09	4.17e-06	NA	NA
5. P	Q88WH9	Tryptophan synthase alpha chain	2.76e-09	1.70e-05	NA	NA
5. P	O58462	Orotidine 5'-phosphate decarboxylase	8.37e-09	1.69e-02	NA	NA
5. P	Q8ZYX2	Indole-3-glycerol phosphate synthase	3.39e-07	3.97e-09	NA	NA
5. P	Q1D7A6	Thiazole synthase	3.89e-09	1.58e-07	NA	NA
5. P	B7K7E4	Pyridoxine 5'-phosphate synthase	1.99e-08	1.62e-10	NA	NA
5. P	B8HP79	Indole-3-glycerol phosphate synthase	1.34e-09	1.65e-03	NA	NA
5. P	Q5YP36	Deoxyribose-phosphate aldolase	5.59e-10	4.36e-07	NA	NA
5. P	A8AW06	Tryptophan synthase alpha chain	4.74e-08	2.27e-08	NA	NA
5. P	A5G535	Pyridoxine 5'-phosphate synthase	9.54e-09	9.67e-10	NA	NA
5. P	Q39KA4	Thiazole synthase	9.96e-09	1.12e-06	NA	NA
5. P	Q2YCZ2	Thiazole synthase	2.27e-09	2.97e-06	NA	NA
5. P	Q9YGB1	N-(5'-phosphoribosyl)anthranilate isomerase	1.15e-07	1.18e-03	NA	NA
5. P	Q3ZZB8	Pyridoxal 5'-phosphate synthase subunit PdxS	5.79e-09	1.90e-02	NA	NA
5. P	A4YJ26	Geranylgeranylglyceryl phosphate synthase	1.73e-07	1.12e-05	NA	NA
5. P	A5UGY5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.76e-09	9.26e-07	NA	NA
5. P	Q8NVT0	Heptaprenylglyceryl phosphate synthase	1.57e-05	1.70e-06	NA	NA
5. P	Q3B0V2	Thiazole synthase	1.26e-08	3.50e-06	NA	NA
5. P	B8ZU95	Thiamine-phosphate synthase	6.42e-09	6.88e-06	NA	NA
5. P	Q8ZIQ4	Deoxyribose-phosphate aldolase 2	4.97e-09	1.36e-02	NA	NA
5. P	A1S6Q5	Thiazole synthase	3.37e-09	3.61e-04	NA	NA
5. P	C1CT53	Indole-3-glycerol phosphate synthase	1.76e-08	4.28e-10	NA	NA
5. P	Q57MR9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.52e-08	2.64e-06	NA	NA
5. P	B5QZL6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.69e-08	2.51e-06	NA	NA
5. P	Q2K879	Indole-3-glycerol phosphate synthase	4.67e-10	4.10e-09	NA	NA
5. P	Q3V7J3	Pyridoxine 5'-phosphate synthase	4.08e-08	2.61e-08	NA	NA
5. P	C5BMF5	Imidazole glycerol phosphate synthase subunit HisF	2.20e-10	1.09e-02	NA	NA
5. P	Q18C74	Imidazole glycerol phosphate synthase subunit HisF	5.01e-10	2.24e-04	NA	NA
5. P	Q0BQJ0	Tryptophan synthase alpha chain	1.38e-08	7.54e-04	NA	NA
5. P	A4XYV5	Thiamine-phosphate synthase	4.76e-07	2.93e-03	NA	NA
5. P	Q1IX39	Imidazole glycerol phosphate synthase subunit HisF	4.74e-10	5.88e-03	NA	NA
5. P	Q8R884	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.07e-07	1.33e-08	NA	NA
5. P	C6DF72	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.53e-08	9.52e-06	NA	NA
5. P	Q2G8S8	Tryptophan synthase alpha chain	3.72e-09	3.31e-04	NA	NA
5. P	A1KCM9	Thiazole synthase	1.84e-09	1.05e-07	NA	NA
5. P	A5INE5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.76e-07	1.60e-06	NA	NA
5. P	Q3JCB9	N-(5'-phosphoribosyl)anthranilate isomerase	2.15e-06	1.88e-02	NA	NA
5. P	Q03K81	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.88e-10	1.04e-04	NA	NA
5. P	Q98CT3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.97e-09	1.26e-06	NA	NA
5. P	Q6AMS4	Indole-3-glycerol phosphate synthase	2.91e-11	3.03e-08	NA	NA
5. P	Q28NK3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.28e-07	4.62e-08	NA	NA
5. P	Q5PK87	Thiazole synthase	1.87e-09	9.89e-06	NA	NA
5. P	B4EWA4	Deoxyribose-phosphate aldolase	5.28e-09	2.25e-02	NA	NA
5. P	B7GL45	Imidazole glycerol phosphate synthase subunit HisF	1.36e-10	4.24e-02	NA	NA
5. P	B8IPG1	Thiazole synthase	1.44e-09	2.50e-10	NA	NA
5. P	B0T799	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.22e-07	6.27e-08	NA	NA
5. P	C5BDB6	Tryptophan synthase alpha chain	3.75e-09	2.86e-05	NA	NA
5. P	A2CAH8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.43e-07	1.20e-05	NA	NA
5. P	Q7U7S1	Pyridoxine 5'-phosphate synthase	1.65e-08	5.95e-09	NA	NA
5. P	Q46WL7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.94e-06	2.09e-07	NA	NA
5. P	B1AIG9	Triosephosphate isomerase	1.32e-03	4.45e-04	NA	NA
5. P	Q48907	3-hexulose-6-phosphate synthase	1.95e-10	2.57e-07	NA	NA
5. P	A7ZGB2	Imidazole glycerol phosphate synthase subunit HisF	1.74e-07	2.54e-05	NA	NA
5. P	Q7VDF1	Imidazole glycerol phosphate synthase subunit HisF	2.89e-10	1.50e-03	NA	NA
5. P	O67502	Tryptophan synthase alpha chain	3.42e-09	2.64e-09	NA	NA
5. P	Q46DY6	Triosephosphate isomerase	6.74e-11	6.20e-12	NA	NA
5. P	C5CBK6	Indole-3-glycerol phosphate synthase	2.12e-08	1.18e-08	NA	NA
5. P	Q1LT71	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.64e-08	4.43e-09	NA	NA
5. P	Q5LR59	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2	9.46e-07	2.04e-08	NA	NA
5. P	P0A878	Tryptophan synthase alpha chain	3.22e-09	5.90e-06	NA	NA
5. P	Q92TC8	Tryptophan synthase alpha chain	2.97e-08	7.87e-03	NA	NA
5. P	B5YA97	Thiamine-phosphate synthase	1.41e-10	2.91e-05	NA	NA
5. P	A6GY76	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.34e-10	9.07e-07	NA	NA
5. P	B0RR82	N-(5'-phosphoribosyl)anthranilate isomerase	2.68e-06	2.57e-02	NA	NA
5. P	Q7WDY0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.95e-07	8.21e-07	NA	NA
5. P	Q5HLB4	Thiazole synthase	3.06e-09	3.05e-07	NA	NA
5. P	A8FUV3	Thiazole synthase	2.10e-09	8.41e-06	NA	NA
5. P	A5GRL0	Indole-3-glycerol phosphate synthase	5.29e-10	2.20e-05	NA	NA
5. P	Q97BE8	Thiamine-phosphate synthase	2.60e-09	9.16e-03	NA	NA
5. P	B4RCL1	Tryptophan synthase alpha chain	7.53e-05	2.16e-03	NA	NA
5. P	A7N7S3	Thiamine-phosphate synthase	1.81e-07	2.68e-05	NA	NA
5. P	A2SSN5	Triosephosphate isomerase	2.58e-11	4.02e-07	NA	NA
5. P	A5CXY8	Imidazole glycerol phosphate synthase subunit HisF	5.32e-10	2.22e-04	NA	NA
5. P	Q5WY75	Indole-3-glycerol phosphate synthase	1.94e-10	4.07e-08	NA	NA
5. P	A5N7N9	N-(5'-phosphoribosyl)anthranilate isomerase	1.42e-06	1.88e-02	NA	NA
5. P	A7ZNJ6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.42e-08	4.92e-07	NA	NA
5. P	Q5HEL6	Heptaprenylglyceryl phosphate synthase	1.58e-05	1.70e-06	NA	NA
5. P	Q1LKI4	Tryptophan synthase alpha chain	6.45e-09	5.46e-05	NA	NA
5. P	Q67KI0	Imidazole glycerol phosphate synthase subunit HisF	1.86e-10	2.16e-03	NA	NA
5. P	A1RJ17	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.61e-09	1.05e-08	NA	NA
5. P	B1XX77	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.70e-07	3.67e-07	NA	NA
5. P	Q47R98	3-methyl-2-oxobutanoate hydroxymethyltransferase	2.83e-05	3.22e-02	NA	NA
5. P	B3QRR1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.96e-07	3.85e-03	NA	NA
5. P	Q3BYB5	Indole-3-glycerol phosphate synthase	1.79e-10	1.23e-08	NA	NA
5. P	B3Q6M9	Indole-3-glycerol phosphate synthase	6.54e-08	1.37e-08	NA	NA
5. P	A7NQB8	Pyridoxal 5'-phosphate synthase subunit PdxS	2.07e-06	2.86e-03	NA	NA
5. P	A5IB92	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.35e-10	5.61e-05	NA	NA
5. P	P60714	Imidazole glycerol phosphate synthase subunit HisF	2.76e-10	3.06e-04	NA	NA
5. P	P51013	Ribulose-phosphate 3-epimerase	1.33e-05	7.81e-04	NA	NA
5. P	Q6LYI9	Tryptophan synthase alpha chain	9.95e-10	1.59e-05	NA	NA
5. P	O68816	Tryptophan synthase alpha chain	5.49e-06	7.09e-11	NA	NA
5. P	A5N8P8	Thiazole synthase	3.35e-09	5.06e-06	NA	NA
5. P	Q9RYY1	Thiazole synthase	3.53e-09	7.94e-04	NA	NA
5. P	C0ZUQ6	Deoxyribose-phosphate aldolase	4.00e-10	4.97e-07	NA	NA
5. P	Q3JDH3	Thiamine-phosphate synthase	2.90e-10	1.82e-03	NA	NA
5. P	O29513	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	1.05e-05	3.22e-02	NA	NA
5. P	B9IUZ9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.58e-08	6.92e-04	NA	NA
5. P	Q92AH6	Orotidine 5'-phosphate decarboxylase	5.91e-08	1.28e-02	NA	NA
5. P	Q9YEF5	Geranylgeranylglyceryl phosphate synthase	1.28e-06	7.64e-06	NA	NA
5. P	B4RU63	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.44e-09	3.04e-10	NA	NA
5. P	Q3JN01	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.85e-07	2.65e-07	NA	NA
5. P	Q3M9L4	Pyridoxine 5'-phosphate synthase	1.03e-08	7.60e-11	NA	NA
5. P	B3ELU3	Pyridoxine 5'-phosphate synthase	2.35e-08	4.40e-07	NA	NA
5. P	Q7MGM7	Thiazole synthase	2.43e-09	4.59e-06	NA	NA
5. P	A4WB03	Tryptophan synthase alpha chain	2.54e-09	8.76e-05	NA	NA
5. P	A9AMA5	Tryptophan synthase alpha chain	8.23e-09	1.24e-05	NA	NA
5. P	B8EJS1	Indole-3-glycerol phosphate synthase	7.73e-10	1.16e-07	NA	NA
5. P	C3PBN9	Heptaprenylglyceryl phosphate synthase	7.96e-06	8.95e-11	NA	NA
5. P	A1WR23	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.37e-09	8.74e-06	NA	NA
5. P	Q5GXR3	N-(5'-phosphoribosyl)anthranilate isomerase	4.26e-06	2.70e-02	NA	NA
5. P	A5UYU9	N-(5'-phosphoribosyl)anthranilate isomerase	1.48e-06	3.43e-04	NA	NA
5. P	Q30U33	Thiazole synthase	3.55e-09	1.75e-07	NA	NA
5. P	B1MBV2	Tryptophan synthase alpha chain	5.80e-06	2.13e-06	NA	NA
5. P	A9VLH6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.27e-08	9.16e-06	NA	NA
5. P	Q9PM74	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.68e-06	7.44e-05	NA	NA
5. P	A2BRT6	Pyridoxine 5'-phosphate synthase	6.32e-09	3.86e-08	NA	NA
5. P	B0U2A9	Pyridoxine 5'-phosphate synthase	1.07e-06	9.73e-07	NA	NA
5. P	Q53726	Heptaprenylglyceryl phosphate synthase	1.59e-05	1.70e-06	NA	NA
5. P	Q5FRN3	Tryptophan synthase alpha chain	1.02e-08	2.22e-04	NA	NA
5. P	Q47WP8	Pyridoxine 5'-phosphate synthase	2.52e-08	2.76e-09	NA	NA
5. P	Q3SGS2	Indole-3-glycerol phosphate synthase	2.19e-10	5.90e-06	NA	NA
5. P	Q8DNM6	Indole-3-glycerol phosphate synthase	1.79e-08	4.43e-10	NA	NA
5. P	B3GZH2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.01e-09	8.06e-08	NA	NA
5. P	A8FHQ9	Imidazole glycerol phosphate synthase subunit HisF	1.28e-07	2.49e-02	NA	NA
5. P	Q9HQS4	Triosephosphate isomerase	5.42e-10	7.09e-11	NA	NA
5. P	Q31XS3	Pyridoxine 5'-phosphate synthase	1.54e-08	2.61e-11	NA	NA
5. P	A7I3Y5	Pyridoxine 5'-phosphate synthase	6.71e-08	1.27e-05	NA	NA
5. P	B8DPF1	Pyridoxine 5'-phosphate synthase	1.20e-08	3.59e-07	NA	NA
5. P	A9BHQ4	N-(5'-phosphoribosyl)anthranilate isomerase	2.60e-07	3.67e-02	NA	NA
5. P	B1XY47	N-(5'-phosphoribosyl)anthranilate isomerase	6.23e-07	9.69e-03	NA	NA
5. P	Q73SV2	Deoxyribose-phosphate aldolase	7.64e-11	8.08e-05	NA	NA
5. P	Q31TC7	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.53e-08	1.98e-11	NA	NA
5. P	A7HXZ6	Indole-3-glycerol phosphate synthase	1.55e-10	5.16e-09	NA	NA
5. P	Q5HIA5	3-hexulose-6-phosphate synthase	1.97e-09	1.07e-07	NA	NA
5. P	Q2IWB0	Indole-3-glycerol phosphate synthase	4.80e-10	6.21e-09	NA	NA
5. P	B2HVE7	Indole-3-glycerol phosphate synthase	8.15e-10	1.62e-07	NA	NA
5. P	C5A615	Geranylgeranylglyceryl phosphate synthase	2.34e-10	3.78e-08	NA	NA
5. P	B5Y7V3	Deoxyribose-phosphate aldolase	3.56e-10	1.17e-07	NA	NA
5. P	Q4L904	Thiazole synthase	4.41e-09	4.14e-07	NA	NA
5. P	C6C1D1	Tryptophan synthase alpha chain	3.89e-08	1.20e-08	NA	NA
5. P	O29333	Orotidine 5'-phosphate decarboxylase	2.54e-09	9.17e-05	NA	NA
5. P	A8H5E5	Imidazole glycerol phosphate synthase subunit HisF	2.08e-07	8.08e-04	NA	NA
5. P	Q2NET5	Geranylgeranylglyceryl phosphate synthase	2.40e-10	6.27e-08	NA	NA
5. P	A5FJ95	Pyridoxine 5'-phosphate synthase	5.20e-08	2.88e-06	NA	NA
5. P	A8A1P8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.48e-08	4.92e-07	NA	NA
5. P	B0RR86	Tryptophan synthase alpha chain	2.19e-06	1.34e-07	NA	NA
5. P	B1Z1P1	Tryptophan synthase alpha chain	9.21e-09	1.56e-05	NA	NA
5. P	B3QTV1	Pyridoxine 5'-phosphate synthase	1.45e-08	1.53e-11	NA	NA
5. P	Q1QRX0	Imidazole glycerol phosphate synthase subunit HisF	2.40e-10	4.34e-02	NA	NA
5. P	A3MFQ4	Indole-3-glycerol phosphate synthase	8.37e-11	2.00e-08	NA	NA
5. P	Q1QE71	Thiazole synthase	6.33e-09	2.32e-08	NA	NA
5. P	A7H522	Tryptophan synthase alpha chain	5.95e-06	2.00e-08	NA	NA
5. P	O22765	Tryptophan synthase alpha chain	3.15e-09	4.87e-06	NA	NA
5. P	Q10Y87	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.70e-07	1.92e-05	NA	NA
5. P	A0T0L1	Thiazole synthase	7.93e-06	2.15e-06	NA	NA
5. P	Q92MQ3	Deoxyribose-phosphate aldolase	3.25e-10	4.29e-06	NA	NA
5. P	A4Y083	Imidazole glycerol phosphate synthase subunit HisF	2.79e-10	1.70e-04	NA	NA
5. P	B7GVK1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.91e-06	1.54e-05	NA	NA
5. P	B2TY68	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.62e-08	3.08e-11	NA	NA
5. P	Q97P30	Indole-3-glycerol phosphate synthase	1.78e-08	1.50e-09	NA	NA
5. P	Q49WT7	3-hexulose-6-phosphate synthase 1	3.16e-09	5.22e-07	NA	NA
5. P	Q8FXY6	Tryptophan synthase alpha chain	1.51e-08	1.81e-04	NA	NA
5. P	B2UX21	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.15e-07	1.33e-05	NA	NA
5. P	B2T9N0	Tryptophan synthase alpha chain	1.28e-08	2.94e-06	NA	NA
5. P	P13997	N-(5'-phosphoribosyl)anthranilate isomerase	1.92e-06	1.73e-02	NA	NA
5. P	P24670	3-dehydroquinate dehydratase	1.69e-08	1.27e-03	NA	NA
5. P	P58687	3-dehydroquinate dehydratase	2.50e-08	3.17e-02	NA	NA
5. P	Q3V7J9	Pyridoxine 5'-phosphate synthase	5.69e-09	5.27e-09	NA	NA
5. P	A4X9Q0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.57e-07	4.22e-07	NA	NA
5. P	A6UU96	(5-formylfuran-3-yl)methyl phosphate synthase	2.40e-09	1.98e-03	NA	NA
5. P	Q9Y8T6	N-(5'-phosphoribosyl)anthranilate isomerase	1.10e-08	5.98e-04	NA	NA
5. P	Q9ZFA7	Indole-3-glycerol phosphate synthase	3.05e-10	3.36e-09	NA	NA
5. P	A4VQX9	Thiamine-phosphate synthase	5.26e-07	6.81e-06	NA	NA
5. P	Q9S4H7	Putative imidazole glycerol phosphate synthase subunit HisF	1.12e-09	4.73e-04	NA	NA
5. P	Q63DW8	Imidazole glycerol phosphate synthase subunit HisF	2.12e-10	3.11e-03	NA	NA
5. P	P63932	Deoxyribose-phosphate aldolase	3.98e-08	1.22e-06	NA	NA
5. P	B0JGL3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.37e-07	8.84e-05	NA	NA
5. P	Q8YE36	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.29e-06	1.80e-04	NA	NA
5. P	Q3B5F2	Tryptophan synthase alpha chain	1.38e-06	3.47e-06	NA	NA
5. P	B0TAQ4	Pyridoxal 5'-phosphate synthase subunit PdxS	1.74e-06	1.85e-02	NA	NA
5. P	B7MDH8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.31e-08	8.90e-07	NA	NA
5. P	Q1GXW1	Thiamine-phosphate synthase	2.63e-07	1.87e-02	NA	NA
5. P	C4XIJ2	Thiamine-phosphate synthase	3.64e-09	4.17e-06	NA	NA
5. P	Q57854	Imidazole glycerol phosphate synthase subunit HisF	4.57e-07	3.78e-02	NA	NA
5. P	B7I0F3	Tryptophan synthase alpha chain	1.55e-09	8.67e-08	NA	NA
5. P	A6L6Z2	Imidazole glycerol phosphate synthase subunit HisF	1.66e-07	3.81e-02	NA	NA
5. P	Q8U2H5	Uncharacterized protein PF0860	3.84e-09	3.12e-02	NA	NA
5. P	B2UQA2	Imidazole glycerol phosphate synthase subunit HisF	2.67e-10	1.50e-04	NA	NA
5. P	B5BIC0	Tryptophan synthase alpha chain	3.76e-09	4.02e-07	NA	NA
5. P	P39304	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.59e-08	1.15e-11	NA	NA
5. P	B7V609	Indole-3-glycerol phosphate synthase	1.96e-10	4.52e-08	NA	NA
5. P	B8EM86	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.38e-06	8.50e-04	NA	NA
5. P	C5BMF4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.74e-09	4.36e-07	NA	NA
5. P	B3ENW0	Tryptophan synthase alpha chain	2.05e-06	1.08e-05	NA	NA
5. P	Q6LZM2	Orotidine 5'-phosphate decarboxylase	8.53e-09	1.50e-05	NA	NA
5. P	B2AGF6	Thiazole synthase	7.63e-05	3.82e-06	NA	NA
5. P	A7MMG7	Tryptophan synthase alpha chain	2.57e-09	9.42e-05	NA	NA
5. P	B8FP24	Imidazole glycerol phosphate synthase subunit HisF	9.79e-08	1.56e-02	NA	NA
5. P	A0KU07	Deoxyribose-phosphate aldolase	3.44e-09	8.46e-03	NA	NA
5. P	B7JES9	N-(5'-phosphoribosyl)anthranilate isomerase	1.50e-06	3.50e-02	NA	NA
5. P	A4SV19	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.60e-06	1.65e-03	NA	NA
5. P	B8J249	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.49e-07	1.33e-04	NA	NA
5. P	A1KAV5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.58e-09	1.36e-06	NA	NA
5. P	Q71YQ8	Heptaprenylglyceryl phosphate synthase	1.17e-05	4.58e-07	NA	NA
5. P	B0CHH2	Pyridoxine 5'-phosphate synthase	6.40e-07	1.07e-07	NA	NA
5. P	B7INA2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.71e-08	6.43e-06	NA	NA
5. P	B1VTI8	2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase	2.96e-09	3.77e-04	NA	NA
5. P	B0JY78	Imidazole glycerol phosphate synthase subunit HisF	1.20e-07	5.79e-03	NA	NA
5. P	Q97CA8	3-dehydroquinate dehydratase	1.52e-06	9.24e-03	NA	NA
5. P	B2KEC4	Pyridoxine 5'-phosphate synthase	1.48e-08	1.18e-10	NA	NA
5. P	B8E999	Imidazole glycerol phosphate synthase subunit HisF	1.16e-07	1.57e-02	NA	NA
5. P	A6U559	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.50e-09	1.22e-07	NA	NA
5. P	A0KWK2	Thiazole synthase	2.57e-09	3.43e-06	NA	NA
5. P	Q8CQ92	Imidazole glycerol phosphate synthase subunit HisF	6.37e-10	4.90e-04	NA	NA
5. P	Q1IFZ9	Indole-3-glycerol phosphate synthase	3.84e-10	1.08e-06	NA	NA
5. P	P16608	Tryptophan synthase alpha chain	2.58e-08	2.31e-05	NA	NA
5. P	A1UAB4	Thiamine-phosphate synthase	1.92e-09	1.34e-07	NA	NA
5. P	A3NZP6	Indole-3-glycerol phosphate synthase	1.38e-10	1.22e-08	NA	NA
5. P	A4SV52	Indole-3-glycerol phosphate synthase	1.70e-10	2.20e-07	NA	NA
5. P	Q83R04	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.36e-08	8.21e-07	NA	NA
5. P	Q5N0H4	Imidazole glycerol phosphate synthase subunit HisF	1.11e-07	3.28e-04	NA	NA
5. P	Q4ZVW1	N-(5'-phosphoribosyl)anthranilate isomerase	1.10e-06	8.26e-03	NA	NA
5. P	Q6AMF7	Thiazole synthase	1.95e-09	1.82e-06	NA	NA
5. P	Q8TVJ8	Indole-3-glycerol phosphate synthase	6.39e-08	8.93e-10	NA	NA
5. P	B9M5K2	Pyridoxine 5'-phosphate synthase	7.11e-09	3.69e-10	NA	NA
5. P	C1EMQ6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.70e-08	1.88e-05	NA	NA
5. P	A8HQ40	N-(5'-phosphoribosyl)anthranilate isomerase	5.68e-07	6.38e-03	NA	NA
5. P	B1XY49	Tryptophan synthase alpha chain	6.98e-09	1.02e-05	NA	NA
5. P	Q970Z0	Imidazole glycerol phosphate synthase subunit HisF	2.04e-07	4.21e-03	NA	NA
5. P	A2RK25	Tryptophan synthase alpha chain	1.15e-08	1.50e-07	NA	NA
5. P	A7GVW5	Imidazole glycerol phosphate synthase subunit HisF	2.67e-10	2.65e-02	NA	NA
5. P	B1KRF9	Imidazole glycerol phosphate synthase subunit HisF	1.42e-07	5.00e-03	NA	NA
5. P	B5YPY0	3-dehydroquinate dehydratase	2.34e-08	1.03e-03	NA	NA
5. P	Q9RQV9	Pyridoxine 5'-phosphate synthase	1.42e-08	1.07e-07	NA	NA
5. P	A5USQ4	Indole-3-glycerol phosphate synthase	1.39e-10	6.40e-08	NA	NA
5. P	B2V184	Deoxyribose-phosphate aldolase	1.56e-10	9.93e-08	NA	NA
5. P	Q92PR9	Indole-3-glycerol phosphate synthase	2.00e-07	3.38e-07	NA	NA
5. P	B7LCQ5	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.53e-08	1.98e-11	NA	NA
5. P	O28087	(5-formylfuran-3-yl)methyl phosphate synthase	9.84e-09	1.85e-02	NA	NA
5. P	B8G9S2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.45e-10	1.93e-04	NA	NA
5. P	Q01NZ1	Thiazole synthase	5.84e-09	2.52e-09	NA	NA
5. P	Q67RZ3	Deoxyribose-phosphate aldolase	5.92e-10	1.30e-06	NA	NA
5. P	Q039B4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.15e-10	1.36e-04	NA	NA
5. P	A9AZD9	Thiamine-phosphate synthase	3.11e-10	9.07e-07	NA	NA
5. P	Q0BIW5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.96e-07	3.90e-08	NA	NA
5. P	B7I8K2	Tryptophan synthase alpha chain	4.21e-09	1.47e-05	NA	NA
5. P	A9BAN4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.05e-07	1.36e-04	NA	NA
5. P	Q9ZBH3	Putative (5-formylfuran-3-yl)methyl phosphate synthase	3.51e-08	1.41e-02	NA	NA
5. P	Q17ZN1	Pyridoxine 5'-phosphate synthase	6.76e-07	7.64e-06	NA	NA
5. P	Q01128	N-(5'-phosphoribosyl)anthranilate isomerase	5.25e-06	1.09e-02	NA	NA
5. P	A0B8J3	Geranylgeranylglyceryl phosphate synthase	1.21e-07	2.36e-02	NA	NA
5. P	A0LK96	Pyridoxine 5'-phosphate synthase	9.76e-09	5.70e-12	NA	NA
5. P	P66989	Indole-3-glycerol phosphate synthase	5.88e-10	2.46e-07	NA	NA
5. P	O30725	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.96e-07	1.75e-06	NA	NA
5. P	Q31E65	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.83e-07	2.81e-07	NA	NA
5. P	A9A3Z1	Geranylgeranylglyceryl phosphate synthase	1.31e-07	2.51e-05	NA	NA
5. P	B4EFK2	Tryptophan synthase alpha chain	7.97e-09	3.78e-05	NA	NA
5. P	A1WAT8	Tryptophan synthase alpha chain	2.88e-06	3.14e-06	NA	NA
5. P	Q2G8S2	Orotidine 5'-phosphate decarboxylase	1.09e-08	7.62e-03	NA	NA
5. P	Q5WX31	Tryptophan synthase alpha chain	1.56e-09	6.86e-03	NA	NA
5. P	Q3KJI6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.91e-08	4.02e-07	NA	NA
5. P	B5EAK6	Tryptophan synthase alpha chain	1.09e-09	3.11e-05	NA	NA
5. P	A1R5S1	Imidazole glycerol phosphate synthase subunit HisF	8.65e-08	1.02e-02	NA	NA
5. P	Q88AF6	Thiazole synthase	3.54e-09	3.26e-08	NA	NA
5. P	A7I1W6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.34e-09	3.70e-07	NA	NA
5. P	Q2FQM4	Geranylgeranylglyceryl phosphate synthase	1.64e-05	2.04e-08	NA	NA
5. P	Q5F9Y6	Tryptophan synthase alpha chain	7.06e-07	6.96e-08	NA	NA
5. P	A1W434	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.05e-06	5.17e-07	NA	NA
5. P	Q7NUD9	Tryptophan synthase alpha chain	2.27e-09	4.68e-09	NA	NA
5. P	Q8FNZ7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.71e-07	1.84e-10	NA	NA
5. P	A2BTP5	Thiazole synthase	5.62e-09	5.61e-07	NA	NA
5. P	A8ES24	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.29e-09	6.27e-08	NA	NA
5. P	Q7MPP3	Putative imidazole glycerol phosphate synthase subunit hisF2	1.04e-06	2.91e-02	NA	NA
5. P	Q8EPW8	Deoxyribose-phosphate aldolase 1	8.84e-10	4.28e-09	NA	NA
5. P	B7JBI2	Thiamine-phosphate synthase	1.91e-07	1.83e-06	NA	NA
5. P	A6T006	Tryptophan synthase alpha chain	2.97e-09	2.69e-08	NA	NA
5. P	Q18C22	Deoxyribose-phosphate aldolase	9.07e-11	2.88e-09	NA	NA
5. P	A0PRX9	Thiazole synthase	4.88e-09	2.69e-06	NA	NA
5. P	Q7VEW8	Imidazole glycerol phosphate synthase subunit HisF	3.14e-10	1.31e-02	NA	NA
5. P	A4IQ84	Indole-3-glycerol phosphate synthase	4.46e-08	1.01e-10	NA	NA
5. P	Q6HLU6	Indole-3-glycerol phosphate synthase	1.42e-08	1.64e-10	NA	NA
5. P	Q7VY68	N-(5'-phosphoribosyl)anthranilate isomerase	1.16e-06	3.61e-02	NA	NA
5. P	Q7N964	Thiamine-phosphate synthase	1.17e-08	9.50e-04	NA	NA
5. P	B8DHB5	Tryptophan synthase alpha chain	5.60e-09	3.37e-04	NA	NA
5. P	O22018	Tryptophan synthase alpha chain	2.86e-09	5.84e-07	NA	NA
5. P	Q7SIB9	Imidazole glycerol phosphate synthase subunit HisF	2.12e-07	2.70e-04	NA	NA
5. P	A6KXM3	Pyridoxine 5'-phosphate synthase	2.73e-08	1.55e-09	NA	NA
5. P	Q5HCM3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.56e-09	5.64e-08	NA	NA
5. P	A5UY94	Pyridoxal 5'-phosphate synthase subunit PdxS	1.84e-06	4.08e-03	NA	NA
5. P	A1AYV3	Tryptophan synthase alpha chain	2.04e-08	3.37e-06	NA	NA
5. P	Q1I3G7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.45e-09	1.43e-04	NA	NA
5. P	Q2Y865	Pyridoxine 5'-phosphate synthase	1.68e-08	1.37e-08	NA	NA
5. P	A5CRW2	Imidazole glycerol phosphate synthase subunit HisF	7.44e-10	6.81e-06	NA	NA
5. P	B6JCG5	Imidazole glycerol phosphate synthase subunit HisF	2.11e-10	6.38e-03	NA	NA
5. P	Q57AH3	Imidazole glycerol phosphate synthase subunit HisF	7.10e-10	1.17e-04	NA	NA
5. P	B1I3Z6	N-(5'-phosphoribosyl)anthranilate isomerase	5.25e-07	5.38e-03	NA	NA
5. P	B9DMR9	Heptaprenylglyceryl phosphate synthase	1.19e-05	4.92e-07	NA	NA
5. P	B4SD44	N-(5'-phosphoribosyl)anthranilate isomerase	9.84e-07	2.25e-03	NA	NA
5. P	Q8GDQ6	Imidazole glycerol phosphate synthase subunit HisF (Fragment)	1.75e-07	1.32e-02	NA	NA
5. P	Q4FUL2	Tryptophan synthase alpha chain	2.50e-06	1.24e-02	NA	NA
5. P	A4G1P4	Indole-3-glycerol phosphate synthase	1.68e-10	2.27e-07	NA	NA
5. P	Q8FG49	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.31e-08	3.48e-07	NA	NA
5. P	P50908	Tryptophan synthase alpha chain	2.31e-08	6.86e-05	NA	NA
5. P	Q97CS3	Orotidine 5'-phosphate decarboxylase	5.20e-07	2.36e-03	NA	NA
5. P	Q051T8	N-(5'-phosphoribosyl)anthranilate isomerase	6.74e-06	1.67e-04	NA	NA
5. P	O74025	Triosephosphate isomerase	4.71e-11	2.59e-14	NA	NA
5. P	Q2Y7R5	Tryptophan synthase alpha chain	4.87e-09	3.29e-03	NA	NA
5. P	A6VDR0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.62e-08	7.79e-05	NA	NA
5. P	Q602R3	Thiamine-phosphate synthase	1.40e-09	2.83e-05	NA	NA
5. P	O28965	Triosephosphate isomerase	5.92e-11	1.05e-08	NA	NA
5. P	A7H5V3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.37e-06	7.58e-05	NA	NA
5. P	Q1CN74	Thiazole synthase	5.72e-09	2.40e-03	NA	NA
5. P	Q13EQ3	N-(5'-phosphoribosyl)anthranilate isomerase	2.04e-07	3.75e-03	NA	NA
5. P	B1YRW1	Imidazole glycerol phosphate synthase subunit HisF	8.29e-10	2.87e-02	NA	NA
5. P	Q5P794	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.89e-09	2.86e-05	NA	NA
5. P	Q123F4	Indole-3-glycerol phosphate synthase	2.95e-10	7.34e-08	NA	NA
5. P	Q5L2C0	Thiazole synthase	2.18e-09	1.07e-07	NA	NA
5. P	Q98QP7	Deoxyribose-phosphate aldolase	1.89e-10	1.63e-08	NA	NA
5. P	Q1C7P3	Tryptophan synthase alpha chain	2.71e-09	2.37e-06	NA	NA
5. P	A7NN50	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.50e-10	5.12e-05	NA	NA
5. P	Q3BUF3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.74e-10	1.49e-03	NA	NA
5. P	Q3Z6V7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.89e-07	1.68e-06	NA	NA
5. P	Q28LB1	Tryptophan synthase alpha chain	6.96e-05	6.75e-06	NA	NA
5. P	B3QNM2	Thiamine-phosphate synthase	1.54e-09	2.63e-05	NA	NA
5. P	Q58927	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.65e-08	8.08e-05	NA	NA
5. P	Q4UU44	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.82e-10	1.80e-04	NA	NA
5. P	Q8YPM0	Deoxyribose-phosphate aldolase	4.78e-10	2.49e-06	NA	NA
5. P	Q46LX8	Tryptophan synthase alpha chain	2.90e-09	1.27e-03	NA	NA
5. P	A3M9N4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.84e-06	1.54e-05	NA	NA
5. P	B8ZRC1	Tryptophan synthase alpha chain	8.38e-06	1.14e-06	NA	NA
5. P	Q5HVR3	Indole-3-glycerol phosphate synthase	1.06e-11	4.91e-06	NA	NA
5. P	A6GWZ0	Tryptophan synthase alpha chain	9.98e-09	3.00e-04	NA	NA
5. P	A5IU73	Heptaprenylglyceryl phosphate synthase	1.52e-05	2.04e-06	NA	NA
5. P	Q7P1R3	Thiamine-phosphate synthase	2.18e-09	3.35e-03	NA	NA
5. P	Q083K1	Imidazole glycerol phosphate synthase subunit HisF	1.41e-07	2.96e-03	NA	NA
5. P	B7L9Q1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.63e-08	5.28e-07	NA	NA
5. P	B8FP23	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.05e-07	3.54e-05	NA	NA
5. P	Q5XQP9	N-(5'-phosphoribosyl)anthranilate isomerase	3.48e-06	7.44e-05	NA	NA
5. P	B0KI44	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.30e-06	8.22e-05	NA	NA
5. P	C4XGU0	Pyridoxine 5'-phosphate synthase	1.12e-08	2.82e-09	NA	NA
5. P	Q9S2N4	Thiazole synthase	3.83e-05	1.20e-06	NA	NA
5. P	B8DZP8	Tryptophan synthase alpha chain	7.50e-08	7.90e-12	NA	NA
5. P	Q73BQ9	Indole-3-glycerol phosphate synthase	2.52e-08	1.10e-10	NA	NA
5. P	Q9PH84	Pyridoxine 5'-phosphate synthase	1.20e-06	4.44e-07	NA	NA
5. P	C0Z6P5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.07e-07	3.40e-04	NA	NA
5. P	B8E2C7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.38e-09	6.86e-05	NA	NA
5. P	A6UEI0	N-(5'-phosphoribosyl)anthranilate isomerase	8.70e-07	4.90e-02	NA	NA
5. P	A1TJQ2	Indole-3-glycerol phosphate synthase	2.43e-10	1.53e-05	NA	NA
5. P	B0K2U0	N-(5'-phosphoribosyl)anthranilate isomerase	7.23e-07	2.77e-03	NA	NA
5. P	Q0SX89	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.51e-08	1.98e-11	NA	NA
5. P	Q8DJN7	Imidazole glycerol phosphate synthase subunit HisF	3.35e-07	1.66e-02	NA	NA
5. P	B1ZW12	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.76e-10	8.08e-05	NA	NA
5. P	A0M283	Imidazole glycerol phosphate synthase subunit HisF	9.75e-08	3.81e-02	NA	NA
5. P	C1DQD4	N-(5'-phosphoribosyl)anthranilate isomerase	8.73e-07	2.38e-02	NA	NA
5. P	B0UHP4	Thiazole synthase	1.59e-09	3.63e-11	NA	NA
5. P	Q3SRB0	Pyridoxine 5'-phosphate synthase	9.04e-09	5.95e-08	NA	NA
5. P	B0CJK9	N-(5'-phosphoribosyl)anthranilate isomerase	9.70e-07	2.89e-02	NA	NA
5. P	A0LTT7	Tryptophan synthase alpha chain	4.08e-06	6.20e-08	NA	NA
5. P	B4RLX9	3-dehydroquinate dehydratase	5.51e-08	1.87e-02	NA	NA
5. P	B2GBR5	Imidazole glycerol phosphate synthase subunit HisF	3.49e-10	2.80e-02	NA	NA
5. P	A4VKF4	N-(5'-phosphoribosyl)anthranilate isomerase	4.94e-07	2.88e-03	NA	NA
5. P	A7FNH9	Thiazole synthase	3.56e-09	2.40e-03	NA	NA
5. P	P0A794	Pyridoxine 5'-phosphate synthase	2.00e-08	2.73e-11	NA	NA
5. P	Q18DL2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.55e-08	2.49e-07	NA	NA
5. P	Q3Z247	3-dehydroquinate dehydratase	2.38e-08	4.08e-04	NA	NA
5. P	Q0T9J7	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.49e-08	1.15e-11	NA	NA
5. P	Q10ZM7	Indole-3-glycerol phosphate synthase	6.82e-10	7.51e-05	NA	NA
5. P	Q97AZ4	Probable transaldolase	2.89e-08	3.00e-02	NA	NA
5. P	A5V9W0	Imidazole glycerol phosphate synthase subunit HisF	1.78e-10	7.65e-05	NA	NA
5. P	A0RB63	N-(5'-phosphoribosyl)anthranilate isomerase	1.69e-06	4.76e-02	NA	NA
5. P	Q89A59	Ribulose-phosphate 3-epimerase	9.98e-06	8.22e-04	NA	NA
5. P	B0SDM7	Tryptophan synthase alpha chain	2.12e-06	7.56e-09	NA	NA
5. P	B9J7M8	Orotidine 5'-phosphate decarboxylase	3.63e-08	1.70e-03	NA	NA
5. P	Q311Y2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.72e-07	6.97e-03	NA	NA
5. P	B6EJA2	Tryptophan synthase alpha chain	2.67e-09	8.55e-07	NA	NA
5. P	Q46906	Uncharacterized protein YgcP	5.95e-09	6.81e-03	NA	NA
5. P	A3DN81	Geranylgeranylglyceryl phosphate synthase	1.34e-06	1.10e-06	NA	NA
5. P	B6YWA8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.29e-08	2.00e-08	NA	NA
5. P	Q07PW9	Thiazole synthase	4.83e-05	1.06e-06	NA	NA
5. P	Q4FND0	Tryptophan synthase alpha chain	1.91e-05	2.95e-09	NA	NA
5. P	P51012	Ribulose-phosphate 3-epimerase	3.10e-08	2.44e-05	NA	NA
5. P	C3MBC2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.62e-06	2.26e-04	NA	NA
5. P	A1KJ29	Tryptophan synthase alpha chain	6.15e-06	1.43e-05	NA	NA
5. P	Q6D4T9	Tryptophan synthase alpha chain	2.42e-09	9.68e-05	NA	NA
5. P	Q2KU99	Indole-3-glycerol phosphate synthase	1.42e-10	1.10e-05	NA	NA
5. P	D2QS27	Geranylgeranylglyceryl phosphate synthase	6.24e-07	5.83e-08	NA	NA
5. P	Q8DVF2	Tryptophan synthase alpha chain	3.70e-08	5.68e-06	NA	NA
5. P	Q2Y5Q6	Thiamine-phosphate synthase	2.72e-10	1.25e-06	NA	NA
5. P	B1ZNA6	Pyridoxine 5'-phosphate synthase	1.75e-08	7.53e-14	NA	NA
5. P	Q6NJX0	Deoxyribose-phosphate aldolase	6.92e-10	3.44e-05	NA	NA
5. P	Q8U1U1	Orotidine 5'-phosphate decarboxylase	1.35e-06	5.48e-04	NA	NA
5. P	A7H5V4	Imidazole glycerol phosphate synthase subunit HisF	2.02e-10	2.36e-03	NA	NA
5. P	Q1GNC3	Imidazole glycerol phosphate synthase subunit HisF	3.48e-10	3.69e-03	NA	NA
5. P	B5QVU3	3-dehydroquinate dehydratase	2.41e-08	2.07e-02	NA	NA
5. P	Q9PMQ6	Triosephosphate isomerase	1.30e-06	3.00e-02	NA	NA
5. P	Q9WYG8	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	1.91e-03	7.79e-05	NA	NA
5. P	B0CJI6	Imidazole glycerol phosphate synthase subunit HisF	3.39e-10	1.17e-04	NA	NA
5. P	Q2FDI8	Imidazole glycerol phosphate synthase subunit HisF	2.54e-10	2.12e-03	NA	NA
5. P	Q57LD3	Pyridoxine 5'-phosphate synthase	1.01e-08	5.95e-10	NA	NA
5. P	P34816	Tryptophan synthase alpha chain	2.10e-06	3.17e-04	NA	NA
5. P	Q5WDI1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.39e-09	1.82e-03	NA	NA
5. P	Q12NB8	Thiazole synthase	2.81e-09	3.15e-02	NA	NA
5. P	B4RCS1	Thiazole synthase	2.41e-09	2.34e-11	NA	NA
5. P	Q7V2P2	Imidazole glycerol phosphate synthase subunit HisF	1.02e-07	6.98e-04	NA	NA
5. P	A2BY04	Indole-3-glycerol phosphate synthase	9.71e-10	1.21e-06	NA	NA
5. P	Q8UDU5	Pyridoxine 5'-phosphate synthase	2.97e-07	1.37e-08	NA	NA
5. P	Q321F0	3-dehydroquinate dehydratase	2.24e-08	7.87e-04	NA	NA
5. P	Q8D8B1	Tryptophan synthase alpha chain	1.95e-09	8.76e-05	NA	NA
5. P	Q11I86	Pyridoxine 5'-phosphate synthase	4.42e-07	7.50e-07	NA	NA
5. P	C3K568	Tryptophan synthase alpha chain	2.27e-06	1.60e-04	NA	NA
5. P	Q3AJ26	Pyridoxine 5'-phosphate synthase	1.34e-08	1.55e-09	NA	NA
5. P	Q8Z322	Thiazole synthase	1.72e-09	3.78e-06	NA	NA
5. P	Q5WX33	N-(5'-phosphoribosyl)anthranilate isomerase	1.70e-06	2.07e-04	NA	NA
5. P	B7LUL2	Thiazole synthase	1.52e-09	2.02e-06	NA	NA
5. P	Q7RXQ8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.09e-06	1.00e-06	NA	NA
5. P	A9L3J3	Thiazole synthase	1.87e-09	6.88e-06	NA	NA
5. P	Q4G387	Thiazole synthase	5.65e-06	1.26e-04	NA	NA
5. P	Q2YU68	Heptaprenylglyceryl phosphate synthase	1.16e-05	1.87e-06	NA	NA
5. P	A1S7I3	Tryptophan synthase alpha chain	1.85e-09	2.23e-06	NA	NA
5. P	B7J4S8	Tryptophan synthase alpha chain	2.38e-06	1.06e-07	NA	NA
5. P	Q5F5C4	Thiazole synthase	8.75e-09	3.06e-04	NA	NA
5. P	A3CMP6	Deoxyribose-phosphate aldolase	3.97e-10	7.56e-09	NA	NA
5. P	B9L7B6	Thiazole synthase	4.77e-09	1.63e-07	NA	NA
5. P	Q5HHL2	3-dehydroquinate dehydratase	9.31e-07	1.41e-02	NA	NA
5. P	C6DEP1	Deoxyribose-phosphate aldolase	1.17e-09	2.00e-08	NA	NA
5. P	Q8KX32	Tryptophan synthase alpha chain	1.22e-09	2.05e-07	NA	NA
5. P	P05194	3-dehydroquinate dehydratase	2.29e-08	6.69e-04	NA	NA
5. P	Q47QS4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.28e-07	9.09e-09	NA	NA
5. P	C0Q1J8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.66e-08	2.64e-06	NA	NA
5. P	P50382	Tryptophan synthase alpha chain	3.34e-10	4.07e-08	NA	NA
5. P	A5VBA0	Indole-3-glycerol phosphate synthase	2.93e-10	2.27e-07	NA	NA
5. P	A3NE93	Imidazole glycerol phosphate synthase subunit HisF	8.97e-10	7.14e-03	NA	NA
5. P	Q7VU67	Indole-3-glycerol phosphate synthase	9.69e-11	1.82e-06	NA	NA
5. P	Q30NR6	Imidazole glycerol phosphate synthase subunit HisF	1.11e-07	1.03e-03	NA	NA
5. P	A3DD04	Thiazole synthase	3.08e-09	3.51e-08	NA	NA
5. P	Q9K0V9	Pyridoxine 5'-phosphate synthase	1.76e-08	3.98e-07	NA	NA
5. P	A3MPU5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.29e-07	2.65e-07	NA	NA
5. P	Q5V212	N-(5'-phosphoribosyl)anthranilate isomerase	3.08e-08	1.73e-02	NA	NA
5. P	Q4L4R1	3-dehydroquinate dehydratase	1.43e-07	2.51e-02	NA	NA
5. P	Q82A99	Imidazole glycerol phosphate synthase subunit HisF	8.77e-10	3.96e-02	NA	NA
5. P	Q89FP2	Thiazole synthase	4.65e-06	1.32e-03	NA	NA
5. P	Q5WJ32	Heptaprenylglyceryl phosphate synthase	8.64e-06	1.45e-08	NA	NA
5. P	Q04IY7	Indole-3-glycerol phosphate synthase	1.73e-08	4.43e-10	NA	NA
5. P	A1W035	Thiazole synthase	2.86e-09	9.89e-10	NA	NA
5. P	A9MHE0	Thiazole synthase	1.32e-09	5.62e-06	NA	NA
5. P	A6WP21	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-06	5.19e-08	NA	NA
5. P	B5YZP0	Tryptophan synthase alpha chain	2.76e-09	2.69e-06	NA	NA
5. P	B2GG36	Deoxyribose-phosphate aldolase	8.55e-10	1.25e-05	NA	NA
5. P	B1L873	Imidazole glycerol phosphate synthase subunit HisF	1.05e-07	2.70e-04	NA	NA
5. P	B9JG66	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.64e-06	3.87e-04	NA	NA
5. P	B5YE89	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.31e-09	5.34e-03	NA	NA
5. P	B0RPJ1	Thiazole synthase	2.34e-09	2.31e-09	NA	NA
5. P	Q81T58	Imidazole glycerol phosphate synthase subunit HisF	2.10e-10	1.44e-03	NA	NA
5. P	Q5SKD9	Pyridoxal 5'-phosphate synthase subunit PdxS	1.03e-08	2.33e-02	NA	NA
5. P	P44988	Probable 3-keto-L-gulonate-6-phosphate decarboxylase	6.64e-08	3.51e-08	NA	NA
5. P	B7N529	3-dehydroquinate dehydratase	2.36e-08	6.57e-04	NA	NA
5. P	Q21XM2	Pyridoxine 5'-phosphate synthase	3.00e-07	5.68e-06	NA	NA
5. P	Q5N324	Tryptophan synthase alpha chain	1.82e-10	1.24e-05	NA	NA
5. P	Q2SJD2	N-(5'-phosphoribosyl)anthranilate isomerase	7.03e-07	4.12e-04	NA	NA
5. P	Q75AP1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.65e-06	9.67e-04	NA	NA
5. P	A8AW03	Indole-3-glycerol phosphate synthase	1.96e-08	7.26e-08	NA	NA
5. P	Q7MPK7	Putative imidazole glycerol phosphate synthase subunit hisF3	1.43e-09	7.87e-04	NA	NA
5. P	A0RBM2	Imidazole glycerol phosphate synthase subunit HisF	2.12e-10	3.11e-03	NA	NA
5. P	P49570	Thiazole synthase	7.09e-06	2.04e-09	NA	NA
5. P	Q3A6Y9	Thiazole synthase 2	7.90e-10	5.12e-03	NA	NA
5. P	Q02YX1	Imidazole glycerol phosphate synthase subunit HisF	3.52e-10	1.06e-02	NA	NA
5. P	A5U2W1	Imidazole glycerol phosphate synthase subunit HisF	3.54e-10	2.85e-02	NA	NA
5. P	Q5WGS2	N-(5'-phosphoribosyl)anthranilate isomerase	5.13e-07	3.03e-02	NA	NA
5. P	O13504	N-(5'-phosphoribosyl)anthranilate isomerase	3.10e-06	1.00e-02	NA	NA
5. P	Q7VQW6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.58e-06	4.03e-08	NA	NA
5. P	B8JDL2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-09	5.11e-06	NA	NA
5. P	A3N3W4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.61e-08	9.33e-08	NA	NA
5. P	Q98AZ6	Thiazole synthase	4.88e-09	6.43e-05	NA	NA
5. P	C3K6V2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.63e-08	7.89e-07	NA	NA
5. P	Q0HUX4	Thiazole synthase	1.86e-09	1.40e-05	NA	NA
5. P	A7NS83	N-(5'-phosphoribosyl)anthranilate isomerase	2.00e-06	2.30e-04	NA	NA
5. P	Q8PT98	N-(5'-phosphoribosyl)anthranilate isomerase 1	1.85e-08	8.17e-06	NA	NA
5. P	Q13EQ1	Tryptophan synthase alpha chain	2.98e-08	1.25e-03	NA	NA
5. P	Q5PJE1	Putative epimerase LsrE	8.04e-08	1.32e-03	NA	NA
5. P	Q5P1I9	Tryptophan synthase alpha chain	5.94e-09	6.13e-04	NA	NA
5. P	Q97P33	Tryptophan synthase alpha chain	5.25e-08	1.27e-05	NA	NA
5. P	Q7WH63	Pyridoxine 5'-phosphate synthase	2.86e-08	3.78e-07	NA	NA
5. P	A5CZ73	Imidazole glycerol phosphate synthase subunit HisF	1.88e-07	2.28e-04	NA	NA
5. P	B7M403	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.78e-08	5.84e-07	NA	NA
5. P	Q8ESU2	Indole-3-glycerol phosphate synthase	7.53e-12	1.18e-08	NA	NA
5. P	Q16AJ0	Pyridoxine 5'-phosphate synthase	3.86e-08	8.46e-07	NA	NA
5. P	O29439	Imidazole glycerol phosphate synthase subunit HisF	3.26e-07	1.12e-02	NA	NA
5. P	Q3ABS1	Indole-3-glycerol phosphate synthase	2.95e-11	2.66e-06	NA	NA
5. P	A6T4L2	3-dehydroquinate dehydratase	9.10e-09	3.64e-05	NA	NA
5. P	Q02V45	Tryptophan synthase alpha chain	4.60e-05	3.63e-07	NA	NA
5. P	A3D7J4	Deoxyribose-phosphate aldolase	3.16e-09	8.66e-03	NA	NA
5. P	A5EK25	Indole-3-glycerol phosphate synthase	5.42e-10	9.19e-09	NA	NA
5. P	C1FN42	Imidazole glycerol phosphate synthase subunit HisF	2.74e-10	1.19e-02	NA	NA
5. P	C3JZS5	N-(5'-phosphoribosyl)anthranilate isomerase	1.29e-06	2.57e-03	NA	NA
5. P	B8E9A0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.47e-09	5.19e-08	NA	NA
5. P	Q8PJ26	N-(5'-phosphoribosyl)anthranilate isomerase	2.77e-06	1.02e-02	NA	NA
5. P	Q87LP2	Pyridoxine 5'-phosphate synthase	1.70e-08	1.22e-09	NA	NA
5. P	B3DRT8	Imidazole glycerol phosphate synthase subunit HisF	3.78e-10	8.88e-03	NA	NA
5. P	Q604P4	Tryptophan synthase alpha chain	2.41e-07	4.40e-07	NA	NA
5. P	Q8Y372	Thiazole synthase	6.28e-06	2.82e-06	NA	NA
5. P	A9M9R8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.24e-06	1.80e-04	NA	NA
5. P	P71350	Thiamine-phosphate synthase	4.70e-07	4.97e-08	NA	NA
5. P	B5YIB4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.10e-08	3.40e-08	NA	NA
5. P	A1U5H6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.59e-09	4.67e-05	NA	NA
5. P	A6LT21	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.14e-07	2.80e-02	NA	NA
5. P	A1W0M1	Pyridoxine 5'-phosphate synthase	4.71e-08	3.94e-07	NA	NA
5. P	B7IM75	N-(5'-phosphoribosyl)anthranilate isomerase	1.86e-06	3.56e-02	NA	NA
5. P	B0C6F8	Tryptophan synthase alpha chain	2.03e-09	9.33e-08	NA	NA
5. P	A8M4E3	Thiazole synthase	3.48e-09	2.20e-07	NA	NA
5. P	B1ZFB1	Orotidine 5'-phosphate decarboxylase	5.27e-08	1.10e-02	NA	NA
5. P	Q9S3U4	N-(5'-phosphoribosyl)anthranilate isomerase	4.39e-08	2.24e-02	NA	NA
5. P	Q71Z38	Indole-3-glycerol phosphate synthase	3.22e-11	4.57e-09	NA	NA
5. P	B8DSW1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.01e-07	3.11e-06	NA	NA
5. P	A2S754	Imidazole glycerol phosphate synthase subunit HisF	4.50e-10	9.24e-03	NA	NA
5. P	A2C129	Tryptophan synthase alpha chain	2.29e-09	5.16e-06	NA	NA
5. P	B5FJ82	3-dehydroquinate dehydratase	2.40e-08	2.07e-02	NA	NA
5. P	Q8TXZ9	N-(5'-phosphoribosyl)anthranilate isomerase	4.81e-07	1.33e-02	NA	NA
5. P	Q3AT62	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.38e-07	8.36e-04	NA	NA
5. P	P18304	Indole-3-glycerol phosphate synthase	1.55e-10	1.70e-08	NA	NA
5. P	A2RCN4	Deoxyribose-phosphate aldolase	4.25e-08	1.22e-06	NA	NA
5. P	Q9RN77	3-dehydroquinate dehydratase	2.36e-08	2.07e-02	NA	NA
5. P	B1JKS3	Tryptophan synthase alpha chain	2.75e-09	5.21e-06	NA	NA
5. P	Q5PNM0	Tryptophan synthase alpha chain	3.44e-09	4.02e-07	NA	NA
5. P	A1WH73	Indole-3-glycerol phosphate synthase	4.30e-10	6.07e-06	NA	NA
5. P	B1XQI2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.67e-07	2.27e-05	NA	NA
5. P	A5G8T0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.91e-07	7.08e-09	NA	NA
5. P	Q5NQ36	Indole-3-glycerol phosphate synthase	4.77e-10	2.19e-06	NA	NA
5. P	A7GMU9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.75e-08	1.56e-04	NA	NA
5. P	B9MKC6	Tryptophan synthase alpha chain	7.31e-06	9.70e-09	NA	NA
5. P	A9M2Q6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.83e-07	2.44e-07	NA	NA
5. P	A3PMM5	Tryptophan synthase alpha chain	9.75e-09	5.66e-07	NA	NA
5. P	Q8ZAP9	Thiazole synthase	3.33e-09	2.61e-03	NA	NA
5. P	A1KSN7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.78e-06	1.37e-07	NA	NA
5. P	P66981	Tryptophan synthase alpha chain	6.15e-06	1.43e-05	NA	NA
5. P	Q83EI7	Thiazole synthase	4.56e-06	3.17e-05	NA	NA
5. P	A6QBN6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	9.14e-10	1.38e-07	NA	NA
5. P	Q1I3G8	Imidazole glycerol phosphate synthase subunit HisF	3.17e-10	3.03e-04	NA	NA
5. P	A3P027	Imidazole glycerol phosphate synthase subunit HisF	9.93e-10	7.14e-03	NA	NA
5. P	Q972A1	Indole-3-glycerol phosphate synthase	7.89e-11	4.16e-08	NA	NA
5. P	Q8FHW0	Tryptophan synthase alpha chain	3.08e-09	5.21e-06	NA	NA
5. P	B9M0M0	Imidazole glycerol phosphate synthase subunit HisF	2.12e-07	9.16e-03	NA	NA
5. P	Q60180	Tryptophan synthase alpha chain	1.23e-05	8.50e-04	NA	NA
5. P	Q18KP6	Geranylgeranylglyceryl phosphate synthase	2.17e-05	5.31e-06	NA	NA
5. P	A6LT22	Imidazole glycerol phosphate synthase subunit HisF	2.13e-10	1.55e-02	NA	NA
5. P	Q32EF3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.21e-08	8.63e-07	NA	NA
5. P	P60579	Phosphoribosyl isomerase A	6.45e-07	3.11e-07	NA	NA
5. P	A3PGF5	Pyridoxine 5'-phosphate synthase	1.66e-08	1.13e-09	NA	NA
5. P	A5FPL3	Tryptophan synthase alpha chain	4.32e-10	1.22e-08	NA	NA
5. P	A3NM66	Tryptophan synthase alpha chain	9.94e-09	4.58e-07	NA	NA
5. P	Q2YS94	3-hexulose-6-phosphate synthase	2.35e-09	1.72e-07	NA	NA
5. P	Q317X8	Thiazole synthase	4.45e-09	3.93e-06	NA	NA
5. P	B9KXJ4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.77e-09	6.04e-05	NA	NA
5. P	A5VNE4	Thiazole synthase	3.21e-06	6.20e-08	NA	NA
5. P	Q7NUI6	Indole-3-glycerol phosphate synthase	3.30e-10	6.51e-10	NA	NA
5. P	C1FN40	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.86e-08	3.43e-04	NA	NA
5. P	B1J1Y7	Thiamine-phosphate synthase	6.39e-07	7.16e-04	NA	NA
5. P	B5EX43	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.46e-08	8.13e-07	NA	NA
5. P	Q6HLU5	N-(5'-phosphoribosyl)anthranilate isomerase	2.30e-06	4.08e-02	NA	NA
5. P	B6I2A1	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.64e-08	1.15e-11	NA	NA
5. P	A3NE94	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.18e-09	2.65e-07	NA	NA
5. P	C3K6Z0	Pyridoxine 5'-phosphate synthase	3.00e-08	1.12e-09	NA	NA
5. P	C0ZB54	Deoxyribose-phosphate aldolase	4.95e-10	2.06e-08	NA	NA
5. P	B8GPL4	Pyridoxine 5'-phosphate synthase	3.02e-08	3.59e-08	NA	NA
5. P	B1M7M3	Orotidine 5'-phosphate decarboxylase	8.21e-08	1.24e-02	NA	NA
5. P	Q9KPB5	Pyridoxine 5'-phosphate synthase	1.59e-08	1.81e-09	NA	NA
5. P	O34293	Thiazole synthase	5.62e-09	2.81e-07	NA	NA
5. P	Q18JI3	Imidazole glycerol phosphate synthase subunit HisF	2.69e-10	3.77e-04	NA	NA
5. P	O67417	Pyridoxine 5'-phosphate synthase	1.30e-08	1.70e-07	NA	NA
5. P	Q4L677	Indole-3-glycerol phosphate synthase	1.44e-10	1.84e-10	NA	NA
5. P	A8LGR8	Indole-3-glycerol phosphate synthase	4.38e-12	1.77e-08	NA	NA
5. P	B6J7I2	Tryptophan synthase alpha chain	3.35e-10	2.37e-06	NA	NA
5. P	Q02EM6	Imidazole glycerol phosphate synthase subunit HisF	2.90e-10	3.71e-04	NA	NA
5. P	Q478Z2	Thiazole synthase	2.03e-09	6.61e-08	NA	NA
5. P	C1DI61	Thiazole synthase	3.25e-09	2.25e-07	NA	NA
5. P	Q9PGC4	Thiamine-phosphate synthase	9.46e-07	6.86e-05	NA	NA
5. P	B6JP91	Pyridoxine 5'-phosphate synthase	8.04e-07	3.17e-05	NA	NA
5. P	Q57GJ6	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	3.00e-08	1.33e-10	NA	NA
5. P	B1LH32	Tryptophan synthase alpha chain	3.02e-09	2.18e-05	NA	NA
5. P	Q8GJM0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.74e-07	2.83e-05	NA	NA
5. P	A5GMK4	Indole-3-glycerol phosphate synthase	6.09e-10	1.36e-05	NA	NA
5. P	A5IBF8	Tryptophan synthase alpha chain	1.44e-09	1.55e-02	NA	NA
5. P	A5W6Y0	N-(5'-phosphoribosyl)anthranilate isomerase	1.59e-06	1.64e-02	NA	NA
5. P	C6KT50	Pyridoxal 5'-phosphate synthase subunit Pdx1	2.82e-06	1.52e-02	NA	NA
5. P	A9W5U0	Imidazole glycerol phosphate synthase subunit HisF	2.33e-10	8.22e-04	NA	NA
5. P	A4X9N0	Tryptophan synthase alpha chain	4.26e-08	2.37e-06	NA	NA
5. P	Q21NH5	Imidazole glycerol phosphate synthase subunit HisF	2.16e-10	3.74e-04	NA	NA
5. P	Q8TXM0	Geranylgeranylglyceryl phosphate synthase	1.90e-07	3.04e-10	NA	NA
5. P	Q4JVZ1	Thiamine-phosphate synthase	2.38e-07	6.39e-07	NA	NA
5. P	A1WY05	Tryptophan synthase alpha chain	2.28e-06	8.30e-05	NA	NA
5. P	A5VXL5	Indole-3-glycerol phosphate synthase	2.89e-10	1.97e-06	NA	NA
5. P	Q01NI9	Tryptophan synthase alpha chain	8.34e-07	2.00e-06	NA	NA
5. P	P30300	Glycerol uptake operon antiterminator regulatory protein	8.55e-08	2.31e-05	NA	NA
5. P	Q9RPQ4	Imidazole glycerol phosphate synthase subunit HisF	8.28e-10	1.46e-02	NA	NA
5. P	Q1BS30	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.81e-09	1.30e-07	NA	NA
5. P	P46969	Ribulose-phosphate 3-epimerase	1.24e-05	7.94e-04	NA	NA
5. P	A7I416	Imidazole glycerol phosphate synthase subunit HisF	9.39e-10	3.43e-04	NA	NA
5. P	P0AG10	Ribulose-phosphate 3-epimerase	1.53e-08	7.38e-05	NA	NA
5. P	Q4J8X8	Tryptophan synthase alpha chain	4.12e-10	1.87e-07	NA	NA
5. P	B6EK72	Copper homeostasis protein CutC	1.79e-08	3.05e-02	NA	NA
5. P	Q2N9N0	Tryptophan synthase alpha chain	4.46e-08	8.33e-06	NA	NA
5. P	Q3V814	Pyridoxine 5'-phosphate synthase	1.30e-08	4.99e-09	NA	NA
5. P	B9LFN2	Imidazole glycerol phosphate synthase subunit HisF	1.92e-10	2.15e-02	NA	NA
5. P	A9HI56	Thiazole synthase	5.97e-09	3.66e-08	NA	NA
5. P	Q7WD05	Tryptophan synthase alpha chain	3.03e-09	6.95e-06	NA	NA
5. P	A1A2H2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.14e-07	2.61e-04	NA	NA
5. P	Q02HS5	Pyridoxine 5'-phosphate synthase	1.44e-08	1.77e-08	NA	NA
5. P	C0QRW6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.39e-09	1.04e-06	NA	NA
5. P	Q5X5Q3	N-(5'-phosphoribosyl)anthranilate isomerase	1.22e-06	2.39e-04	NA	NA
5. P	A4G4G1	N-(5'-phosphoribosyl)anthranilate isomerase	1.92e-06	1.76e-02	NA	NA
5. P	Q10W95	Tryptophan synthase alpha chain	3.82e-09	6.01e-06	NA	NA
5. P	B0C977	Pyridoxine 5'-phosphate synthase	4.54e-09	8.83e-10	NA	NA
5. P	B3DQA4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.70e-07	2.14e-05	NA	NA
5. P	Q06121	Indole-3-glycerol phosphate synthase	2.21e-11	2.51e-07	NA	NA
5. P	Q9K0C6	N-(5'-phosphoribosyl)anthranilate isomerase	1.36e-06	3.35e-02	NA	NA
5. P	P20577	Indole-3-glycerol phosphate synthase	4.47e-10	3.12e-08	NA	NA
5. P	A7MX07	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.88e-08	3.29e-09	NA	NA
5. P	B4SCL0	Thiazole synthase	1.18e-09	4.50e-05	NA	NA
5. P	Q8A7Z5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.19e-10	3.33e-06	NA	NA
5. P	A1B388	Imidazole glycerol phosphate synthase subunit HisF	2.47e-10	9.58e-04	NA	NA
5. P	Q5WH85	Thiazole synthase	7.18e-09	1.79e-05	NA	NA
5. P	B1ZAD6	Imidazole glycerol phosphate synthase subunit HisF	2.89e-10	3.08e-04	NA	NA
5. P	Q63FR5	Thiazole synthase	1.40e-05	4.25e-08	NA	NA
5. P	B1XBZ3	Thiazole synthase	1.47e-09	3.71e-06	NA	NA
5. P	B7LA84	Thiazole synthase	1.50e-09	2.17e-06	NA	NA
5. P	A9NG35	Deoxyribose-phosphate aldolase	5.59e-10	7.41e-08	NA	NA
5. P	B9DS93	Deoxyribose-phosphate aldolase	4.63e-10	6.52e-07	NA	NA
5. P	A2C3H1	Pyridoxine 5'-phosphate synthase	3.41e-08	4.24e-09	NA	NA
5. P	Q8UAS8	Thiamine-phosphate synthase	4.72e-09	3.38e-07	NA	NA
5. P	B2KCM6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.68e-09	4.30e-05	NA	NA
5. P	A7I616	Imidazole glycerol phosphate synthase subunit HisF	1.91e-07	3.59e-02	NA	NA
5. P	A8Z2S0	Heptaprenylglyceryl phosphate synthase	1.62e-05	1.95e-06	NA	NA
5. P	Q9CC56	Phosphoribosyl isomerase A	4.04e-07	2.69e-08	NA	NA
5. P	Q9CC53	Tryptophan synthase alpha chain	6.81e-06	1.14e-06	NA	NA
5. P	Q2J8L3	Imidazole glycerol phosphate synthase subunit HisF	2.87e-10	3.61e-05	NA	NA
5. P	A9KE95	Tryptophan synthase alpha chain	3.74e-10	6.08e-03	NA	NA
5. P	C4ZR73	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.53e-08	1.15e-11	NA	NA
5. P	B3CLF3	Pyridoxine 5'-phosphate synthase	7.64e-08	4.33e-10	NA	NA
5. P	B9JX64	Indole-3-glycerol phosphate synthase	2.33e-07	9.49e-09	NA	NA
5. P	Q7M9W9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.55e-06	5.73e-06	NA	NA
5. P	C3MBA0	Tryptophan synthase alpha chain	6.37e-05	3.42e-02	NA	NA
5. P	B7HHG5	Imidazole glycerol phosphate synthase subunit HisF	2.60e-10	1.18e-03	NA	NA
5. P	A8LX55	Imidazole glycerol phosphate synthase subunit HisF	2.49e-10	2.27e-03	NA	NA
5. P	Q32GE2	3-dehydroquinate dehydratase	2.20e-08	2.81e-03	NA	NA
5. P	Q053M5	Tryptophan synthase alpha chain	1.14e-06	7.72e-06	NA	NA
5. P	B1LA15	Tryptophan synthase alpha chain	2.40e-08	5.25e-04	NA	NA
5. P	A1UZ42	Tryptophan synthase alpha chain	9.49e-09	4.58e-07	NA	NA
5. P	Q0ACP4	Thiazole synthase	2.95e-09	4.57e-09	NA	NA
5. P	Q46YW7	Tryptophan synthase alpha chain	4.89e-09	1.39e-05	NA	NA
5. P	C6DHS2	Thiazole synthase	2.76e-09	1.30e-04	NA	NA
5. P	A0JVL1	Indole-3-glycerol phosphate synthase	5.68e-09	3.15e-09	NA	NA
5. P	Q47R33	Thiamine-phosphate synthase	9.22e-07	3.05e-06	NA	NA
5. P	B7ML76	Tryptophan synthase alpha chain	2.89e-09	3.57e-06	NA	NA
5. P	Q88RP7	Tryptophan synthase alpha chain	4.59e-05	4.14e-03	NA	NA
5. P	P74435	N-(5'-phosphoribosyl)anthranilate isomerase	2.95e-07	1.34e-02	NA	NA
5. P	Q2YQY9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.45e-06	1.80e-04	NA	NA
5. P	Q88UE3	Imidazole glycerol phosphate synthase subunit HisF	4.22e-10	2.07e-02	NA	NA
5. P	A0AG15	Imidazole glycerol phosphate synthase subunit HisF	9.46e-11	3.75e-03	NA	NA
5. P	B5Y1W9	3-dehydroquinate dehydratase	9.16e-09	3.74e-05	NA	NA
5. P	A6UFC6	Orotidine 5'-phosphate decarboxylase	2.72e-08	2.74e-02	NA	NA
5. P	Q3ABV0	Deoxyribose-phosphate aldolase	1.38e-10	6.96e-08	NA	NA
5. P	P57206	Imidazole glycerol phosphate synthase subunit HisF	1.08e-07	1.17e-03	NA	NA
5. P	Q3Z108	Tryptophan synthase alpha chain	3.09e-09	1.71e-06	NA	NA
5. P	A7H8C3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.94e-09	7.94e-06	NA	NA
5. P	Q0T3A3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.35e-08	8.21e-07	NA	NA
5. P	A4ISR2	Imidazole glycerol phosphate synthase subunit HisF	1.22e-07	5.00e-03	NA	NA
5. P	B9E171	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.66e-08	1.43e-03	NA	NA
5. P	Q0T478	3-dehydroquinate dehydratase	2.29e-08	1.16e-03	NA	NA
5. P	A4YJQ1	Orotidine 5'-phosphate decarboxylase	3.78e-08	7.03e-03	NA	NA
5. P	P03964	Indole-3-glycerol phosphate synthase	2.32e-10	1.45e-12	NA	NA
5. P	O33772	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.96e-09	2.02e-04	NA	NA
5. P	Q65EG3	Imidazole glycerol phosphate synthase subunit HisF	9.61e-08	2.07e-02	NA	NA
5. P	A3PTW9	Thiamine-phosphate synthase	1.01e-09	3.47e-08	NA	NA
5. P	Q7TTU3	Indole-3-glycerol phosphate synthase	1.24e-09	9.79e-06	NA	NA
5. P	A5W9G9	Thiamine-phosphate synthase	5.90e-07	1.91e-04	NA	NA
5. P	Q5YYN3	Tryptophan synthase alpha chain	5.86e-06	4.58e-07	NA	NA
5. P	B1LSQ8	Tryptophan synthase alpha chain	6.54e-05	7.31e-05	NA	NA
5. P	Q3V870	Pyridoxine 5'-phosphate synthase	3.17e-08	2.78e-08	NA	NA
5. P	Q3K587	Thiazole synthase	1.75e-09	1.17e-07	NA	NA
5. P	A3QF21	Imidazole glycerol phosphate synthase subunit HisF	1.77e-10	1.77e-02	NA	NA
5. P	Q8FP52	Thiazole synthase	4.68e-09	4.01e-06	NA	NA
5. P	Q81T59	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.86e-08	2.41e-04	NA	NA
5. P	A4QI77	Tryptophan synthase alpha chain	1.43e-09	3.21e-03	NA	NA
5. P	A5FA76	Tryptophan synthase alpha chain	1.25e-08	1.59e-05	NA	NA
5. P	Q9ZBL2	Thiazole synthase	3.65e-09	3.02e-06	NA	NA
5. P	A8HYT9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.59e-06	7.87e-04	NA	NA
5. P	Q8XVE6	Indole-3-glycerol phosphate synthase 1	2.33e-10	7.28e-07	NA	NA
5. P	A1WW05	Imidazole glycerol phosphate synthase subunit HisF	3.96e-10	1.97e-02	NA	NA
5. P	B2HYJ0	Tryptophan synthase alpha chain	3.03e-09	1.47e-05	NA	NA
5. P	Q5L3C1	Heptaprenylglyceryl phosphate synthase	7.06e-06	1.30e-07	NA	NA
5. P	Q2P0U3	Tryptophan synthase alpha chain	1.13e-08	2.17e-06	NA	NA
5. P	C6E7F4	Imidazole glycerol phosphate synthase subunit HisF	1.93e-10	2.12e-02	NA	NA
5. P	Q5P2G1	Indole-3-glycerol phosphate synthase	2.05e-10	2.20e-07	NA	NA
5. P	Q5YNQ2	Thiazole synthase	4.31e-09	7.98e-08	NA	NA
5. P	B3Q606	Tryptophan synthase alpha chain	2.31e-08	1.97e-03	NA	NA
5. P	B4TUS2	3-dehydroquinate dehydratase	2.44e-08	2.07e-02	NA	NA
5. P	B7LLX8	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.64e-08	2.23e-11	NA	NA
5. P	A6UX98	Tryptophan synthase alpha chain	3.94e-05	2.96e-07	NA	NA
5. P	P60583	Phosphoribosyl isomerase A	4.49e-07	3.59e-07	NA	NA
5. P	Q8Z7E0	Tryptophan synthase alpha chain	3.73e-09	3.78e-07	NA	NA
5. P	Q9UZ35	Orotidine 5'-phosphate decarboxylase	8.86e-09	3.85e-05	NA	NA
5. P	Q6HN84	Thiazole synthase	2.62e-05	5.36e-08	NA	NA
5. P	B9JFD8	Indole-3-glycerol phosphate synthase	2.57e-07	1.26e-06	NA	NA
5. P	Q0K692	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.24e-06	2.77e-06	NA	NA
5. P	B6EGV5	Thiazole synthase	2.06e-09	5.76e-08	NA	NA
5. P	Q5V138	Indole-3-glycerol phosphate synthase	1.15e-10	1.22e-10	NA	NA
5. P	Q5X4Z5	Thiazole synthase	4.73e-09	1.70e-05	NA	NA
5. P	Q3V7N3	Pyridoxine 5'-phosphate synthase	2.02e-08	9.27e-11	NA	NA
5. P	Q0B002	Tryptophan synthase alpha chain	2.62e-07	7.36e-06	NA	NA
5. P	A5VT43	Imidazole glycerol phosphate synthase subunit HisF	2.70e-10	1.17e-04	NA	NA
5. P	Q9X7C2	Imidazole glycerol phosphate synthase subunit HisF	3.01e-10	1.08e-02	NA	NA
5. P	A7MHE2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.89e-08	1.16e-06	NA	NA
5. P	Q323I8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.68e-08	3.82e-07	NA	NA
5. P	P60666	Imidazole glycerol phosphate synthase subunit HisF	3.09e-10	9.83e-04	NA	NA
5. P	P43759	Tryptophan synthase alpha chain	5.10e-09	2.06e-06	NA	NA
5. P	B1YB76	Deoxyribose-phosphate aldolase	1.32e-08	6.98e-05	NA	NA
5. P	A0LTS5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.75e-07	1.67e-10	NA	NA
5. P	A1KAT2	Indole-3-glycerol phosphate synthase	4.01e-10	7.16e-09	NA	NA
5. P	A1B387	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.28e-07	9.83e-07	NA	NA
5. P	Q2J8L2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.77e-07	8.61e-05	NA	NA
5. P	A5GES5	N-(5'-phosphoribosyl)anthranilate isomerase	8.26e-07	4.51e-02	NA	NA
5. P	Q30ZQ6	Pyridoxine 5'-phosphate synthase	1.08e-08	1.20e-07	NA	NA
5. P	Q4KKP5	Tryptophan synthase alpha chain	2.00e-06	2.95e-04	NA	NA
5. P	Q51843	Pyridoxine 5'-phosphate synthase	5.07e-08	8.71e-09	NA	NA
5. P	Q4K503	Indole-3-glycerol phosphate synthase	3.91e-10	3.93e-06	NA	NA
5. P	C0R576	Pyridoxine 5'-phosphate synthase	1.69e-08	5.63e-09	NA	NA
5. P	Q3KHL6	Pyridoxine 5'-phosphate synthase	2.93e-08	3.29e-08	NA	NA
5. P	B3GX82	Thiamine-phosphate synthase	1.13e-09	8.95e-08	NA	NA
5. P	B4UDJ9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.09e-09	5.11e-06	NA	NA
5. P	P9WFX7	Indole-3-glycerol phosphate synthase	5.55e-09	1.39e-08	NA	NA
5. P	B1WY64	Pyridoxine 5'-phosphate synthase	1.26e-08	4.14e-09	NA	NA
5. P	Q1R079	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.21e-09	8.08e-05	NA	NA
5. P	Q3AVH3	Pyridoxine 5'-phosphate synthase	1.40e-08	2.22e-08	NA	NA
5. P	B4TT28	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.88e-08	1.33e-10	NA	NA
5. P	Q8ZK87	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.95e-08	1.33e-10	NA	NA
5. P	Q2FYR3	Tryptophan synthase alpha chain	1.13e-08	6.21e-09	NA	NA
5. P	Q8KFJ5	Pyridoxine 5'-phosphate synthase	1.30e-08	1.63e-08	NA	NA
5. P	Q7W5G9	Tryptophan synthase alpha chain	3.18e-09	6.19e-06	NA	NA
5. P	Q6NEB5	Tryptophan synthase alpha chain	1.33e-09	1.24e-05	NA	NA
5. P	B0SYZ4	Indole-3-glycerol phosphate synthase	3.83e-11	2.66e-06	NA	NA
5. P	Q07UQ8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.30e-06	7.61e-04	NA	NA
5. P	Q7M9F6	Thiazole synthase	4.32e-09	2.03e-07	NA	NA
5. P	A7I6L7	Geranylgeranylglyceryl phosphate synthase	1.96e-05	5.72e-07	NA	NA
5. P	C0RFZ5	N-(5'-phosphoribosyl)anthranilate isomerase	9.57e-07	2.89e-02	NA	NA
5. P	B2FKL1	Indole-3-glycerol phosphate synthase	3.35e-10	3.36e-08	NA	NA
5. P	Q8ES84	Heptaprenylglyceryl phosphate synthase	3.37e-06	1.76e-05	NA	NA
5. P	B0RSL8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.04e-09	1.80e-04	NA	NA
5. P	A3PHK7	Indole-3-glycerol phosphate synthase	3.59e-10	9.39e-09	NA	NA
5. P	B5IEU6	Deoxyribose-phosphate aldolase	2.29e-07	1.18e-07	NA	NA
5. P	Q9HFW8	N-(5'-phosphoribosyl)anthranilate isomerase	1.74e-06	1.85e-03	NA	NA
5. P	Q63EC6	Tryptophan synthase alpha chain	1.45e-09	2.27e-08	NA	NA
5. P	Q8Y6C8	Heptaprenylglyceryl phosphate synthase	1.71e-05	4.63e-07	NA	NA
5. P	B2GGU9	Imidazole glycerol phosphate synthase subunit HisF	5.95e-08	1.78e-04	NA	NA
5. P	Q3BQ15	Thiazole synthase	2.24e-09	2.00e-09	NA	NA
5. P	Q3AQC1	N-(5'-phosphoribosyl)anthranilate isomerase	6.12e-07	2.33e-04	NA	NA
5. P	B0SRP0	Imidazole glycerol phosphate synthase subunit HisF	1.23e-10	9.00e-05	NA	NA
5. P	B2K9V8	Deoxyribose-phosphate aldolase	7.68e-10	5.72e-07	NA	NA
5. P	B7NRS3	Thiazole synthase	1.72e-09	1.21e-06	NA	NA
5. P	Q1CT27	Thiamine-phosphate synthase	6.68e-09	1.86e-05	NA	NA
5. P	Q12VH4	Geranylgeranylglyceryl phosphate synthase	5.09e-08	7.81e-08	NA	NA
5. P	B1XSZ1	Indole-3-glycerol phosphate synthase	4.79e-10	6.20e-07	NA	NA
5. P	Q7UYK5	Pyridoxine 5'-phosphate synthase	1.99e-08	2.87e-10	NA	NA
5. P	A9VWE9	Tryptophan synthase alpha chain	9.51e-05	1.97e-03	NA	NA
5. P	Q3IQA5	Deoxyribose-phosphate aldolase	3.06e-07	1.43e-04	NA	NA
5. P	Q0W6K5	Geranylgeranylglyceryl phosphate synthase	5.54e-08	6.27e-08	NA	NA
5. P	Q31U06	Thiazole synthase	1.63e-09	1.15e-06	NA	NA
5. P	B7HKD3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.89e-08	2.05e-03	NA	NA
5. P	A1WW06	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.73e-07	2.01e-05	NA	NA
5. P	B3E618	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.78e-07	2.50e-10	NA	NA
5. P	A1W0U8	Putative imidazole glycerol phosphate synthase subunit hisF2	1.21e-06	5.21e-03	NA	NA
5. P	Q8PEG8	Pyridoxine 5'-phosphate synthase	6.11e-07	1.09e-06	NA	NA
5. P	Q2YQM7	Pyridoxine 5'-phosphate synthase	7.27e-07	8.15e-08	NA	NA
5. P	Q1NZ26	Uncharacterized protein F13E9.13, mitochondrial	3.34e-06	2.89e-05	NA	NA
5. P	Q57PS8	3-dehydroquinate dehydratase	2.50e-08	3.40e-02	NA	NA
5. P	A3PI63	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.08e-07	1.50e-07	NA	NA
5. P	Q9PF95	Thiazole synthase	2.04e-09	1.30e-08	NA	NA
5. P	P9WG75	Thiamine-phosphate synthase	3.17e-09	5.01e-06	NA	NA
5. P	A5GSQ4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.67e-09	8.33e-06	NA	NA
5. P	A6UEK3	Imidazole glycerol phosphate synthase subunit HisF	2.34e-10	1.92e-05	NA	NA
5. P	Q5NMD5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.29e-07	1.83e-09	NA	NA
5. P	A6VFT8	Tryptophan synthase alpha chain	7.80e-10	6.88e-06	NA	NA
5. P	Q6A655	Deoxyribose-phosphate aldolase 2	1.83e-09	8.76e-05	NA	NA
5. P	A8FNR4	Imidazole glycerol phosphate synthase subunit HisF	1.90e-07	4.76e-03	NA	NA
5. P	Q6G480	Thiazole synthase	1.50e-06	1.42e-03	NA	NA
5. P	O14105	Ribulose-phosphate 3-epimerase	1.17e-07	4.84e-05	NA	NA
5. P	A9L4B9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.26e-09	1.26e-08	NA	NA
5. P	Q5NMD6	Imidazole glycerol phosphate synthase subunit HisF	1.98e-10	3.58e-04	NA	NA
5. P	Q04RT3	N-(5'-phosphoribosyl)anthranilate isomerase	4.49e-06	1.67e-04	NA	NA
5. P	C5CQJ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.60e-06	3.49e-04	NA	NA
5. P	A1W2Z8	Indole-3-glycerol phosphate synthase	3.05e-10	3.28e-07	NA	NA
5. P	Q133T5	Thiazole synthase	1.99e-04	1.16e-05	NA	NA
5. P	Q056S8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.74e-10	3.69e-03	NA	NA
5. P	A1UWA0	Indole-3-glycerol phosphate synthase	9.40e-11	2.00e-08	NA	NA
5. P	Q4ZPE4	Pyridoxine 5'-phosphate synthase	2.70e-08	1.54e-08	NA	NA
5. P	Q8THS6	(5-formylfuran-3-yl)methyl phosphate synthase	6.12e-09	5.38e-03	NA	NA
5. P	Q3AV87	Indole-3-glycerol phosphate synthase	6.60e-10	7.11e-05	NA	NA
5. P	A9M5F4	Indole-3-glycerol phosphate synthase	5.44e-10	2.46e-07	NA	NA
5. P	A1RJ16	Imidazole glycerol phosphate synthase subunit HisF	1.07e-07	1.18e-02	NA	NA
5. P	C4XI54	Tryptophan synthase alpha chain	4.63e-08	1.51e-09	NA	NA
5. P	Q8P7R6	N-(5'-phosphoribosyl)anthranilate isomerase	2.79e-06	2.57e-02	NA	NA
5. P	Q3T0G5	Pyridoxal phosphate homeostasis protein	8.10e-04	2.27e-02	NA	NA
5. P	Q7MP37	Deoxyribose-phosphate aldolase 1	2.06e-10	6.02e-07	NA	NA
5. P	A7Z617	N-(5'-phosphoribosyl)anthranilate isomerase	8.21e-08	2.17e-04	NA	NA
5. P	Q98ME3	Indole-3-glycerol phosphate synthase	1.15e-07	3.94e-07	NA	NA
5. P	B4S715	N-(5'-phosphoribosyl)anthranilate isomerase	8.89e-07	2.51e-02	NA	NA
5. P	O27697	Tryptophan synthase alpha chain	2.08e-05	2.07e-09	NA	NA
5. P	Q71Z41	Tryptophan synthase alpha chain	5.49e-09	3.37e-04	NA	NA
5. P	Q5JFU9	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.76e-08	8.32e-03	NA	NA
5. P	B9MBS5	Indole-3-glycerol phosphate synthase	1.73e-10	3.00e-06	NA	NA
5. P	A5G8S9	Imidazole glycerol phosphate synthase subunit HisF	1.31e-07	3.03e-02	NA	NA
5. P	P72776	Pyridoxine 5'-phosphate synthase	8.90e-09	7.43e-11	NA	NA
5. P	B7GZV4	Thiazole synthase	3.35e-09	2.37e-08	NA	NA
5. P	Q5ZVY5	N-(5'-phosphoribosyl)anthranilate isomerase	1.32e-06	3.22e-04	NA	NA
5. P	B4S4Z8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.11e-07	2.56e-04	NA	NA
5. P	B5YD09	Tryptophan synthase alpha chain	9.05e-08	1.04e-11	NA	NA
5. P	B5XT03	Tryptophan synthase alpha chain	2.68e-09	3.54e-05	NA	NA
5. P	A1VGB6	Tryptophan synthase alpha chain	3.00e-08	5.89e-08	NA	NA
5. P	Q0SRC4	Deoxyribose-phosphate aldolase	4.32e-10	1.61e-08	NA	NA
5. P	A6TM77	Tryptophan synthase alpha chain	1.56e-09	3.40e-06	NA	NA
5. P	A8Z5H3	Imidazole glycerol phosphate synthase subunit HisF	2.41e-10	2.12e-03	NA	NA
5. P	A9M642	Pyridoxine 5'-phosphate synthase	9.18e-07	1.07e-07	NA	NA
5. P	Q12WC6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.21e-10	4.50e-06	NA	NA
5. P	B1VH88	Imidazole glycerol phosphate synthase subunit HisF	1.94e-10	5.48e-04	NA	NA
5. P	Q9UZN7	Geranylgeranylglyceryl phosphate synthase	1.86e-10	1.67e-07	NA	NA
5. P	A1BEZ1	N-(5'-phosphoribosyl)anthranilate isomerase	7.84e-07	1.35e-02	NA	NA
5. P	C1D7J7	Indole-3-glycerol phosphate synthase	2.28e-11	6.56e-09	NA	NA
5. P	B1ILB0	Imidazole glycerol phosphate synthase subunit HisF	2.78e-10	9.02e-03	NA	NA
5. P	A1KVH8	Pyridoxine 5'-phosphate synthase	1.62e-08	4.40e-07	NA	NA
5. P	C4L415	Deoxyribose-phosphate aldolase	5.85e-10	2.66e-06	NA	NA
5. P	B8I5V5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.91e-08	2.68e-03	NA	NA
5. P	Q8Z5J7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.64e-08	2.51e-06	NA	NA
5. P	Q46CW8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.92e-10	1.24e-02	NA	NA
5. P	Q24QJ5	Imidazole glycerol phosphate synthase subunit HisF	2.41e-07	8.19e-03	NA	NA
5. P	Q2FIJ1	3-dehydroquinate dehydratase	9.02e-07	1.41e-02	NA	NA
5. P	Q9JYT0	3-dehydroquinate dehydratase	3.93e-08	3.90e-02	NA	NA
5. P	A5IFW5	Pyridoxine 5'-phosphate synthase	2.88e-08	2.78e-08	NA	NA
5. P	Q7V9K9	Thiazole synthase	8.74e-05	1.85e-07	NA	NA
5. P	Q4ZLQ1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.05e-06	2.77e-06	NA	NA
5. P	Q88R42	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.41e-09	8.22e-05	NA	NA
5. P	Q62DD0	Indole-3-glycerol phosphate synthase	9.62e-11	2.00e-08	NA	NA
5. P	B7HWF4	Thiazole synthase	1.71e-05	1.60e-06	NA	NA
5. P	Q7UG70	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.75e-10	4.67e-07	NA	NA
5. P	B7V3N4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	8.82e-09	7.79e-05	NA	NA
5. P	O94903	Pyridoxal phosphate homeostasis protein	9.26e-04	4.15e-02	NA	NA
5. P	A5N6W8	3-dehydroquinate dehydratase	3.29e-08	9.46e-03	NA	NA
5. P	A6TM74	Indole-3-glycerol phosphate synthase	4.86e-11	2.47e-10	NA	NA
5. P	A6VPG9	Thiamine-phosphate synthase	5.98e-07	1.89e-08	NA	NA
5. P	B0K8T5	N-(5'-phosphoribosyl)anthranilate isomerase	6.67e-07	1.78e-03	NA	NA
5. P	P9WP02	Deoxyribose-phosphate aldolase	1.00e-10	8.95e-03	NA	NA
5. P	Q7TUA7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.90e-07	3.49e-03	NA	NA
5. P	P9WMM5	Phosphoribosyl isomerase A	6.48e-07	1.01e-06	NA	NA
5. P	B4TQK0	Thiazole synthase	1.80e-09	4.77e-06	NA	NA
5. P	Q8PD70	Indole-3-glycerol phosphate synthase	2.83e-10	4.94e-09	NA	NA
5. P	Q8DVF5	Indole-3-glycerol phosphate synthase	1.79e-08	1.73e-09	NA	NA
5. P	A4SFW2	Thiazole synthase	1.25e-09	2.61e-04	NA	NA
5. P	B1HTW4	Heptaprenylglyceryl phosphate synthase	1.12e-05	2.76e-09	NA	NA
5. P	Q8D304	Pyridoxine 5'-phosphate synthase	9.77e-09	3.08e-09	NA	NA
5. P	C1D7L7	Pyridoxine 5'-phosphate synthase	1.71e-08	8.93e-10	NA	NA
5. P	Q97AR4	Geranylgeranylglyceryl phosphate synthase	2.82e-10	2.81e-10	NA	NA
5. P	B1MX63	Thiamine-phosphate synthase	3.18e-07	5.36e-05	NA	NA
5. P	P60582	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.31e-06	5.93e-05	NA	NA
5. P	Q4JAS3	Geranylgeranylglyceryl phosphate synthase	6.56e-07	5.05e-09	NA	NA
5. P	B9E150	N-(5'-phosphoribosyl)anthranilate isomerase	1.41e-06	1.88e-02	NA	NA
5. P	C3MCF2	Indole-3-glycerol phosphate synthase	1.21e-07	3.40e-06	NA	NA
5. P	Q1IX18	Thiazole synthase	4.09e-09	9.42e-05	NA	NA
5. P	Q10184	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.18e-07	7.18e-05	NA	NA
5. P	Q8YLL0	N-(5'-phosphoribosyl)anthranilate isomerase	1.25e-07	9.09e-03	NA	NA
5. P	Q3Z0G0	Imidazole glycerol phosphate synthase subunit HisF	1.36e-07	4.48e-02	NA	NA
5. P	Q1BEL9	Thiamine-phosphate synthase	2.48e-09	1.34e-07	NA	NA
5. P	Q5H704	Pyridoxine 5'-phosphate synthase	5.82e-07	1.15e-07	NA	NA
5. P	A8AG60	Tryptophan synthase alpha chain	2.87e-09	2.74e-06	NA	NA
5. P	A5IC64	Thiazole synthase	3.76e-06	2.13e-04	NA	NA
5. P	A7Z962	Imidazole glycerol phosphate synthase subunit HisF	1.27e-07	6.23e-03	NA	NA
5. P	Q6A8L1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.28e-07	1.29e-04	NA	NA
5. P	Q0SSM0	Thiazole synthase	1.93e-09	5.27e-09	NA	NA
5. P	B2J2G1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.27e-07	1.08e-03	NA	NA
5. P	Q7VQZ9	Tryptophan synthase alpha chain	6.55e-07	8.84e-05	NA	NA
5. P	A2C897	Pyridoxine 5'-phosphate synthase	1.90e-08	1.27e-10	NA	NA
5. P	Q47HQ4	Tryptophan synthase alpha chain	6.80e-09	9.72e-08	NA	NA
5. P	Q9PIF1	Tryptophan synthase alpha chain	3.82e-06	5.03e-08	NA	NA
5. P	Q6FL81	Ribulose-phosphate 3-epimerase	1.33e-05	2.22e-02	NA	NA
5. P	A4FY92	(5-formylfuran-3-yl)methyl phosphate synthase	1.20e-09	1.69e-02	NA	NA
5. P	B1ZLY7	Tryptophan synthase alpha chain	1.01e-04	4.04e-04	NA	NA
5. P	Q1C1U5	Thiazole synthase	5.10e-09	2.40e-03	NA	NA
5. P	B2SUX4	Pyridoxine 5'-phosphate synthase	5.14e-07	1.15e-07	NA	NA
5. P	A0PRY2	Thiamine-phosphate synthase	2.66e-09	4.33e-06	NA	NA
5. P	Q2JP46	Pyridoxine 5'-phosphate synthase	1.02e-08	1.03e-11	NA	NA
5. P	A8ZUC6	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.74e-07	7.57e-08	NA	NA
5. P	Q7VGZ1	Imidazole glycerol phosphate synthase subunit HisF	3.09e-07	3.64e-04	NA	NA
5. P	Q87JW8	Thiamine-phosphate synthase	1.64e-10	1.59e-05	NA	NA
5. P	B7J5U0	Thiazole synthase	1.26e-09	2.59e-07	NA	NA
5. P	B7IBD1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.38e-09	1.54e-05	NA	NA
5. P	Q6G0A2	Thiazole synthase	1.89e-06	2.44e-03	NA	NA
5. P	C0RGR3	Thiazole synthase	2.98e-06	3.38e-07	NA	NA
5. P	Q1MNC1	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.60e-09	1.16e-04	NA	NA
5. P	P51382	Tryptophan synthase alpha chain	8.19e-07	3.57e-05	NA	NA
5. P	B0TDM7	Imidazole glycerol phosphate synthase subunit HisF	1.52e-07	2.25e-02	NA	NA
5. P	A7H5C4	Triosephosphate isomerase	2.30e-04	3.12e-02	NA	NA
5. P	Q3B287	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.12e-09	1.16e-02	NA	NA
5. P	C1CMD5	Indole-3-glycerol phosphate synthase	1.66e-08	1.50e-09	NA	NA
5. P	A7X763	Imidazole glycerol phosphate synthase subunit HisF	4.37e-10	1.63e-03	NA	NA
5. P	Q3BZR9	Pyridoxine 5'-phosphate synthase	8.08e-07	1.34e-07	NA	NA
5. P	Q1LT72	Imidazole glycerol phosphate synthase subunit HisF	1.56e-10	2.16e-03	NA	NA
5. P	A5I246	Imidazole glycerol phosphate synthase subunit HisF	2.86e-10	1.19e-02	NA	NA
5. P	A7IGG9	Thiamine-phosphate synthase	5.86e-09	2.86e-05	NA	NA
5. P	Q8AAD6	Indole-3-glycerol phosphate synthase	3.11e-10	2.64e-09	NA	NA
5. P	Q9PI11	Indole-3-glycerol phosphate synthase	1.10e-11	4.91e-06	NA	NA
5. P	Q0SHY5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.67e-07	1.25e-06	NA	NA
5. P	Q0IC57	Indole-3-glycerol phosphate synthase	6.58e-10	2.97e-06	NA	NA
5. P	Q6A8F1	Deoxyribose-phosphate aldolase 1	4.15e-10	3.64e-06	NA	NA
5. P	A1AN65	Tryptophan synthase alpha chain	2.44e-09	1.83e-05	NA	NA
5. P	Q3ANJ9	Thiazole synthase	9.79e-05	8.30e-05	NA	NA
5. P	Q2RNS6	N-(5'-phosphoribosyl)anthranilate isomerase	4.06e-07	1.43e-04	NA	NA
5. P	B0T798	Imidazole glycerol phosphate synthase subunit HisF	2.36e-07	2.05e-03	NA	NA
5. P	A4SDF7	Pyridoxine 5'-phosphate synthase	1.40e-08	6.08e-09	NA	NA
5. P	A8LGR0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.28e-07	2.49e-05	NA	NA
5. P	A0PYE7	3-dehydroquinate dehydratase	1.97e-08	1.64e-02	NA	NA
5. P	Q3Z6G1	Tryptophan synthase alpha chain	4.13e-10	5.59e-08	NA	NA
5. P	A9HWC3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.76e-09	1.05e-06	NA	NA
5. P	A7X240	Tryptophan synthase alpha chain	1.47e-08	4.14e-09	NA	NA
5. P	A1S6Z6	Imidazole glycerol phosphate synthase subunit HisF	2.67e-07	1.90e-03	NA	NA
5. P	Q6GH32	Tryptophan synthase alpha chain	1.06e-08	2.02e-08	NA	NA
5. P	O30724	Imidazole glycerol phosphate synthase subunit HisF	2.87e-10	9.61e-06	NA	NA
5. P	Q87QK7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	3.85e-08	3.15e-09	NA	NA
5. P	Q877I0	Deoxyribose-phosphate aldolase	4.03e-07	3.01e-09	NA	NA
5. P	B0JTM2	Indole-3-glycerol phosphate synthase	6.43e-10	8.08e-05	NA	NA
5. P	Q38X22	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	2.25e-07	2.38e-02	NA	NA
5. P	B0VRF8	Tryptophan synthase alpha chain	4.55e-09	1.47e-05	NA	NA
5. P	Q5PH79	3-dehydroquinate dehydratase	3.33e-08	1.26e-03	NA	NA
5. P	B5F1H3	Thiazole synthase	1.49e-09	6.56e-06	NA	NA
5. P	Q3A2C7	Tryptophan synthase alpha chain	7.76e-10	9.51e-05	NA	NA
5. P	A5UGT0	Thiamine-phosphate synthase	5.79e-07	9.62e-08	NA	NA
5. P	B1JED2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.01e-08	4.29e-06	NA	NA
5. P	B7NVN0	Tryptophan synthase alpha chain	2.82e-09	7.57e-06	NA	NA
5. P	P16250	Phosphoribosyl isomerase A	3.94e-07	1.07e-08	NA	NA
5. P	B6J5W6	Thiazole synthase	4.80e-06	6.26e-05	NA	NA
5. P	Q2YWJ9	3-dehydroquinate dehydratase	3.81e-07	2.10e-02	NA	NA
5. P	A1W1K3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.52e-06	6.88e-06	NA	NA
5. P	Q74J28	Orotidine 5'-phosphate decarboxylase	7.06e-08	2.38e-02	NA	NA
5. P	A4FXH7	Tryptophan synthase alpha chain	9.43e-10	6.26e-05	NA	NA
5. P	Q1RBA3	3-dehydroquinate dehydratase	2.54e-08	5.82e-04	NA	NA
5. P	Q11VM2	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.66e-07	1.93e-09	NA	NA
5. P	Q9V1G9	Tryptophan synthase alpha chain	8.56e-10	1.97e-06	NA	NA
5. P	A7H2E1	Pyridoxine 5'-phosphate synthase	3.71e-08	4.63e-05	NA	NA
5. P	A6VDQ9	Imidazole glycerol phosphate synthase subunit HisF	2.86e-10	2.04e-04	NA	NA
5. P	Q72U04	Tryptophan synthase alpha chain	1.19e-06	2.82e-06	NA	NA
5. P	Q89ZF2	Deoxyribose-phosphate aldolase	9.80e-10	2.70e-09	NA	NA
5. P	Q0C639	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.52e-07	9.23e-08	NA	NA
5. P	Q74AI3	Tryptophan synthase alpha chain	2.63e-09	1.60e-09	NA	NA
5. P	A5UC41	Tryptophan synthase alpha chain	5.79e-09	1.60e-06	NA	NA
5. P	C6E1P3	Tryptophan synthase alpha chain	9.69e-10	6.67e-05	NA	NA
5. P	Q3KJI5	Imidazole glycerol phosphate synthase subunit HisF	3.12e-10	1.95e-04	NA	NA
5. P	A1BGM7	Thiamine-phosphate synthase	1.82e-10	1.39e-04	NA	NA
5. P	Q0THD6	3-dehydroquinate dehydratase	2.39e-08	4.12e-04	NA	NA
5. P	A4J147	Indole-3-glycerol phosphate synthase	7.60e-11	1.97e-10	NA	NA
5. P	Q82SJ7	Pyridoxine 5'-phosphate synthase	1.96e-08	7.89e-10	NA	NA
5. P	Q5V140	Tryptophan synthase alpha chain	5.42e-09	5.22e-07	NA	NA
5. P	Q48A93	Thiazole synthase	4.10e-05	6.97e-03	NA	NA
5. P	Q2FWG3	Thiamine-phosphate synthase	3.73e-06	5.48e-04	NA	NA
5. P	A6UR05	Imidazole glycerol phosphate synthase subunit HisF	2.84e-09	1.91e-02	NA	NA
5. P	Q8G691	Tryptophan synthase alpha chain	1.98e-07	1.31e-05	NA	NA
5. P	Q66C53	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.04e-08	2.71e-05	NA	NA
5. P	B1YL09	Imidazole glycerol phosphate synthase subunit HisF	2.18e-10	2.20e-04	NA	NA
5. P	B7V3N3	Imidazole glycerol phosphate synthase subunit HisF	2.94e-10	3.71e-04	NA	NA
5. P	Q3B2C7	Indole-3-glycerol phosphate synthase	2.24e-11	3.24e-06	NA	NA
5. P	Q8U092	N-(5'-phosphoribosyl)anthranilate isomerase	1.19e-07	9.03e-04	NA	NA
5. P	Q58636	Uncharacterized protein MJ1239	6.79e-04	3.63e-03	NA	NA
5. P	Q8PT96	Tryptophan synthase alpha chain	1.88e-09	1.40e-07	NA	NA
5. P	Q57AF2	Tryptophan synthase alpha chain	1.65e-08	2.19e-04	NA	NA
5. P	C4KZ66	Indole-3-glycerol phosphate synthase	2.27e-11	2.99e-12	NA	NA
5. P	B2RH32	Thiazole synthase	2.28e-06	6.52e-07	NA	NA
5. P	B8IPH4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.02e-06	1.43e-08	NA	NA
5. P	Q6L277	Indole-3-glycerol phosphate synthase	7.68e-06	2.98e-04	NA	NA
5. P	C5D4T6	Deoxyribose-phosphate aldolase	8.98e-10	1.29e-08	NA	NA
5. P	B4RJN4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.21e-06	5.22e-07	NA	NA
5. P	A9WR62	Imidazole glycerol phosphate synthase subunit HisF	1.70e-07	2.24e-04	NA	NA
5. P	Q49Z84	Deoxyribose-phosphate aldolase	1.04e-09	2.39e-07	NA	NA
5. P	Q48C81	Imidazole glycerol phosphate synthase subunit HisF	3.87e-10	3.19e-04	NA	NA
5. P	Q82WM5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.38e-07	6.13e-06	NA	NA
5. P	B6I5K1	Thiazole synthase	1.72e-09	2.17e-06	NA	NA
5. P	Q0KF31	Thiazole synthase	9.29e-06	6.75e-06	NA	NA
5. P	Q8ZV18	N-(5'-phosphoribosyl)anthranilate isomerase	3.89e-07	6.86e-04	NA	NA
5. P	Q63GS5	Heptaprenylglyceryl phosphate synthase	7.77e-06	7.89e-10	NA	NA
5. P	A9A8I8	Pyridoxal 5'-phosphate synthase subunit PdxS	1.79e-06	3.48e-02	NA	NA
5. P	Q6AAE4	Thiazole synthase	9.85e-09	1.49e-03	NA	NA
5. P	Q3AL94	Indole-3-glycerol phosphate synthase	7.15e-10	2.20e-05	NA	NA
5. P	Q7VHV1	Pyridoxine 5'-phosphate synthase	1.12e-07	1.40e-07	NA	NA
5. P	Q3JCB7	Tryptophan synthase alpha chain	7.96e-07	2.26e-04	NA	NA
5. P	Q8Y9G4	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.89e-08	4.98e-04	NA	NA
5. P	P82134	Pyridoxal 5'-phosphate synthase subunit PdxS	2.00e-08	4.01e-03	NA	NA
5. P	Q81GG4	Tryptophan synthase alpha chain	1.31e-09	5.72e-07	NA	NA
5. P	Q1MND5	Tryptophan synthase alpha chain	2.89e-08	1.29e-02	NA	NA
5. P	Q1IH21	Tryptophan synthase alpha chain	4.57e-05	1.35e-04	NA	NA
5. P	A8G9H6	Deoxyribose-phosphate aldolase	4.53e-09	2.46e-02	NA	NA
5. P	A4FZ85	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.08e-10	3.21e-06	NA	NA
5. P	Q1BM66	Tryptophan synthase alpha chain	1.02e-08	4.54e-05	NA	NA
5. P	Q4FUV3	Pyridoxine 5'-phosphate synthase	2.91e-08	2.36e-10	NA	NA
5. P	A6USK6	(5-formylfuran-3-yl)methyl phosphate synthase	1.20e-09	2.24e-02	NA	NA
5. P	Q81G02	Imidazole glycerol phosphate synthase subunit HisF	2.29e-10	5.29e-03	NA	NA
5. P	Q8YE37	Imidazole glycerol phosphate synthase subunit HisF	3.32e-10	9.59e-05	NA	NA
5. P	P30139	Thiazole synthase	1.56e-09	3.71e-06	NA	NA
5. P	Q0AF72	Pyridoxine 5'-phosphate synthase	2.27e-08	5.45e-09	NA	NA
5. P	Q5HRH7	3-hexulose-6-phosphate synthase	2.01e-09	2.22e-08	NA	NA
5. P	A7GDQ5	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.86e-08	1.91e-04	NA	NA
5. P	A3P7M8	Tryptophan synthase alpha chain	9.46e-09	1.78e-06	NA	NA
5. P	Q1I5W1	Pyridoxine 5'-phosphate synthase	2.72e-08	6.59e-10	NA	NA
5. P	Q6AE15	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.70e-07	1.79e-09	NA	NA
5. P	B1LP17	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.57e-08	4.36e-07	NA	NA
5. P	Q3JNB0	Indole-3-glycerol phosphate synthase	9.30e-11	1.17e-08	NA	NA
5. P	B4STS6	Thiazole synthase	2.36e-09	1.24e-09	NA	NA
5. P	Q2JRV8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.08e-07	8.33e-06	NA	NA
5. P	C3K307	Indole-3-glycerol phosphate synthase	2.81e-10	2.13e-06	NA	NA
5. P	Q9A229	Imidazole glycerol phosphate synthase subunit HisF	1.26e-07	5.93e-03	NA	NA
5. P	B2S983	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.02e-06	1.80e-04	NA	NA
5. P	Q81TL9	N-(5'-phosphoribosyl)anthranilate isomerase	2.24e-06	4.08e-02	NA	NA
5. P	Q1XDA5	Tryptophan synthase alpha chain	2.98e-07	7.98e-10	NA	NA
5. P	C1DH67	Tryptophan synthase alpha chain	3.96e-05	1.71e-05	NA	NA
5. P	A8MDA4	Geranylgeranylglyceryl phosphate synthase	1.24e-07	2.07e-07	NA	NA
5. P	Q1IGD3	Thiazole synthase	2.75e-09	5.07e-07	NA	NA
5. P	Q58515	Uncharacterized protein MJ1115	2.72e-09	1.63e-05	NA	NA
5. P	B7HKD4	Imidazole glycerol phosphate synthase subunit HisF	2.25e-10	4.25e-03	NA	NA
5. P	Q49WT0	3-hexulose-6-phosphate synthase 2	2.15e-09	1.43e-06	NA	NA
5. P	O34727	Imidazole glycerol phosphate synthase subunit HisF	1.27e-07	5.98e-03	NA	NA
5. P	A1KFV2	Deoxyribose-phosphate aldolase	1.33e-10	8.95e-03	NA	NA
5. P	C6A2A3	Geranylgeranylglyceryl phosphate synthase	1.43e-10	2.37e-08	NA	NA
5. P	B0C390	Thiazole synthase	1.59e-08	4.25e-08	NA	NA
5. P	C1DHY7	Indole-3-glycerol phosphate synthase	1.69e-10	1.16e-07	NA	NA
5. P	B2I5X7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	6.12e-07	3.84e-04	NA	NA
5. P	B0KF94	N-(5'-phosphoribosyl)anthranilate isomerase	7.84e-07	4.35e-03	NA	NA
5. P	Q4UXY4	Thiazole synthase	2.40e-09	2.31e-09	NA	NA
5. P	A0B9D8	N-(5'-phosphoribosyl)anthranilate isomerase	3.26e-09	3.43e-03	NA	NA
5. P	O67657	Indole-3-glycerol phosphate synthase	2.01e-11	4.16e-08	NA	NA
5. P	Q65MR4	Heptaprenylglyceryl phosphate synthase	9.57e-06	1.76e-08	NA	NA
5. P	Q46Z21	Pyridoxine 5'-phosphate synthase	5.68e-08	2.11e-08	NA	NA
5. P	P58799	Imidazole glycerol phosphate synthase subunit HisF	3.90e-10	1.47e-05	NA	NA
5. P	B9KPC8	Imidazole glycerol phosphate synthase subunit HisF	3.01e-10	6.55e-05	NA	NA
5. P	Q8G2U9	Thiazole synthase	3.24e-06	2.37e-08	NA	NA
5. P	P11081	Tryptophan synthase alpha chain	2.31e-06	1.04e-03	NA	NA
5. P	Q1LS25	Thiazole synthase	1.15e-05	1.18e-05	NA	NA
5. P	A9EXF3	Thiazole synthase	5.53e-09	9.14e-10	NA	NA
5. P	Q5KXU9	Indole-3-glycerol phosphate synthase	4.06e-08	5.88e-10	NA	NA
5. P	A1AR94	Pyridoxine 5'-phosphate synthase	1.39e-08	2.98e-09	NA	NA
5. P	Q3ZZ10	Tryptophan synthase alpha chain	5.97e-10	5.59e-08	NA	NA
5. P	A0KPE4	Deoxyribose-phosphate aldolase	3.48e-09	1.14e-02	NA	NA
5. P	A8ZVC5	Pyridoxine 5'-phosphate synthase	2.77e-08	3.81e-11	NA	NA
5. P	Q8DU34	Deoxyribose-phosphate aldolase	8.90e-10	1.99e-07	NA	NA
5. P	O69158	Pyridoxine 5'-phosphate synthase	1.41e-08	1.28e-09	NA	NA
5. P	Q5LYI5	Indole-3-glycerol phosphate synthase	2.06e-08	2.08e-10	NA	NA
5. P	B2J1L6	N-(5'-phosphoribosyl)anthranilate isomerase	9.80e-08	4.42e-03	NA	NA
5. P	Q8TS37	Orotidine 5'-phosphate decarboxylase	3.04e-09	6.63e-04	NA	NA
5. P	Q9Y8T3	Tryptophan synthase alpha chain	5.29e-10	1.00e-06	NA	NA
5. P	Q5YYP3	Imidazole glycerol phosphate synthase subunit HisF	2.65e-10	1.21e-02	NA	NA
5. P	Q161I8	Tryptophan synthase alpha chain	8.76e-09	2.17e-08	NA	NA
5. P	Q9HU44	Imidazole glycerol phosphate synthase subunit hisF1	2.87e-10	3.71e-04	NA	NA
5. P	B0VBS1	Indole-3-glycerol phosphate synthase	7.86e-10	2.13e-07	NA	NA
5. P	Q2RGW2	Imidazole glycerol phosphate synthase subunit HisF	8.66e-08	3.07e-02	NA	NA
5. P	Q3V812	Pyridoxine 5'-phosphate synthase	1.15e-08	1.31e-08	NA	NA
5. P	P9WI50	Ribulose-phosphate 3-epimerase	1.98e-08	2.15e-02	NA	NA
5. P	Q65I33	Indole-3-glycerol phosphate synthase	1.86e-10	1.39e-11	NA	NA
5. P	B0SMR9	Thiamine-phosphate synthase	1.55e-08	7.94e-06	NA	NA
5. P	B2USY5	Thiamine-phosphate synthase	6.81e-09	1.65e-05	NA	NA
5. P	B9M7D5	Tryptophan synthase alpha chain	1.09e-09	7.65e-05	NA	NA
5. P	A4SDQ2	Tryptophan synthase alpha chain	1.86e-06	1.65e-07	NA	NA
5. P	B2I0N7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.74e-09	1.54e-05	NA	NA
5. P	Q979V9	Indole-3-glycerol phosphate synthase	1.67e-05	1.29e-04	NA	NA
5. P	A7IHP0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.20e-06	1.80e-04	NA	NA
5. P	Q8DGP3	N-(5'-phosphoribosyl)anthranilate isomerase	3.46e-07	3.77e-04	NA	NA
5. P	A7N137	Thiazole synthase	2.02e-09	2.20e-05	NA	NA
5. P	Q9V2I6	Fructose-bisphosphate aldolase class 1	1.34e-09	2.57e-02	NA	NA
5. P	C5A366	Deoxyribose-phosphate aldolase	1.79e-09	9.60e-09	NA	NA
5. P	A1RRN9	Geranylgeranylglyceryl phosphate synthase	1.03e-07	3.05e-05	NA	NA
5. P	Q9ZL01	Thiamine-phosphate synthase	2.10e-06	7.29e-06	NA	NA
5. P	B3EH68	Thiazole synthase	1.31e-09	1.65e-03	NA	NA
5. P	Q5QX79	Tryptophan synthase alpha chain	1.96e-09	4.82e-07	NA	NA
5. P	Q87AX6	Thiamine-phosphate synthase	1.19e-06	5.71e-05	NA	NA
5. P	P00911	Indole-3-glycerol phosphate synthase	1.18e-09	5.59e-08	NA	NA
5. P	P42405	3-hexulose-6-phosphate synthase	6.82e-07	2.66e-08	NA	NA
5. P	Q6G601	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	2.32e-09	5.64e-08	NA	NA
5. P	C5CKE4	Indole-3-glycerol phosphate synthase	3.64e-10	1.22e-06	NA	NA
5. P	B7L5P5	3-dehydroquinate dehydratase	2.29e-08	9.26e-04	NA	NA
5. P	B2S9A6	N-(5'-phosphoribosyl)anthranilate isomerase	1.15e-06	2.89e-02	NA	NA
5. P	P0DA63	Deoxyribose-phosphate aldolase	4.35e-08	1.22e-06	NA	NA
5. P	A9M7F3	Thiazole synthase	3.18e-06	2.37e-08	NA	NA
5. P	B2U0F1	Tryptophan synthase alpha chain	2.88e-09	5.46e-06	NA	NA
5. P	Q5SKG7	Thiazole synthase	2.23e-08	2.61e-04	NA	NA
5. P	B7M738	Thiazole synthase	1.53e-09	1.99e-06	NA	NA
5. P	O33774	Imidazole glycerol phosphate synthase subunit HisF	2.47e-10	1.39e-02	NA	NA
5. P	C0Q2S2	Thiazole synthase	1.62e-09	9.08e-06	NA	NA
5. P	B0V529	Tryptophan synthase alpha chain	3.32e-09	1.47e-05	NA	NA
5. P	B4U872	Pyridoxine 5'-phosphate synthase	1.10e-08	1.34e-09	NA	NA
5. P	Q1R080	Imidazole glycerol phosphate synthase subunit HisF	2.89e-10	2.65e-03	NA	NA
5. P	A6VFU0	N-(5'-phosphoribosyl)anthranilate isomerase	1.43e-07	2.07e-02	NA	NA
5. P	Q1LU41	Thiazole synthase	1.94e-09	3.46e-03	NA	NA
5. P	A9WFI5	Tryptophan synthase alpha chain	1.20e-08	2.23e-06	NA	NA
5. P	B1ITJ5	Tryptophan synthase alpha chain	2.91e-09	5.90e-06	NA	NA
5. P	Q1QY43	N-(5'-phosphoribosyl)anthranilate isomerase	1.46e-06	7.93e-03	NA	NA
5. P	Q0HJ99	Imidazole glycerol phosphate synthase subunit HisF	1.07e-07	1.33e-03	NA	NA
5. P	A8LHX7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.97e-09	4.25e-06	NA	NA
5. P	B6I896	Imidazole glycerol phosphate synthase subunit HisF	2.41e-07	4.48e-02	NA	NA
5. P	A0JUZ7	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	5.96e-07	3.40e-08	NA	NA
5. P	C1ANM5	Phosphoribosyl isomerase A	6.57e-07	3.11e-07	NA	NA
5. P	B3EGF7	Tryptophan synthase alpha chain	2.24e-06	1.40e-07	NA	NA
5. P	P75293	Probable 3-keto-L-gulonate-6-phosphate decarboxylase	2.19e-08	4.87e-08	NA	NA
5. P	Q89WE6	N-(5'-phosphoribosyl)anthranilate isomerase	2.43e-07	1.55e-02	NA	NA
5. P	P37678	3-keto-L-gulonate-6-phosphate decarboxylase SgbH	2.52e-08	1.29e-07	NA	NA
5. P	Q4FMP0	Thiazole synthase	1.51e-09	2.80e-11	NA	NA
5. P	B0CJ70	Thiazole synthase	5.04e-09	1.01e-06	NA	NA
5. P	P0AG07	Ribulose-phosphate 3-epimerase	1.52e-08	7.38e-05	NA	NA
5. P	A7Z3F8	Thiazole synthase	1.93e-09	2.04e-06	NA	NA
5. P	Q65I36	Tryptophan synthase alpha chain	1.47e-09	3.82e-06	NA	NA
5. P	Q136D2	Indole-3-glycerol phosphate synthase	7.26e-08	5.33e-09	NA	NA
5. P	Q6G602	Imidazole glycerol phosphate synthase subunit HisF	2.34e-10	2.12e-03	NA	NA
5. P	Q979G6	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	4.53e-06	1.77e-02	NA	NA
5. P	Q7VD15	Tryptophan synthase alpha chain	2.36e-09	1.41e-06	NA	NA
5. P	B1WT19	N-(5'-phosphoribosyl)anthranilate isomerase	3.43e-07	2.72e-02	NA	NA
5. P	Q73T20	Thiazole synthase	3.34e-09	3.05e-07	NA	NA
5. P	Q0RFX9	Indole-3-glycerol phosphate synthase	1.39e-11	6.20e-08	NA	NA
5. P	B3Q951	Imidazole glycerol phosphate synthase subunit HisF	2.00e-10	4.53e-04	NA	NA
5. P	B0R2Z3	Geranylgeranylglyceryl phosphate synthase	1.77e-05	3.11e-05	NA	NA
5. P	C5CJH0	Thiazole synthase	3.80e-05	1.73e-06	NA	NA
5. P	A3DDS6	N-(5'-phosphoribosyl)anthranilate isomerase	1.48e-07	6.40e-04	NA	NA
5. P	Q3J6Q1	Imidazole glycerol phosphate synthase subunit HisF	3.70e-10	2.82e-04	NA	NA
5. P	Q9UZT4	Uncharacterized protein PYRAB10620	6.66e-10	3.24e-03	NA	NA
5. P	B8FUK9	Deoxyribose-phosphate aldolase	2.53e-09	5.41e-06	NA	NA
5. P	Q32CV7	Pyridoxine 5'-phosphate synthase	1.26e-08	1.94e-11	NA	NA
5. P	A8Z6K1	Indole-3-glycerol phosphate synthase	1.30e-11	1.83e-06	NA	NA
5. P	Q2VYJ0	Imidazole glycerol phosphate synthase subunit HisF	2.02e-10	1.36e-05	NA	NA
5. P	B1J4E3	Pyridoxine 5'-phosphate synthase	2.93e-08	7.40e-09	NA	NA
5. P	B9LKB2	Tryptophan synthase alpha chain	9.59e-09	2.23e-06	NA	NA
5. P	A9AAU6	Tryptophan synthase alpha chain	9.56e-10	2.35e-05	NA	NA
5. P	Q8UCA5	Copper homeostasis protein CutC	1.18e-07	1.46e-03	NA	NA
5. P	Q21VL5	Thiamine-phosphate synthase	4.93e-10	2.18e-07	NA	NA
5. P	A3D5B0	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	4.88e-09	2.13e-08	NA	NA
5. P	B1J2G8	Thiazole synthase	2.16e-09	4.72e-08	NA	NA
5. P	Q12FC8	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	1.64e-06	1.34e-04	NA	NA
5. P	B2ICL3	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	7.98e-09	8.33e-06	NA	NA
5. P	C5CBK1	Imidazole glycerol phosphate synthase subunit HisF	6.44e-08	3.54e-03	NA	NA
5. P	B5FS97	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	2.94e-08	1.33e-10	NA	NA
6. F	A6U025	Probable nitronate monooxygenase	4.27e-08	NA	NA	0.5995
6. F	A6VQ74	Imidazole glycerol phosphate synthase subunit HisF	1.23e-07	NA	NA	0.6426
6. F	Q5PDN6	Imidazole glycerol phosphate synthase subunit HisF	1.35e-07	NA	NA	0.6467
6. F	O48881	Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic	1.97e-04	NA	NA	0.6096
6. F	Q5HRP0	Dihydropteroate synthase	3.06e-05	NA	NA	0.5249
6. F	O34294	Thiamine-phosphate synthase	5.24e-09	NA	NA	0.6069
6. F	Q66FP6	Thiamine-phosphate synthase	1.28e-08	NA	NA	0.5576
6. F	Q8CMT7	Dihydropteroate synthase	3.17e-05	NA	NA	0.5252
6. F	P29251	Folic acid synthesis protein fol1	1.70e-01	NA	NA	0.3137
6. F	A4W5B6	Thiamine-phosphate synthase	6.34e-09	NA	NA	0.5785
6. F	P43776	Dihydropteroate synthase	1.78e-05	NA	NA	0.5735
6. F	Q0TFZ6	D-tagatose-1,6-bisphosphate aldolase subunit GatY	2.77e-08	NA	NA	0.5557
6. F	Q9I4V0	NADH:quinone reductase	7.83e-09	NA	NA	0.632
6. F	Q67T51	Thiamine biosynthesis bifunctional protein ThiM/ThiE	2.52e-06	NA	NA	0.6184
6. F	B6I5K4	Thiamine-phosphate synthase	2.51e-06	NA	NA	0.594
6. F	Q9RPV0	4-hydroxy-2-oxo-heptane-1,7-dioate aldolase	1.41e-06	NA	NA	0.6156
6. F	C4KGW9	Homocitrate synthase	2.91e-07	NA	NA	0.6046
6. F	P0DB08	Dihydropteroate synthase	1.14e-05	NA	NA	0.5346
6. F	A5GMH7	Thiamine-phosphate synthase	2.52e-06	NA	NA	0.6162
6. F	P57366	Tryptophan biosynthesis protein TrpCF	1.08e-07	NA	NA	0.5943
6. F	A8M4E6	Thiamine-phosphate synthase	1.32e-08	NA	NA	0.6178
6. F	P9WNC8	Inactive dihydropteroate synthase 2	4.60e-05	NA	NA	0.2977
6. F	Q57H62	Thiamine-phosphate synthase	8.19e-09	NA	NA	0.595
6. F	B5FHY2	5-keto-4-deoxy-D-glucarate aldolase	1.83e-06	NA	NA	0.586
6. F	P61422	Thiamine biosynthesis bifunctional protein ThiED	1.64e-06	NA	NA	0.5768
6. F	Q2W3R9	Thiazole synthase	5.16e-08	NA	NA	0.5323
6. F	O25909	Probable nicotinate-nucleotide pyrophosphorylase [carboxylating]	4.53e-05	NA	NA	0.425
6. F	Q32AG6	Thiamine-phosphate synthase	2.55e-06	NA	NA	0.5802
6. F	Q99VF6	Probable nitronate monooxygenase	4.08e-08	NA	NA	0.6024
6. F	B7LMV6	5-keto-4-deoxy-D-glucarate aldolase	1.30e-06	NA	NA	0.5926
6. F	A2CB21	Thiamine-phosphate synthase	4.45e-06	NA	NA	0.594
6. F	Q8X6Y0	Thiamine-phosphate synthase	2.74e-06	NA	NA	0.5794
6. F	Q5HIG1	Dihydropteroate synthase	2.02e-05	NA	NA	0.5019
6. F	Q9ZLB6	Probable tRNA-dihydrouridine synthase	2.58e-05	NA	NA	0.535
6. F	P59655	Dihydropteroate synthase	5.53e-05	NA	NA	0.517
6. F	B1XSV3	Imidazole glycerol phosphate synthase subunit HisF	2.67e-10	NA	NA	0.6387
6. F	C0PZ22	5-keto-4-deoxy-D-glucarate aldolase	1.84e-06	NA	NA	0.5938
6. F	A7FNH7	Thiamine-phosphate synthase	1.24e-08	NA	NA	0.562
6. F	A9N0K5	Thiamine-phosphate synthase	8.00e-09	NA	NA	0.595
6. F	B1XQ35	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.54e-07	NA	NA	0.5559
6. F	A8AKT0	Thiamine-phosphate synthase	7.28e-09	NA	NA	0.5739
6. F	A9MPQ4	5-keto-4-deoxy-D-glucarate aldolase	1.73e-06	NA	NA	0.5863
6. F	P0AC12	Dihydropteroate synthase type-2	2.05e-05	NA	NA	0.5261
6. F	Q8XGF9	5-keto-4-deoxy-D-glucarate aldolase	1.93e-06	NA	NA	0.5858
6. F	Q5PKA7	Thiamine-phosphate synthase	9.38e-09	NA	NA	0.5833
6. F	A9MHD7	Thiamine-phosphate synthase	8.40e-09	NA	NA	0.5925
6. F	Q9ZJN2	Probable nicotinate-nucleotide pyrophosphorylase [carboxylating]	6.92e-05	NA	NA	0.3935
6. F	B4TQK3	Thiamine-phosphate synthase	9.83e-09	NA	NA	0.5946
6. F	C3MZJ5	Geranylgeranylglyceryl phosphate synthase	2.78e-07	NA	NA	0.5061
6. F	B4TMS0	Imidazole glycerol phosphate synthase subunit HisF	1.38e-07	NA	NA	0.6474
6. F	Q31U04	Thiamine-phosphate synthase	2.45e-06	NA	NA	0.5801
6. F	Q5PCB8	5-keto-4-deoxy-D-glucarate aldolase	1.97e-06	NA	NA	0.5858
6. F	Q8FB78	Thiamine-phosphate synthase	2.29e-06	NA	NA	0.5908
6. F	A9N6Z0	5-keto-4-deoxy-D-glucarate aldolase	1.81e-06	NA	NA	0.5861
6. F	B6I2N1	4-hydroxy-2-oxo-heptane-1,7-dioate aldolase	1.43e-06	NA	NA	0.5994
6. F	B1IS70	4-hydroxy-2-oxo-heptane-1,7-dioate aldolase	1.48e-06	NA	NA	0.5993
6. F	A7ZUK8	Thiamine-phosphate synthase	2.23e-06	NA	NA	0.5947
6. F	Q7MWM0	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.16e-07	NA	NA	0.5426
6. F	Q1CN71	Thiamine-phosphate synthase	1.23e-08	NA	NA	0.5723
6. F	Q8X7B7	Tryptophan biosynthesis protein TrpCF	6.84e-06	NA	NA	0.654
6. F	Q9L9I8	Thiamine-phosphate synthase	7.56e-09	NA	NA	0.5947
6. F	Q1R5V9	Thiamine-phosphate synthase	2.65e-06	NA	NA	0.5934
6. F	C3NFV6	Geranylgeranylglyceryl phosphate synthase	2.30e-07	NA	NA	0.5048
6. F	C3P5Q9	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.35e-07	NA	NA	0.4236
6. F	Q1CZH4	N-(5'-phosphoribosyl)anthranilate isomerase	1.15e-06	NA	NA	0.5843
6. F	B1JUA5	Imidazole glycerol phosphate synthase subunit HisF	4.31e-10	NA	NA	0.6311
6. F	Q5HHG4	Probable nitronate monooxygenase	4.81e-08	NA	NA	0.6014
6. F	Q5HMD0	Thiamine-phosphate synthase	4.00e-06	NA	NA	0.6461
6. F	A5UA15	Imidazole glycerol phosphate synthase subunit HisF	1.39e-07	NA	NA	0.648
6. F	Q0BWJ4	N-(5'-phosphoribosyl)anthranilate isomerase	1.37e-07	NA	NA	0.626
6. F	P74106	Imidazole glycerol phosphate synthase subunit HisF	2.17e-10	NA	NA	0.6379
6. F	O68427	Tryptophan biosynthesis protein TrpCF	7.33e-08	NA	NA	0.6487
6. F	B3GZH3	Imidazole glycerol phosphate synthase subunit HisF	1.33e-10	NA	NA	0.6476
6. F	P0C0G1	Dihydropteroate synthase	1.02e-05	NA	NA	0.5379
6. F	P72965	Thiamine-phosphate synthase	5.04e-06	NA	NA	0.5938
6. F	B8H6U2	Imidazole glycerol phosphate synthase subunit HisF	8.42e-08	NA	NA	0.6474
6. F	A5FJJ1	Thiamine-phosphate synthase	1.43e-09	NA	NA	0.6348
6. F	Q7CPQ8	5-keto-4-deoxy-D-glucarate aldolase	1.89e-06	NA	NA	0.5858
6. F	O05701	Dihydropteroate synthase	2.83e-05	NA	NA	0.5046
6. F	Q7VAV5	Thiamine-phosphate synthase	5.50e-05	NA	NA	0.5461
6. F	P0CN86	Multifunctional tryptophan biosynthesis protein	8.11e-06	NA	NA	0.7138
6. F	Q7U5U1	Thiamine-phosphate synthase	4.81e-08	NA	NA	0.5987
6. F	P0C0X2	Inactive dihydropteroate synthase 2	3.22e-05	NA	NA	0.2769
6. F	Q6GJF7	Dihydropteroate synthase	2.64e-05	NA	NA	0.5008
6. F	B1LN92	D-tagatose-1,6-bisphosphate aldolase subunit GatY	2.64e-08	NA	NA	0.5715
6. F	B4T0Z5	Thiamine-phosphate synthase	6.74e-09	NA	NA	0.5958
6. F	A0A0N9HP11	4,4'-dithiodibutanoate disulfide reductase	4.89e-05	NA	NA	0.5917
6. F	A8Z1H7	Probable nitronate monooxygenase	3.63e-08	NA	NA	0.6018
6. F	Q323I7	Imidazole glycerol phosphate synthase subunit HisF	1.36e-07	NA	NA	0.6538
6. F	Q18CS6	Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit	1.98e-04	NA	NA	0.4514
6. F	A5UMZ1	Imidazole glycerol phosphate synthase subunit HisF	4.15e-10	NA	NA	0.6139
6. F	Q9RYX9	Thiamine-phosphate synthase	3.25e-06	NA	NA	0.5969
6. F	D4GW05	Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase	8.90e-03	NA	NA	0.5264
6. F	Q0K693	Imidazole glycerol phosphate synthase subunit HisF	8.12e-10	NA	NA	0.62
6. F	A7ZNR5	D-tagatose-1,6-bisphosphate aldolase subunit GatY	4.14e-08	NA	NA	0.584
6. F	P64142	Dihydropteroate synthase	2.64e-05	NA	NA	0.5048
6. F	P00910	Tryptophan biosynthesis protein TrpCF	6.97e-06	NA	NA	0.654
6. F	Q8Z325	Thiamine-phosphate synthase	8.66e-09	NA	NA	0.5946
6. F	P59459	Tryptophan biosynthesis protein TrpCF	1.26e-07	NA	NA	0.6554
6. F	B2J6F7	Thiamine-phosphate synthase	6.41e-06	NA	NA	0.5979
6. F	B1XGT9	5-keto-4-deoxy-D-glucarate aldolase	1.45e-06	NA	NA	0.5926
6. F	A4TS25	Thiamine-phosphate synthase	1.25e-08	NA	NA	0.572
6. F	Q4L4T4	Probable nitronate monooxygenase	5.12e-08	NA	NA	0.6022
6. F	B5RFJ1	Thiamine-phosphate synthase	7.78e-09	NA	NA	0.5954
6. F	P52997	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.02e-07	NA	NA	0.5403
6. F	B5BJR2	Thiamine-phosphate synthase	8.52e-09	NA	NA	0.5945
6. F	A6TEE9	5-keto-4-deoxy-D-glucarate aldolase	2.00e-06	NA	NA	0.5931
6. F	Q1MRJ6	Thiamine-phosphate synthase	4.56e-10	NA	NA	0.6115
6. F	B0R808	Dihydroorotate dehydrogenase (quinone)	1.56e-06	NA	NA	0.366
6. F	A2SE09	Imidazole glycerol phosphate synthase subunit HisF	5.03e-10	NA	NA	0.6484
6. F	Q6LYI7	N-(5'-phosphoribosyl)anthranilate isomerase	1.44e-07	NA	NA	0.5724
6. F	P52563	N-(5'-phosphoribosyl)anthranilate isomerase	3.15e-08	NA	NA	0.5719
6. F	C3N7L7	Geranylgeranylglyceryl phosphate synthase	2.88e-07	NA	NA	0.506
6. F	Q6GIG7	Probable nitronate monooxygenase	4.09e-08	NA	NA	0.5997
6. F	Q7V8I3	Thiamine-phosphate synthase	3.19e-06	NA	NA	0.6088
6. F	B4TCT2	Thiamine-phosphate synthase	1.01e-08	NA	NA	0.5823
6. F	Q57JK9	D-tagatose-1,6-bisphosphate aldolase subunit GatY	3.84e-08	NA	NA	0.6009
6. F	C4LFI4	Imidazole glycerol phosphate synthase subunit HisF	1.29e-10	NA	NA	0.6485
6. F	P05382	Dihydropteroate synthase	5.56e-05	NA	NA	0.5135
6. F	Q9HS44	Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase	9.40e-03	NA	NA	0.5598
6. F	A9GBI6	Imidazole glycerol phosphate synthase subunit HisF	5.76e-10	NA	NA	0.6214
6. F	Q8PRX4	N-(5'-phosphoribosyl)anthranilate isomerase 2	2.08e-08	NA	NA	0.6058
6. F	B5F6Q5	5-keto-4-deoxy-D-glucarate aldolase	1.89e-06	NA	NA	0.586
6. F	Q57QP9	4-hydroxy-2-oxo-heptane-1,7-dioate aldolase	9.44e-07	NA	NA	0.6192
6. F	A7GN76	3-methyl-2-oxobutanoate hydroxymethyltransferase	1.24e-07	NA	NA	0.4391
6. F	A6QFD2	Probable nitronate monooxygenase	4.85e-08	NA	NA	0.6139
6. F	Q8CNK2	Thiamine-phosphate synthase	3.90e-06	NA	NA	0.6508
6. F	Q8YX72	Thiamine-phosphate synthase	7.33e-06	NA	NA	0.577
6. F	C4ZSI0	D-tagatose-1,6-bisphosphate aldolase subunit GatY	3.65e-08	NA	NA	0.542
6. F	A2BSJ5	Thiamine-phosphate synthase	7.95e-06	NA	NA	0.6011
6. F	Q59919	Dihydropteroate synthase	3.37e-05	NA	NA	0.5176
6. F	Q97ZE0	Homocitrate synthase	2.89e-07	NA	NA	0.5899
6. F	B0TQY8	Imidazole glycerol phosphate synthase subunit HisF	1.73e-10	NA	NA	0.648
6. F	Q1B7H0	Imidazole glycerol phosphate synthase subunit HisF	2.68e-10	NA	NA	0.6281
6. F	P22098	Tryptophan biosynthesis protein TrpCF	1.97e-05	NA	NA	0.6716
6. F	P64141	Dihydropteroate synthase	2.59e-05	NA	NA	0.4942
6. F	B5Z089	Thiamine-phosphate synthase	3.06e-06	NA	NA	0.5791
6. F	Q1C1U8	Thiamine-phosphate synthase	1.18e-08	NA	NA	0.5777
6. F	B7LUF6	Imidazole glycerol phosphate synthase subunit HisF	1.33e-07	NA	NA	0.6392
6. F	P30012	Nicotinate-nucleotide pyrophosphorylase [carboxylating]	2.17e-05	NA	NA	0.4328
6. F	A1W7J6	Biotin synthase	1.03e-03	NA	NA	0.5309
6. F	B8GEX3	Imidazole glycerol phosphate synthase subunit HisF	2.45e-07	NA	NA	0.6687
6. F	Q0T342	D-tagatose-1,6-bisphosphate aldolase subunit GatY	3.39e-08	NA	NA	0.5748
6. F	P0DB09	Dihydropteroate synthase	1.19e-05	NA	NA	0.5117
6. F	A1SVC5	Imidazole glycerol phosphate synthase subunit HisF	2.24e-10	NA	NA	0.6438
6. F	Q8NXZ2	Dihydropteroate synthase	2.03e-05	NA	NA	0.5045
6. F	Q9KST5	Tryptophan biosynthesis protein TrpCF	1.20e-07	NA	NA	0.672
6. F	B5QZS6	5-keto-4-deoxy-D-glucarate aldolase	1.89e-06	NA	NA	0.586
6. F	Q7NNK8	Thiamine-phosphate synthase	6.47e-06	NA	NA	0.5994
6. F	A8AAK3	Imidazole glycerol phosphate synthase subunit HisF	1.08e-07	NA	NA	0.6365
6. F	B2GBV5	Thiamine-phosphate synthase	2.15e-07	NA	NA	0.6755
6. F	Q2FIF3	Probable nitronate monooxygenase	3.78e-08	NA	NA	0.6018
6. F	A4FXH5	N-(5'-phosphoribosyl)anthranilate isomerase	1.70e-07	NA	NA	0.5836
6. F	Q6GBX4	Dihydropteroate synthase	2.49e-05	NA	NA	0.5176
6. F	Q49W60	Probable nitronate monooxygenase	2.87e-08	NA	NA	0.6151
6. F	Q5F5C2	Thiamine-phosphate synthase	2.87e-08	NA	NA	0.6097
6. F	B5QYE8	Thiamine-phosphate synthase	7.76e-09	NA	NA	0.5853
6. F	Q9JXF7	Thiamine-phosphate synthase	1.33e-08	NA	NA	0.6395
6. F	A5IR97	Probable nitronate monooxygenase	4.38e-08	NA	NA	0.5988
6. F	C3NHU6	Homocitrate synthase	2.93e-07	NA	NA	0.6046
6. F	Q0TA72	Thiamine-phosphate synthase	2.33e-06	NA	NA	0.5937
6. F	Q7NTY1	GMP reductase	2.54e-05	NA	NA	0.5556
6. F	Q5E633	Imidazole glycerol phosphate synthase subunit HisF	1.21e-10	NA	NA	0.6409
6. F	B2TWI0	Thiamine-phosphate synthase	1.17e-08	NA	NA	0.5788
6. F	B5FQK8	Thiamine-phosphate synthase	8.09e-09	NA	NA	0.5957
6. F	Q8NXG7	Probable nitronate monooxygenase	5.25e-08	NA	NA	0.6015
6. F	Q12FC7	Imidazole glycerol phosphate synthase subunit HisF	4.77e-10	NA	NA	0.6478
6. F	Q9HZ95	tRNA-dihydrouridine(16) synthase	2.05e-05	NA	NA	0.5635
6. F	Q6DAM1	Thiamine-phosphate synthase	1.10e-08	NA	NA	0.5782
6. F	P64140	Inactive dihydropteroate synthase 2	4.60e-05	NA	NA	0.2973
6. F	Q8DHK2	Thiamine-phosphate synthase	6.54e-06	NA	NA	0.5995
6. F	Q6GB05	Probable nitronate monooxygenase	4.30e-08	NA	NA	0.5912
6. F	P46451	Tryptophan biosynthesis protein TrpCF	1.45e-07	NA	NA	0.6189
6. F	P28822	Dihydropteroate synthase	2.81e-05	NA	NA	0.5424
6. F	Q44603	Tryptophan biosynthesis protein TrpCF	2.45e-07	NA	NA	0.6505
6. F	Q65RC1	Imidazole glycerol phosphate synthase subunit HisF	1.28e-07	NA	NA	0.6447
6. F	Q8YRC9	Bifunctional protein ThiO/ThiG	3.59e-05	NA	NA	0.5672
6. F	P57855	Tryptophan biosynthesis protein TrpCF	1.23e-07	NA	NA	0.6443
6. F	Q9HR52	Imidazole glycerol phosphate synthase subunit HisF	4.55e-10	NA	NA	0.6217
6. F	Q0S7Q1	(3aS,4S,5R,7aS)-5-hydroxy-7a-methyl-1-oxo-octahydro-1H-indene-4-carboxyl-CoA dehydrogenase	2.63e-08	NA	NA	0.6536
6. F	Q7V0I3	Thiamine-phosphate synthase	9.44e-06	NA	NA	0.5972
6. F	A9C2R2	Biotin synthase	9.39e-04	NA	NA	0.5337
6. F	C1FAD8	Imidazole glycerol phosphate synthase subunit HisF	2.45e-07	NA	NA	0.6142
6. F	Q8ZAQ1	Thiamine-phosphate synthase	1.31e-08	NA	NA	0.5572
7. B	Q14IU8	Pyridoxal 5'-phosphate synthase subunit PdxS	4.67e-09	NA	0.010	NA
7. B	Q5NHE6	Pyridoxal 5'-phosphate synthase subunit PdxS	4.61e-09	NA	0.010	NA
7. B	Q2A260	Pyridoxal 5'-phosphate synthase subunit PdxS	4.62e-09	NA	0.010	NA
7. B	B0TZ17	Pyridoxal 5'-phosphate synthase subunit PdxS	4.74e-09	NA	0.002	NA
7. B	Q0BKT2	Pyridoxal 5'-phosphate synthase subunit PdxS	4.62e-09	NA	0.010	NA
7. B	Q42529	Tryptophan synthase alpha chain, chloroplastic	8.61e-09	NA	0.009	NA
7. B	F6S675	Inosine-5'-monophosphate dehydrogenase 1	2.22e-03	NA	0.042	NA
7. B	Q8PCH1	tRNA-dihydrouridine synthase B	3.55e-06	NA	0.049	NA
7. B	A0Q5I1	Pyridoxal 5'-phosphate synthase subunit PdxS	4.68e-09	NA	0.010	NA
7. B	A4IZB5	Pyridoxal 5'-phosphate synthase subunit PdxS	4.61e-09	NA	0.010	NA
7. B	B2SDL5	Pyridoxal 5'-phosphate synthase subunit PdxS	4.56e-09	NA	0.009	NA
7. B	B0UXP9	Inosine-5'-monophosphate dehydrogenase 2	1.84e-03	NA	0.003	NA
7. B	Q7VNP2	tRNA-dihydrouridine synthase B	3.87e-06	NA	0.001	NA
7. B	P12268	Inosine-5'-monophosphate dehydrogenase 2	1.86e-03	NA	0.014	NA
7. B	Q49V28	Pyridoxal 5'-phosphate synthase subunit PdxS	6.97e-09	NA	0.014	NA
7. B	E9PU28	Inosine-5'-monophosphate dehydrogenase 2	1.62e-03	NA	0.039	NA
7. B	A9B891	Pyridoxal 5'-phosphate synthase subunit PdxS	1.96e-06	NA	0.004	NA
7. B	A7NDQ3	Pyridoxal 5'-phosphate synthase subunit PdxS	4.68e-09	NA	0.010	NA