Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54821.1
JCVISYN3A_0499
50S ribosomal protein L27.
M. mycoides homolog: Q6MT50.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 14
Unique PROST Go: 1
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 808
Unique PROST Homologs: 1
Unique BLAST Homologs: 6
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q7MA29
(50S ribosomal protein L27) with a FATCAT P-Value: 0 and RMSD of 1.02 angstrom. The sequence alignment identity is 53.2%.
Structural alignment shown in left. Query protein AVX54821.1 colored as red in alignment, homolog Q7MA29 colored as blue.
Query protein AVX54821.1 is also shown in right top, homolog Q7MA29 showed in right bottom. They are colored based on secondary structures.
AVX54821.1 MRFLLGLQYFASKKGVGSTKNGRDSESKRLGAKKSDGQFTNAGSIIYRQRGTKIHPGLNVGRGGDDTLFALIAGTVKYEKFGKNRTRVSVIPN- 93 Q7MA29 ---------MAHKKGQGSTQNNRDSAGRRLGVKKFGGEFVRAGNIIIRQRGTKVHPGSNVGMGTDHTIFALIDGIVKFERKDKERKKVSIYPAS 85
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0006412 | translation |
1. PBF | GO:0003735 | structural constituent of ribosome |
1. PBF | GO:0022625 | cytosolic large ribosomal subunit |
1. PBF | GO:0005762 | mitochondrial large ribosomal subunit |
1. PBF | GO:0005840 | ribosome |
1. PBF | GO:0019843 | rRNA binding |
3. BF | GO:0009507 | chloroplast |
4. PB | GO:0003723 | RNA binding |
4. PB | GO:1902626 | assembly of large subunit precursor of preribosome |
4. PB | GO:0000048 | peptidyltransferase activity |
4. PB | GO:0005886 | plasma membrane |
4. PB | GO:0090070 | positive regulation of ribosome biogenesis |
5. P | GO:0005737 | cytoplasm |
6. F | GO:0000049 | tRNA binding |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0006412 | translation |
GO:1990904 | ribonucleoprotein complex |
GO:0005840 | ribosome |
GO:0003735 | structural constituent of ribosome |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | A5IYZ5 | 50S ribosomal protein L27 | 1.11e-16 | 7.42e-10 | 9.56e-28 | 0.9339 |
1. PBF | P66135 | 50S ribosomal protein L27 | 7.68e-12 | 6.27e-42 | 6.19e-35 | 0.8634 |
1. PBF | Q7W1P1 | 50S ribosomal protein L27 | 4.90e-14 | 3.21e-14 | 7.71e-24 | 0.9044 |
1. PBF | Q32BE8 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-16 | 1.27e-21 | 0.9247 |
1. PBF | B1LGF1 | 50S ribosomal protein L27 | 8.88e-16 | 1.01e-16 | 1.27e-21 | 0.9147 |
1. PBF | A5VYC5 | 50S ribosomal protein L27 | 6.66e-16 | 5.91e-18 | 8.66e-22 | 0.9046 |
1. PBF | Q4QM29 | 50S ribosomal protein L27 | 4.33e-15 | 3.74e-19 | 4.59e-22 | 0.9104 |
1. PBF | C1CE94 | 50S ribosomal protein L27 | 6.75e-12 | 2.72e-43 | 6.26e-35 | 0.7813 |
1. PBF | Q253F7 | 50S ribosomal protein L27 | 1.78e-15 | 1.04e-20 | 5.59e-26 | 0.9412 |
1. PBF | Q2J3K2 | 50S ribosomal protein L27 | 0.00e+00 | 1.16e-09 | 7.19e-22 | 0.9463 |
1. PBF | B9L606 | 50S ribosomal protein L27 | 0.00e+00 | 4.20e-15 | 2.12e-26 | 0.9326 |
1. PBF | Q5FH97 | 50S ribosomal protein L27 | 2.22e-16 | 6.21e-14 | 4.89e-18 | 0.9469 |
1. PBF | B6I1Q8 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9192 |
1. PBF | Q8PBH1 | 50S ribosomal protein L27 | 0.00e+00 | 3.79e-15 | 3.03e-21 | 0.8976 |
1. PBF | B3Q726 | 50S ribosomal protein L27 | 2.22e-16 | 1.82e-11 | 1.45e-22 | 0.936 |
1. PBF | A8FJQ0 | 50S ribosomal protein L27 | 4.93e-14 | 3.20e-17 | 1.04e-24 | 0.914 |
1. PBF | B0BV44 | 50S ribosomal protein L27 | 2.22e-16 | 7.69e-14 | 1.96e-24 | 0.9343 |
1. PBF | P66129 | 50S ribosomal protein L27 | 0.00e+00 | 3.62e-11 | 1.21e-21 | 0.9236 |
1. PBF | Q81LE8 | 50S ribosomal protein L27 | 0.00e+00 | 2.43e-39 | 4.78e-41 | 0.9349 |
1. PBF | C0ME76 | 50S ribosomal protein L27 | 0.00e+00 | 2.17e-44 | 8.80e-36 | 0.8438 |
1. PBF | B2UCV4 | 50S ribosomal protein L27 | 3.63e-14 | 3.15e-17 | 4.19e-25 | 0.9139 |
1. PBF | B3PIU8 | 50S ribosomal protein L27 | 7.09e-13 | 3.97e-24 | 9.00e-23 | 0.9032 |
1. PBF | A6T2D6 | 50S ribosomal protein L27 | 8.88e-15 | 1.47e-15 | 1.75e-24 | 0.9136 |
1. PBF | B0BC54 | 50S ribosomal protein L27 | 2.22e-16 | 2.81e-18 | 8.92e-27 | 0.9163 |
1. PBF | A4W0Q0 | 50S ribosomal protein L27 | 0.00e+00 | 4.49e-41 | 4.13e-35 | 0.9364 |
1. PBF | A9BBW8 | 50S ribosomal protein L27 | 0.00e+00 | 4.22e-13 | 2.77e-25 | 0.8988 |
1. PBF | Q6GG59 | 50S ribosomal protein L27 | 2.22e-12 | 5.71e-45 | 3.62e-40 | 0.8476 |
1. PBF | Q8DMF2 | 50S ribosomal protein L27 | 0.00e+00 | 7.98e-12 | 3.98e-33 | 0.9681 |
1. PBF | B1ILY6 | 50S ribosomal protein L27 | 1.11e-16 | 1.65e-24 | 1.27e-40 | 0.9381 |
1. PBF | P66123 | 50S ribosomal protein L27 | 6.66e-16 | 6.40e-18 | 1.69e-27 | 0.9134 |
1. PBF | A0QDG9 | 50S ribosomal protein L27 | 2.21e-14 | 2.54e-15 | 2.69e-23 | 0.91 |
1. PBF | B7I6V8 | 50S ribosomal protein L27 | 0.00e+00 | 1.28e-15 | 4.30e-20 | 0.9262 |
1. PBF | B3CV08 | 50S ribosomal protein L27 | 0.00e+00 | 2.56e-18 | 3.29e-26 | 0.9534 |
1. PBF | A5N6K1 | 50S ribosomal protein L27 | 1.11e-16 | 4.12e-27 | 1.46e-38 | 0.9393 |
1. PBF | A0L073 | 50S ribosomal protein L27 | 3.30e-14 | 2.69e-17 | 2.59e-22 | 0.9008 |
1. PBF | Q2VZU3 | 50S ribosomal protein L27 | 2.07e-14 | 2.40e-10 | 1.08e-19 | 0.9408 |
1. PBF | A5E968 | 50S ribosomal protein L27 | 0.00e+00 | 2.57e-07 | 1.83e-20 | 0.9438 |
1. PBF | Q8E4G3 | 50S ribosomal protein L27 | 1.57e-13 | 1.44e-40 | 3.62e-35 | 0.8962 |
1. PBF | A2BY52 | 50S ribosomal protein L27 | 5.55e-16 | 1.27e-14 | 4.84e-25 | 0.8969 |
1. PBF | Q07U70 | 50S ribosomal protein L27 | 1.58e-14 | 1.21e-11 | 5.94e-23 | 0.9058 |
1. PBF | Q5HNQ6 | 50S ribosomal protein L27 | 1.11e-16 | 1.27e-42 | 7.97e-40 | 0.9159 |
1. PBF | B0U3R4 | 50S ribosomal protein L27 | 6.22e-15 | 3.19e-18 | 5.38e-21 | 0.9088 |
1. PBF | Q8YJ84 | 50S ribosomal protein L27 | 0.00e+00 | 7.26e-12 | 6.48e-23 | 0.958 |
1. PBF | A7ZS81 | 50S ribosomal protein L27 | 1.11e-16 | 1.01e-16 | 1.27e-21 | 0.9197 |
1. PBF | C0QLE8 | 50S ribosomal protein L27 | 8.88e-16 | 1.34e-19 | 2.98e-22 | 0.9662 |
1. PBF | Q6MT50 | 50S ribosomal protein L27 | 9.10e-14 | 7.05e-113 | 1.26e-62 | 0.876 |
1. PBF | B1XT34 | 50S ribosomal protein L27 | 1.89e-15 | 8.57e-17 | 6.76e-27 | 0.9149 |
1. PBF | P0A7L9 | 50S ribosomal protein L27 | 3.33e-16 | 1.01e-16 | 1.27e-21 | 0.9247 |
1. PBF | Q7VAN2 | 50S ribosomal protein L27 | 1.11e-16 | 2.19e-13 | 1.87e-24 | 0.8868 |
1. PBF | Q601F3 | 50S ribosomal protein L27 | 3.33e-16 | 1.12e-21 | 4.83e-25 | 0.9345 |
1. PBF | B7GNK2 | 50S ribosomal protein L27 | 0.00e+00 | 3.16e-20 | 3.42e-19 | 0.9263 |
1. PBF | B7GIR0 | 50S ribosomal protein L27 | 0.00e+00 | 1.75e-43 | 2.39e-41 | 0.9429 |
1. PBF | Q98QN2 | 50S ribosomal protein L27 | 0.00e+00 | 2.91e-14 | 2.51e-28 | 0.9231 |
1. PBF | A4Y426 | 50S ribosomal protein L27 | 1.53e-14 | 2.69e-17 | 2.59e-22 | 0.9104 |
1. PBF | Q836X4 | 50S ribosomal protein L27 | 0.00e+00 | 4.29e-41 | 4.16e-36 | 0.8679 |
1. PBF | A0T0G4 | 50S ribosomal protein L27, chloroplastic | 3.77e-15 | 6.32e-20 | 1.43e-21 | 0.9219 |
1. PBF | B5YS74 | 50S ribosomal protein L27 | 3.33e-16 | 1.01e-16 | 1.27e-21 | 0.9175 |
1. PBF | Q7VP91 | 50S ribosomal protein L27 | 1.29e-14 | 1.09e-20 | 2.56e-23 | 0.914 |
1. PBF | Q319E2 | 50S ribosomal protein L27 | 6.66e-16 | 7.33e-15 | 2.86e-25 | 0.8967 |
1. PBF | B1MMY4 | 50S ribosomal protein L27 | 0.00e+00 | 5.62e-14 | 3.99e-25 | 0.9326 |
1. PBF | A0Q5Q3 | 50S ribosomal protein L27 | 1.37e-12 | 6.71e-18 | 4.69e-23 | 0.8946 |
1. PBF | Q71ZD0 | 50S ribosomal protein L27 | 5.55e-16 | 2.32e-34 | 5.05e-38 | 0.9224 |
1. PBF | B2GD71 | 50S ribosomal protein L27 | 1.01e-12 | 1.05e-30 | 7.31e-33 | 0.9076 |
1. PBF | B8DRP0 | 50S ribosomal protein L27 | 6.66e-16 | 6.02e-12 | 4.25e-22 | 0.9067 |
1. PBF | B4E5X1 | 50S ribosomal protein L27 | 1.75e-14 | 6.50e-17 | 1.90e-23 | 0.9021 |
1. PBF | B2USC8 | 50S ribosomal protein L27 | 1.33e-15 | 1.56e-13 | 1.47e-26 | 0.9125 |
1. PBF | B2JHD8 | 50S ribosomal protein L27 | 7.33e-15 | 8.76e-18 | 3.18e-22 | 0.9128 |
1. PBF | Q13DL3 | 50S ribosomal protein L27 | 0.00e+00 | 9.78e-10 | 1.82e-22 | 0.9503 |
1. PBF | A5VD71 | 50S ribosomal protein L27 | 1.11e-15 | 4.77e-11 | 1.53e-18 | 0.9574 |
1. PBF | Q9X1G7 | 50S ribosomal protein L27 | 0.00e+00 | 3.69e-22 | 3.23e-18 | 0.9404 |
1. PBF | Q1QQU2 | 50S ribosomal protein L27 | 0.00e+00 | 3.14e-09 | 1.09e-21 | 0.9436 |
1. PBF | C1A1L6 | 50S ribosomal protein L27 | 2.74e-14 | 3.60e-14 | 3.60e-26 | 0.9211 |
1. PBF | A2BSR8 | 50S ribosomal protein L27 | 2.55e-15 | 1.67e-13 | 7.14e-24 | 0.8928 |
1. PBF | B7V0B0 | 50S ribosomal protein L27 | 8.48e-14 | 1.86e-19 | 7.07e-21 | 0.9024 |
1. PBF | A6L6D2 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 1.24e-25 | 0.9725 |
1. PBF | A1V0P2 | 50S ribosomal protein L27 | 3.44e-15 | 4.34e-13 | 5.44e-23 | 0.9114 |
1. PBF | B0T395 | 50S ribosomal protein L27 | 0.00e+00 | 9.39e-09 | 1.79e-21 | 0.9673 |
1. PBF | A9FG63 | 50S ribosomal protein L27 | 3.33e-15 | 1.46e-12 | 1.40e-18 | 0.9375 |
1. PBF | A9BP69 | 50S ribosomal protein L27 | 3.15e-14 | 3.90e-15 | 1.42e-20 | 0.9024 |
1. PBF | Q824F4 | 50S ribosomal protein L27 | 0.00e+00 | 3.45e-19 | 6.88e-26 | 0.9492 |
1. PBF | A6LQR8 | 50S ribosomal protein L27 | 1.59e-14 | 3.04e-28 | 2.92e-38 | 0.9192 |
1. PBF | B3PMF8 | 50S ribosomal protein L27 | 2.22e-16 | 3.99e-13 | 8.01e-28 | 0.9199 |
1. PBF | B7IIV4 | 50S ribosomal protein L27 | 9.10e-15 | 2.43e-39 | 4.78e-41 | 0.9216 |
1. PBF | B7N0H8 | 50S ribosomal protein L27 | 1.11e-16 | 1.01e-16 | 1.27e-21 | 0.9221 |
1. PBF | O19885 | 50S ribosomal protein L27, chloroplastic | 6.33e-15 | 8.56e-07 | 5.37e-22 | 0.8976 |
1. PBF | Q88Q09 | 50S ribosomal protein L27 | 2.22e-16 | 5.91e-18 | 8.66e-22 | 0.9078 |
1. PBF | Q5FJG0 | 50S ribosomal protein L27 | 6.36e-14 | 3.32e-24 | 2.62e-36 | 0.9168 |
1. PBF | Q8XVK9 | 50S ribosomal protein L27 | 1.04e-14 | 1.36e-16 | 5.70e-25 | 0.9062 |
1. PBF | B1VXD7 | 50S ribosomal protein L27 | 1.39e-14 | 6.16e-22 | 4.72e-26 | 0.908 |
1. PBF | B7J0M6 | 50S ribosomal protein L27 | 0.00e+00 | 3.50e-19 | 9.68e-22 | 0.9486 |
1. PBF | Q92GG0 | 50S ribosomal protein L27 | 3.33e-16 | 2.10e-15 | 8.70e-24 | 0.9359 |
1. PBF | Q21M08 | 50S ribosomal protein L27 | 8.05e-14 | 3.04e-18 | 3.14e-25 | 0.9097 |
1. PBF | C0RF97 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9472 |
1. PBF | A4XYL3 | 50S ribosomal protein L27 | 3.31e-14 | 3.13e-19 | 2.61e-23 | 0.9102 |
1. PBF | B2S3Y2 | 50S ribosomal protein L27 | 0.00e+00 | 2.91e-14 | 1.90e-21 | 0.9229 |
1. PBF | B5ZUD9 | 50S ribosomal protein L27 | 0.00e+00 | 2.14e-09 | 1.75e-24 | 0.9621 |
1. PBF | Q1GRH1 | 50S ribosomal protein L27 | 0.00e+00 | 1.15e-07 | 9.86e-19 | 0.9589 |
1. PBF | Q0AWJ2 | 50S ribosomal protein L27 | 1.11e-16 | 2.98e-29 | 4.46e-36 | 0.9317 |
1. PBF | Q04Q89 | 50S ribosomal protein L27 | 5.88e-15 | 4.32e-19 | 4.66e-24 | 0.9367 |
1. PBF | Q6F125 | 50S ribosomal protein L27 | 3.33e-16 | 1.08e-55 | 1.39e-52 | 0.8972 |
1. PBF | Q8CS89 | 50S ribosomal protein L27 | 3.33e-15 | 1.27e-42 | 7.97e-40 | 0.8852 |
1. PBF | A5UDJ5 | 50S ribosomal protein L27 | 5.23e-14 | 3.74e-19 | 4.59e-22 | 0.8975 |
1. PBF | Q46X16 | 50S ribosomal protein L27 | 3.15e-12 | 7.67e-13 | 2.91e-24 | 0.887 |
1. PBF | Q8XIJ1 | 50S ribosomal protein L27 | 0.00e+00 | 2.81e-29 | 1.10e-38 | 0.9443 |
1. PBF | Q1IF14 | 50S ribosomal protein L27 | 7.55e-15 | 5.91e-18 | 8.66e-22 | 0.9145 |
1. PBF | B2S810 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9632 |
1. PBF | A0ZZY9 | 50S ribosomal protein L27 | 0.00e+00 | 9.21e-19 | 7.85e-20 | 0.9277 |
1. PBF | C4ZSS4 | 50S ribosomal protein L27 | 8.88e-16 | 1.01e-16 | 1.27e-21 | 0.9131 |
1. PBF | Q817U4 | 50S ribosomal protein L27 | 5.55e-16 | 4.12e-40 | 7.01e-41 | 0.893 |
1. PBF | A1TTD4 | 50S ribosomal protein L27 | 4.65e-14 | 2.13e-15 | 1.26e-22 | 0.8996 |
1. PBF | B1VAF3 | 50S ribosomal protein L27 | 0.00e+00 | 2.21e-43 | 1.43e-38 | 0.9587 |
1. PBF | B0K416 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-26 | 2.00e-37 | 0.8806 |
1. PBF | Q9ABB3 | 50S ribosomal protein L27 | 2.22e-16 | 8.57e-11 | 9.34e-22 | 0.9125 |
1. PBF | A2SD35 | 50S ribosomal protein L27 | 3.43e-14 | 2.44e-14 | 2.37e-21 | 0.9161 |
1. PBF | B0JQG5 | 50S ribosomal protein L27 | 0.00e+00 | 4.48e-10 | 7.43e-32 | 0.9406 |
1. PBF | A1KLD7 | 50S ribosomal protein L27 | 6.66e-16 | 1.17e-14 | 1.41e-24 | 0.9087 |
1. PBF | Q6NDE9 | 50S ribosomal protein L27 | 2.22e-16 | 1.82e-11 | 1.45e-22 | 0.9333 |
1. PBF | Q1DC96 | 50S ribosomal protein L27 | 0.00e+00 | 3.35e-05 | 1.25e-20 | 0.9531 |
1. PBF | Q8KCB7 | 50S ribosomal protein L27 | 1.99e-14 | 1.05e-20 | 1.07e-23 | 0.9213 |
1. PBF | Q3A1D7 | 50S ribosomal protein L27 | 0.00e+00 | 4.89e-18 | 6.57e-25 | 0.9648 |
1. PBF | A6UDV3 | 50S ribosomal protein L27 | 0.00e+00 | 3.39e-11 | 1.41e-25 | 0.9575 |
1. PBF | A5CR31 | 50S ribosomal protein L27 | 7.44e-15 | 1.07e-20 | 3.94e-26 | 0.9104 |
1. PBF | A4WEZ8 | 50S ribosomal protein L27 | 1.89e-15 | 1.95e-20 | 3.08e-21 | 0.9311 |
1. PBF | Q57JG5 | 50S ribosomal protein L27 | 2.99e-14 | 7.84e-19 | 2.00e-22 | 0.9023 |
1. PBF | Q7MYX5 | 50S ribosomal protein L27 | 2.25e-14 | 1.40e-15 | 9.40e-23 | 0.9071 |
1. PBF | Q892N6 | 50S ribosomal protein L27 | 0.00e+00 | 1.34e-25 | 4.17e-41 | 0.9343 |
1. PBF | Q30QN9 | 50S ribosomal protein L27 | 6.66e-16 | 2.95e-18 | 4.00e-26 | 0.9369 |
1. PBF | A9KMF6 | 50S ribosomal protein L27 | 0.00e+00 | 1.14e-36 | 3.09e-42 | 0.9125 |
1. PBF | Q2S2N8 | 50S ribosomal protein L27 | 1.11e-16 | 2.86e-18 | 8.93e-25 | 0.9536 |
1. PBF | A7MJF4 | 50S ribosomal protein L27 | 8.66e-15 | 2.57e-19 | 3.44e-21 | 0.9167 |
1. PBF | A2S5R9 | 50S ribosomal protein L27 | 2.08e-13 | 4.34e-13 | 5.44e-23 | 0.8967 |
1. PBF | Q7VQN1 | 50S ribosomal protein L27 | 9.68e-14 | 1.21e-15 | 9.40e-21 | 0.9033 |
1. PBF | A5D408 | 50S ribosomal protein L27 | 7.77e-16 | 1.04e-15 | 8.90e-34 | 0.9498 |
1. PBF | B1M699 | 50S ribosomal protein L27 | 0.00e+00 | 1.07e-08 | 9.23e-21 | 0.9283 |
1. PBF | Q2RV03 | 50S ribosomal protein L27 | 8.88e-16 | 1.26e-19 | 5.41e-22 | 0.9373 |
1. PBF | P49561 | 50S ribosomal protein L27, chloroplastic | 7.77e-16 | 3.30e-18 | 1.82e-21 | 0.9358 |
1. PBF | O21275 | 60S ribosomal protein L27, mitochondrial | 0.00e+00 | 9.47e-18 | 7.08e-19 | 0.9529 |
1. PBF | A6L8T0 | 50S ribosomal protein L27 | 0.00e+00 | 7.06e-13 | 1.36e-23 | 0.9651 |
1. PBF | Q3K6K8 | 50S ribosomal protein L27 | 6.00e-15 | 1.80e-18 | 2.03e-21 | 0.9167 |
1. PBF | Q9CNS7 | 50S ribosomal protein L27 | 1.55e-15 | 3.79e-20 | 2.03e-23 | 0.9204 |
1. PBF | B8D9H1 | 50S ribosomal protein L27 | 0.00e+00 | 3.99e-19 | 3.45e-23 | 0.9364 |
1. PBF | A5U5D7 | 50S ribosomal protein L27 | 0.00e+00 | 1.17e-14 | 1.41e-24 | 0.9103 |
1. PBF | A6QB71 | 50S ribosomal protein L27 | 1.11e-16 | 4.49e-21 | 2.61e-24 | 0.9562 |
1. PBF | O83725 | 50S ribosomal protein L27 | 0.00e+00 | 2.91e-14 | 1.90e-21 | 0.9222 |
1. PBF | B6YRH8 | 50S ribosomal protein L27 | 9.99e-16 | 2.95e-18 | 4.07e-24 | 0.9394 |
1. PBF | B8FUS1 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-29 | 7.09e-33 | 0.9305 |
1. PBF | A8AQ77 | 50S ribosomal protein L27 | 1.33e-15 | 1.63e-20 | 1.55e-21 | 0.9238 |
1. PBF | B2IE46 | 50S ribosomal protein L27 | 0.00e+00 | 2.91e-07 | 1.14e-22 | 0.9488 |
1. PBF | P66130 | 50S ribosomal protein L27 | 0.00e+00 | 3.62e-11 | 1.21e-21 | 0.9201 |
1. PBF | B9KIJ4 | 50S ribosomal protein L27 | 6.36e-13 | 1.68e-14 | 3.79e-19 | 0.9424 |
1. PBF | B7UJ78 | 50S ribosomal protein L27 | 6.44e-15 | 1.01e-16 | 1.27e-21 | 0.9126 |
1. PBF | B5E4L9 | 50S ribosomal protein L27 | 0.00e+00 | 2.72e-43 | 6.26e-35 | 0.8527 |
1. PBF | B1YJS1 | 50S ribosomal protein L27 | 7.90e-14 | 2.12e-55 | 6.71e-43 | 0.9048 |
1. PBF | Q9CGL5 | 50S ribosomal protein L27 | 1.21e-12 | 9.87e-42 | 1.66e-33 | 0.8599 |
1. PBF | A7X362 | 50S ribosomal protein L27 | 0.00e+00 | 5.71e-45 | 3.62e-40 | 0.8601 |
1. PBF | B2IQ02 | 50S ribosomal protein L27 | 1.78e-13 | 2.72e-43 | 6.26e-35 | 0.7902 |
1. PBF | C5D5G7 | 50S ribosomal protein L27 | 0.00e+00 | 3.98e-42 | 4.27e-43 | 0.9494 |
1. PBF | C1F354 | 50S ribosomal protein L27 | 1.11e-16 | 3.34e-09 | 4.43e-25 | 0.9594 |
1. PBF | A0KGS8 | 50S ribosomal protein L27 | 2.22e-16 | 1.16e-13 | 7.72e-21 | 0.9381 |
1. PBF | Q6G0T7 | 50S ribosomal protein L27 | 0.00e+00 | 4.99e-13 | 2.71e-24 | 0.963 |
1. PBF | B9MRB7 | 50S ribosomal protein L27 | 2.22e-16 | 2.07e-33 | 3.68e-36 | 0.9036 |
1. PBF | Q3KLT4 | 50S ribosomal protein L27 | 7.88e-15 | 6.40e-18 | 1.69e-27 | 0.9071 |
1. PBF | Q66F75 | 50S ribosomal protein L27 | 1.94e-14 | 1.23e-15 | 5.77e-24 | 0.9 |
1. PBF | Q5HFB8 | 50S ribosomal protein L27 | 1.45e-11 | 5.71e-45 | 3.62e-40 | 0.8373 |
1. PBF | A0M7D0 | 50S ribosomal protein L27 | 0.00e+00 | 2.61e-17 | 4.36e-20 | 0.9661 |
1. PBF | Q47MV5 | 50S ribosomal protein L27 | 1.78e-15 | 5.47e-12 | 7.82e-28 | 0.9318 |
1. PBF | Q7V5W4 | 50S ribosomal protein L27 | 0.00e+00 | 5.96e-11 | 9.27e-26 | 0.8924 |
1. PBF | Q21Z00 | 50S ribosomal protein L27 | 5.97e-13 | 4.07e-15 | 2.46e-22 | 0.8861 |
1. PBF | P66124 | 50S ribosomal protein L27 | 1.78e-15 | 6.40e-18 | 1.69e-27 | 0.9115 |
1. PBF | A5CF98 | 50S ribosomal protein L27 | 9.99e-16 | 1.40e-18 | 8.54e-26 | 0.9012 |
1. PBF | Q5X1P0 | 50S ribosomal protein L27 | 0.00e+00 | 7.06e-10 | 1.14e-23 | 0.9308 |
1. PBF | C3L3J4 | 50S ribosomal protein L27 | 0.00e+00 | 3.09e-24 | 5.75e-41 | 0.8646 |
1. PBF | A2C732 | 50S ribosomal protein L27 | 5.55e-16 | 8.80e-11 | 9.68e-26 | 0.9098 |
1. PBF | Q7VK83 | 50S ribosomal protein L27 | 0.00e+00 | 1.36e-15 | 4.96e-28 | 0.9649 |
1. PBF | O67650 | 50S ribosomal protein L27 | 0.00e+00 | 2.62e-07 | 5.18e-23 | 0.9009 |
1. PBF | P41549 | 50S ribosomal protein L27, chloroplastic (Fragment) | 0.00e+00 | 1.05e-08 | 5.27e-13 | 0.9721 |
1. PBF | Q2K2Y0 | 50S ribosomal protein L27 | 0.00e+00 | 2.40e-12 | 5.49e-25 | 0.9082 |
1. PBF | Q47VL3 | 50S ribosomal protein L27 | 1.11e-16 | 1.10e-16 | 1.65e-21 | 0.925 |
1. PBF | B2G856 | 50S ribosomal protein L27 | 0.00e+00 | 2.36e-31 | 1.61e-33 | 0.8785 |
1. PBF | C5BQB3 | 50S ribosomal protein L27 | 2.72e-14 | 7.09e-20 | 4.88e-23 | 0.8965 |
1. PBF | Q11CP4 | 50S ribosomal protein L27 | 0.00e+00 | 3.27e-15 | 3.76e-26 | 0.9639 |
1. PBF | Q1GHD2 | 50S ribosomal protein L27 | 1.11e-16 | 9.37e-12 | 4.44e-19 | 0.9365 |
1. PBF | A9B129 | 50S ribosomal protein L27 | 0.00e+00 | 2.01e-10 | 5.56e-22 | 0.9474 |
1. PBF | A6W353 | 50S ribosomal protein L27 | 1.39e-14 | 1.06e-11 | 1.89e-22 | 0.9068 |
1. PBF | B7VID4 | 50S ribosomal protein L27 | 5.26e-13 | 1.58e-13 | 9.05e-22 | 0.8838 |
1. PBF | A5IMC9 | 50S ribosomal protein L27 | 0.00e+00 | 3.69e-22 | 3.23e-18 | 0.9377 |
1. PBF | A3N3T8 | 50S ribosomal protein L27 | 1.11e-16 | 4.18e-20 | 4.14e-23 | 0.9018 |
1. PBF | A4T2J3 | 50S ribosomal protein L27 | 8.77e-15 | 3.28e-13 | 4.16e-23 | 0.9217 |
1. PBF | B6JD23 | 50S ribosomal protein L27 | 0.00e+00 | 2.42e-09 | 1.76e-21 | 0.9418 |
1. PBF | Q3YX56 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9186 |
1. PBF | A4SR18 | 50S ribosomal protein L27 | 3.33e-16 | 1.30e-17 | 4.11e-20 | 0.9343 |
1. PBF | A7I2Z9 | 50S ribosomal protein L27 | 0.00e+00 | 1.84e-16 | 3.75e-26 | 0.9355 |
1. PBF | Q9PAS2 | 50S ribosomal protein L27 | 1.78e-15 | 3.57e-15 | 9.30e-21 | 0.91 |
1. PBF | Q89X93 | 50S ribosomal protein L27 | 1.55e-15 | 1.26e-09 | 3.34e-22 | 0.9312 |
1. PBF | A0LCZ4 | 50S ribosomal protein L27 | 0.00e+00 | 3.66e-14 | 7.83e-18 | 0.9282 |
1. PBF | C6BZ95 | 50S ribosomal protein L27 | 0.00e+00 | 1.63e-12 | 2.78e-22 | 0.9225 |
1. PBF | Q5Z042 | 50S ribosomal protein L27 | 5.55e-16 | 8.53e-12 | 5.70e-25 | 0.9224 |
1. PBF | Q7MX94 | 50S ribosomal protein L27 | 0.00e+00 | 1.32e-19 | 2.07e-22 | 0.9511 |
1. PBF | A1AKW2 | 50S ribosomal protein L27 | 4.11e-15 | 2.66e-13 | 7.82e-29 | 0.9573 |
1. PBF | Q30XV9 | 50S ribosomal protein L27 | 0.00e+00 | 3.10e-12 | 2.09e-22 | 0.9149 |
1. PBF | Q82C86 | 50S ribosomal protein L27 | 6.66e-16 | 5.13e-21 | 1.98e-24 | 0.9194 |
1. PBF | Q022G4 | 50S ribosomal protein L27 | 8.99e-15 | 2.18e-18 | 4.12e-22 | 0.9402 |
1. PBF | Q2JT19 | 50S ribosomal protein L27 | 1.80e-14 | 7.33e-10 | 2.10e-29 | 0.9112 |
1. PBF | Q4US35 | 50S ribosomal protein L27 | 1.12e-14 | 3.79e-15 | 3.03e-21 | 0.9019 |
1. PBF | P0DE28 | 50S ribosomal protein L27 | 8.88e-16 | 1.60e-39 | 1.64e-35 | 0.9145 |
1. PBF | B4RZH4 | 50S ribosomal protein L27 | 1.51e-14 | 1.27e-14 | 4.47e-21 | 0.9017 |
1. PBF | B9JUI3 | 50S ribosomal protein L27 | 0.00e+00 | 1.44e-09 | 9.19e-24 | 0.9576 |
1. PBF | A5I667 | 50S ribosomal protein L27 | 1.79e-13 | 1.65e-24 | 1.27e-40 | 0.8998 |
1. PBF | A8Z619 | 50S ribosomal protein L27 | 0.00e+00 | 3.66e-14 | 1.65e-22 | 0.9646 |
1. PBF | P95757 | 50S ribosomal protein L27 | 1.67e-15 | 6.16e-22 | 4.72e-26 | 0.9153 |
1. PBF | P44363 | 50S ribosomal protein L27 | 1.15e-14 | 2.79e-19 | 2.32e-21 | 0.9148 |
1. PBF | B7GXH9 | 50S ribosomal protein L27 | 7.77e-16 | 1.28e-15 | 4.30e-20 | 0.9302 |
1. PBF | B8EC05 | 50S ribosomal protein L27 | 3.38e-13 | 4.18e-18 | 2.08e-22 | 0.8767 |
1. PBF | Q5F685 | 50S ribosomal protein L27 | 0.00e+00 | 4.13e-11 | 7.22e-22 | 0.9235 |
1. PBF | P94689 | 50S ribosomal protein L27 (Fragment) | 4.98e-14 | 3.09e-24 | 1.35e-21 | 0.9094 |
1. PBF | A1KAC9 | 50S ribosomal protein L27 | 1.91e-14 | 9.36e-07 | 5.07e-24 | 0.9251 |
1. PBF | A0Q1T6 | 50S ribosomal protein L27 | 1.11e-15 | 1.32e-34 | 4.11e-39 | 0.9267 |
1. PBF | C1AEQ8 | 50S ribosomal protein L27 | 0.00e+00 | 1.17e-14 | 1.41e-24 | 0.9105 |
1. PBF | C5BFA2 | 50S ribosomal protein L27 | 0.00e+00 | 2.29e-15 | 5.50e-23 | 0.9293 |
1. PBF | B5RQB7 | 50S ribosomal protein L27 | 9.99e-16 | 2.86e-18 | 4.45e-20 | 0.9143 |
1. PBF | B3DVG8 | 50S ribosomal protein L27 | 4.44e-16 | 3.59e-16 | 2.48e-20 | 0.8739 |
1. PBF | A8LK04 | 50S ribosomal protein L27 | 1.11e-16 | 6.80e-10 | 2.34e-21 | 0.9315 |
1. PBF | Q8Z0F1 | 50S ribosomal protein L27 | 2.20e-14 | 7.57e-07 | 6.94e-27 | 0.9498 |
1. PBF | A8EV84 | 50S ribosomal protein L27 | 0.00e+00 | 2.45e-13 | 2.60e-24 | 0.9481 |
1. PBF | C1ETN9 | 50S ribosomal protein L27 | 5.88e-15 | 2.43e-39 | 4.78e-41 | 0.9117 |
1. PBF | Q2SZG1 | 50S ribosomal protein L27 | 9.24e-14 | 4.34e-13 | 5.44e-23 | 0.8992 |
1. PBF | A6Q4D3 | 50S ribosomal protein L27 | 0.00e+00 | 7.35e-19 | 4.17e-30 | 0.9365 |
1. PBF | A8GYB3 | 50S ribosomal protein L27 | 1.44e-15 | 1.19e-12 | 1.96e-23 | 0.9347 |
1. PBF | Q5LRY1 | 50S ribosomal protein L27 | 1.54e-14 | 1.04e-13 | 4.46e-21 | 0.8984 |
1. PBF | Q8PN24 | 50S ribosomal protein L27 | 2.66e-15 | 3.06e-13 | 2.52e-21 | 0.9112 |
1. PBF | B0B7Y9 | 50S ribosomal protein L27 | 5.55e-15 | 2.81e-18 | 8.92e-27 | 0.907 |
1. PBF | B8D7S3 | 50S ribosomal protein L27 | 1.11e-16 | 3.99e-19 | 3.45e-23 | 0.9274 |
1. PBF | Q7MP93 | 50S ribosomal protein L27 | 2.39e-14 | 2.44e-14 | 3.90e-22 | 0.9004 |
1. PBF | Q9FD28 | 50S ribosomal protein L27 | 8.88e-16 | 4.34e-13 | 5.44e-23 | 0.8877 |
1. PBF | A9M2Z6 | 50S ribosomal protein L27 | 0.00e+00 | 3.62e-11 | 1.21e-21 | 0.9184 |
1. PBF | Q21D07 | 50S ribosomal protein L27 | 0.00e+00 | 5.77e-10 | 1.60e-21 | 0.9627 |
1. PBF | B8G6X2 | 50S ribosomal protein L27 | 1.07e-14 | 1.76e-07 | 4.00e-23 | 0.9472 |
1. PBF | Q3AS97 | 50S ribosomal protein L27 | 4.39e-13 | 1.45e-20 | 7.23e-21 | 0.9083 |
1. PBF | B5ZB18 | 50S ribosomal protein L27 | 4.05e-09 | 7.68e-33 | 1.94e-35 | 0.7977 |
1. PBF | Q97JL5 | 50S ribosomal protein L27 | 0.00e+00 | 5.59e-28 | 1.38e-34 | 0.8704 |
1. PBF | A9L429 | 50S ribosomal protein L27 | 4.84e-13 | 4.18e-18 | 2.08e-22 | 0.8811 |
1. PBF | C3M9X6 | 50S ribosomal protein L27 | 0.00e+00 | 1.85e-12 | 1.19e-23 | 0.9571 |
1. PBF | B0C3C2 | 50S ribosomal protein L27 | 3.33e-16 | 7.14e-18 | 3.33e-30 | 0.9422 |
1. PBF | A0JXJ9 | 50S ribosomal protein L27 | 0.00e+00 | 8.60e-15 | 1.47e-22 | 0.9184 |
1. PBF | Q6LV48 | 50S ribosomal protein L27 | 4.20e-12 | 1.10e-14 | 3.31e-22 | 0.8743 |
1. PBF | B9DU56 | 50S ribosomal protein L27 | 7.17e-14 | 2.21e-43 | 1.28e-34 | 0.8705 |
1. PBF | A8M0Z0 | 50S ribosomal protein L27 | 3.11e-15 | 1.35e-18 | 2.67e-24 | 0.9208 |
1. PBF | A2C4B8 | 50S ribosomal protein L27 | 3.12e-14 | 8.74e-10 | 5.40e-25 | 0.8376 |
1. PBF | Q747N0 | 50S ribosomal protein L27 | 7.55e-15 | 5.38e-18 | 1.34e-33 | 0.9118 |
1. PBF | B2GGD8 | 50S ribosomal protein L27 | 0.00e+00 | 1.89e-19 | 3.14e-24 | 0.9358 |
1. PBF | A4G8R5 | 50S ribosomal protein L27 | 0.00e+00 | 1.34e-15 | 5.14e-25 | 0.8936 |
1. PBF | Q6D9C5 | 50S ribosomal protein L27 | 8.88e-16 | 3.42e-13 | 4.42e-21 | 0.9187 |
1. PBF | B1KGH0 | 50S ribosomal protein L27 | 0.00e+00 | 7.14e-18 | 2.59e-22 | 0.8989 |
1. PBF | P66137 | 50S ribosomal protein L27 | 1.67e-15 | 1.60e-39 | 1.64e-35 | 0.9148 |
1. PBF | A8YVX6 | 50S ribosomal protein L27 | 0.00e+00 | 8.70e-27 | 1.88e-35 | 0.8865 |
1. PBF | Q5NGR1 | 50S ribosomal protein L27 | 1.04e-12 | 6.71e-18 | 4.69e-23 | 0.8994 |
1. PBF | Q1CBZ2 | 50S ribosomal protein L27 | 1.03e-14 | 1.23e-15 | 5.77e-24 | 0.9024 |
1. PBF | A4YKF6 | 50S ribosomal protein L27 | 0.00e+00 | 1.34e-07 | 2.08e-20 | 0.9388 |
1. PBF | B3QPY8 | 50S ribosomal protein L27 | 1.11e-15 | 9.08e-21 | 7.35e-23 | 0.9298 |
1. PBF | B2HMG2 | 50S ribosomal protein L27 | 4.44e-15 | 9.11e-14 | 2.31e-24 | 0.9115 |
1. PBF | A1AXH4 | 50S ribosomal protein L27 | 2.68e-14 | 2.12e-19 | 9.10e-21 | 0.9077 |
1. PBF | A0PU16 | 50S ribosomal protein L27 | 0.00e+00 | 1.93e-12 | 4.56e-24 | 0.9102 |
1. PBF | Q3JNF9 | 50S ribosomal protein L27 | 1.56e-13 | 4.34e-13 | 5.44e-23 | 0.8953 |
1. PBF | A9AI61 | 50S ribosomal protein L27 | 6.66e-16 | 3.22e-15 | 2.32e-23 | 0.9265 |
1. PBF | Q0BRF0 | 50S ribosomal protein L27 | 0.00e+00 | 2.80e-10 | 3.18e-21 | 0.94 |
1. PBF | A8G8Z2 | 50S ribosomal protein L27 | 4.22e-15 | 1.95e-18 | 6.52e-22 | 0.9333 |
1. PBF | Q6AK06 | 50S ribosomal protein L27 | 2.11e-15 | 2.69e-16 | 1.70e-24 | 0.9594 |
1. PBF | Q4FRD8 | 50S ribosomal protein L27 | 4.44e-16 | 2.07e-17 | 2.40e-17 | 0.9242 |
1. PBF | Q8VW58 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9608 |
1. PBF | Q634A1 | 50S ribosomal protein L27 | 0.00e+00 | 2.43e-39 | 4.78e-41 | 0.8762 |
1. PBF | B8IEL7 | 50S ribosomal protein L27 | 0.00e+00 | 5.63e-10 | 2.00e-21 | 0.9423 |
1. PBF | B4SP13 | 50S ribosomal protein L27 | 0.00e+00 | 3.01e-11 | 6.00e-21 | 0.9264 |
1. PBF | B1I4P7 | 50S ribosomal protein L27 | 0.00e+00 | 2.93e-19 | 8.17e-32 | 0.9614 |
1. PBF | Q5N598 | 50S ribosomal protein L27 | 0.00e+00 | 5.89e-13 | 6.25e-31 | 0.9614 |
1. PBF | Q17Y99 | 50S ribosomal protein L27 | 5.78e-14 | 1.95e-12 | 3.72e-25 | 0.868 |
1. PBF | B0TBW5 | 50S ribosomal protein L27 | 2.22e-16 | 3.05e-43 | 1.87e-36 | 0.918 |
1. PBF | Q0TNI4 | 50S ribosomal protein L27 | 1.85e-13 | 2.81e-29 | 1.10e-38 | 0.8885 |
1. PBF | B5RMX2 | 50S ribosomal protein L27 | 0.00e+00 | 2.86e-18 | 4.45e-20 | 0.9251 |
1. PBF | Q9K8J7 | 50S ribosomal protein L27 | 0.00e+00 | 1.85e-40 | 3.62e-38 | 0.9562 |
1. PBF | P41548 | 50S ribosomal protein L27, chloroplastic (Fragment) | 0.00e+00 | 2.09e-09 | 3.38e-13 | 0.9638 |
1. PBF | B7JQ28 | 50S ribosomal protein L27 | 0.00e+00 | 2.43e-39 | 4.78e-41 | 0.9376 |
1. PBF | B3EEE4 | 50S ribosomal protein L27 | 1.09e-14 | 8.07e-21 | 4.62e-20 | 0.9173 |
1. PBF | C1DEA5 | 50S ribosomal protein L27 | 4.44e-16 | 3.39e-19 | 2.17e-23 | 0.9298 |
1. PBF | A1SMB5 | 50S ribosomal protein L27 | 0.00e+00 | 3.30e-23 | 1.06e-27 | 0.9189 |
1. PBF | A7NKS0 | 50S ribosomal protein L27 | 0.00e+00 | 2.90e-16 | 4.75e-22 | 0.9692 |
1. PBF | B9E020 | 50S ribosomal protein L27 | 0.00e+00 | 4.12e-27 | 1.46e-38 | 0.9526 |
1. PBF | B9K8D0 | 50S ribosomal protein L27 | 0.00e+00 | 3.50e-22 | 1.46e-20 | 0.9474 |
1. PBF | C1FVW6 | 50S ribosomal protein L27 | 4.66e-15 | 1.65e-24 | 1.27e-40 | 0.9169 |
1. PBF | A7FMT7 | 50S ribosomal protein L27 | 6.11e-15 | 1.23e-15 | 5.77e-24 | 0.9063 |
1. PBF | Q28Q14 | 50S ribosomal protein L27 | 0.00e+00 | 1.47e-13 | 8.55e-19 | 0.9562 |
1. PBF | A8F2N7 | 50S ribosomal protein L27 | 0.00e+00 | 2.41e-14 | 9.87e-24 | 0.9427 |
1. PBF | Q8ZBA7 | 50S ribosomal protein L27 | 3.77e-15 | 1.23e-15 | 5.77e-24 | 0.9065 |
1. PBF | Q2P5B5 | 50S ribosomal protein L27 | 2.80e-14 | 9.83e-13 | 3.57e-21 | 0.8983 |
1. PBF | Q67SC7 | 50S ribosomal protein L27 | 9.99e-16 | 1.22e-26 | 1.36e-34 | 0.935 |
1. PBF | Q07YI9 | 50S ribosomal protein L27 | 6.66e-16 | 5.64e-16 | 8.91e-22 | 0.9241 |
1. PBF | A5IAS6 | 50S ribosomal protein L27 | 2.33e-15 | 7.06e-10 | 1.14e-23 | 0.9271 |
1. PBF | B5REQ1 | 50S ribosomal protein L27 | 2.80e-14 | 7.84e-19 | 2.00e-22 | 0.9098 |
1. PBF | Q1R0C1 | 50S ribosomal protein L27 | 1.11e-16 | 2.49e-16 | 1.29e-22 | 0.9116 |
1. PBF | C4K1G6 | 50S ribosomal protein L27 | 0.00e+00 | 6.42e-15 | 1.90e-24 | 0.9323 |
1. PBF | A1TC22 | 50S ribosomal protein L27 | 0.00e+00 | 1.10e-13 | 3.85e-23 | 0.9192 |
1. PBF | Q98EZ0 | 50S ribosomal protein L27 | 4.33e-15 | 1.08e-07 | 1.55e-23 | 0.9054 |
1. PBF | C5CXX4 | 50S ribosomal protein L27 | 5.34e-13 | 4.93e-15 | 1.59e-22 | 0.8884 |
1. PBF | C4XNW1 | 50S ribosomal protein L27 | 0.00e+00 | 1.89e-05 | 4.49e-22 | 0.9037 |
1. PBF | B8HA20 | 50S ribosomal protein L27 | 1.11e-16 | 8.60e-15 | 1.47e-22 | 0.9262 |
1. PBF | B7KFE2 | 50S ribosomal protein L27 | 2.22e-15 | 3.75e-05 | 1.48e-30 | 0.9525 |
1. PBF | B1IBP4 | 50S ribosomal protein L27 | 2.73e-13 | 2.72e-43 | 6.26e-35 | 0.8938 |
1. PBF | B1XHG1 | 50S ribosomal protein L27 | 3.33e-16 | 1.01e-16 | 1.27e-21 | 0.9172 |
1. PBF | Q1IVS6 | 50S ribosomal protein L27 | 1.78e-14 | 3.70e-12 | 7.85e-23 | 0.9264 |
1. PBF | A7N0G1 | 50S ribosomal protein L27 | 0.00e+00 | 4.94e-14 | 1.01e-22 | 0.8982 |
1. PBF | C0PZJ7 | 50S ribosomal protein L27 | 4.74e-14 | 7.84e-19 | 2.00e-22 | 0.8973 |
1. PBF | A8Z2H3 | 50S ribosomal protein L27 | 0.00e+00 | 5.71e-45 | 3.62e-40 | 0.8573 |
1. PBF | Q5FUL3 | 50S ribosomal protein L27 | 0.00e+00 | 1.45e-13 | 9.86e-21 | 0.9443 |
1. PBF | P74267 | 50S ribosomal protein L27 | 1.11e-16 | 3.62e-15 | 1.34e-30 | 0.9525 |
1. PBF | Q4ZYK2 | 50S ribosomal protein L27 | 0.00e+00 | 1.21e-09 | 4.05e-20 | 0.9212 |
1. PBF | Q1BZE1 | 50S ribosomal protein L27 | 0.00e+00 | 6.50e-17 | 1.90e-23 | 0.9042 |
1. PBF | Q9Z807 | 50S ribosomal protein L27 | 1.11e-16 | 3.85e-17 | 1.16e-24 | 0.9338 |
1. PBF | Q2LR76 | 50S ribosomal protein L27 | 4.00e-15 | 1.57e-12 | 7.37e-25 | 0.9382 |
1. PBF | Q31IT5 | 50S ribosomal protein L27 | 1.55e-15 | 2.46e-17 | 1.30e-21 | 0.9197 |
1. PBF | P0A7M0 | 50S ribosomal protein L27 | 4.44e-16 | 1.01e-16 | 1.27e-21 | 0.921 |
1. PBF | Q3YRY1 | 50S ribosomal protein L27 | 2.44e-15 | 6.17e-16 | 1.91e-17 | 0.9345 |
1. PBF | A9NBL4 | 50S ribosomal protein L27 | 0.00e+00 | 9.65e-14 | 5.80e-19 | 0.9463 |
1. PBF | A7HT69 | 50S ribosomal protein L27 | 2.98e-14 | 5.39e-08 | 2.71e-18 | 0.8969 |
1. PBF | C3PLM9 | 50S ribosomal protein L27 | 1.44e-15 | 1.99e-16 | 7.11e-23 | 0.9371 |
1. PBF | Q2FG82 | 50S ribosomal protein L27 | 9.95e-12 | 5.71e-45 | 3.62e-40 | 0.8376 |
1. PBF | A3M899 | 50S ribosomal protein L27 | 1.11e-16 | 1.28e-15 | 4.30e-20 | 0.9383 |
1. PBF | A3Q2F4 | 50S ribosomal protein L27 | 7.77e-16 | 1.01e-13 | 1.09e-24 | 0.9173 |
1. PBF | Q46JC1 | 50S ribosomal protein L27 | 1.11e-16 | 8.74e-10 | 5.40e-25 | 0.8693 |
1. PBF | Q02ZA6 | 50S ribosomal protein L27 | 1.16e-12 | 5.35e-42 | 1.57e-34 | 0.872 |
1. PBF | B1XPD9 | 50S ribosomal protein L27 | 0.00e+00 | 5.80e-15 | 2.97e-31 | 0.9651 |
1. PBF | Q03FZ9 | 50S ribosomal protein L27 | 1.09e-12 | 8.70e-27 | 7.58e-33 | 0.9324 |
1. PBF | A5GD28 | 50S ribosomal protein L27 | 6.04e-14 | 2.07e-17 | 2.14e-31 | 0.9028 |
1. PBF | A7ZC11 | 50S ribosomal protein L27 | 1.44e-15 | 3.23e-16 | 9.94e-26 | 0.9392 |
1. PBF | P0A7M1 | 50S ribosomal protein L27 | 1.22e-15 | 1.01e-16 | 1.27e-21 | 0.9123 |
1. PBF | Q2JNE2 | 50S ribosomal protein L27 | 0.00e+00 | 4.21e-09 | 7.00e-29 | 0.9418 |
1. PBF | Q8DYV5 | 50S ribosomal protein L27 | 6.05e-11 | 1.44e-40 | 3.62e-35 | 0.8476 |
1. PBF | Q0SR53 | 50S ribosomal protein L27 | 1.11e-16 | 2.81e-29 | 1.10e-38 | 0.9172 |
1. PBF | Q11XX3 | 50S ribosomal protein L27 | 0.00e+00 | 1.19e-08 | 1.66e-24 | 0.9609 |
1. PBF | Q83G56 | 50S ribosomal protein L27 | 1.11e-16 | 1.20e-14 | 1.90e-24 | 0.9419 |
1. PBF | Q2GK21 | 50S ribosomal protein L27 | 8.88e-16 | 1.01e-14 | 7.64e-20 | 0.9153 |
1. PBF | B1LBJ4 | 50S ribosomal protein L27 | 0.00e+00 | 3.69e-22 | 3.23e-18 | 0.9483 |
1. PBF | A1KVV9 | 50S ribosomal protein L27 | 0.00e+00 | 3.62e-11 | 1.21e-21 | 0.9116 |
1. PBF | Q74IL5 | 50S ribosomal protein L27 | 6.06e-11 | 1.68e-31 | 9.33e-36 | 0.8409 |
1. PBF | C1KVI7 | 50S ribosomal protein L27 | 9.26e-13 | 2.32e-34 | 5.05e-38 | 0.8843 |
1. PBF | Q8EVW5 | 50S ribosomal protein L27 | 0.00e+00 | 3.18e-45 | 1.66e-37 | 0.9288 |
1. PBF | P47476 | 50S ribosomal protein L27 | 0.00e+00 | 3.25e-31 | 6.11e-35 | 0.9145 |
1. PBF | B9KER2 | 50S ribosomal protein L27 | 0.00e+00 | 1.69e-17 | 2.01e-25 | 0.968 |
1. PBF | A7Z783 | 50S ribosomal protein L27 | 9.99e-16 | 9.30e-51 | 4.06e-44 | 0.8941 |
1. PBF | B8GYX1 | 50S ribosomal protein L27 | 9.99e-16 | 8.57e-11 | 9.34e-22 | 0.9076 |
1. PBF | Q0SM74 | 50S ribosomal protein L27 | 0.00e+00 | 3.50e-19 | 9.68e-22 | 0.9436 |
1. PBF | A1VK91 | 50S ribosomal protein L27 | 3.71e-14 | 1.56e-17 | 1.05e-22 | 0.9123 |
1. PBF | A1VXH8 | 50S ribosomal protein L27 | 7.77e-15 | 3.20e-17 | 1.04e-24 | 0.9406 |
1. PBF | Q889F2 | 50S ribosomal protein L27 | 0.00e+00 | 1.21e-09 | 4.05e-20 | 0.9227 |
1. PBF | B0RY33 | 50S ribosomal protein L27 | 1.67e-14 | 3.79e-15 | 3.03e-21 | 0.9017 |
1. PBF | A4JBB7 | 50S ribosomal protein L27 | 4.19e-13 | 6.50e-17 | 1.90e-23 | 0.8967 |
1. PBF | B4S9F0 | 50S ribosomal protein L27 | 3.99e-13 | 1.89e-25 | 6.84e-20 | 0.8977 |
1. PBF | B5R0H6 | 50S ribosomal protein L27 | 6.66e-16 | 7.84e-19 | 2.00e-22 | 0.921 |
1. PBF | Q12F98 | 50S ribosomal protein L27 | 1.33e-15 | 1.97e-14 | 5.54e-25 | 0.8827 |
1. PBF | Q1IW73 | 50S ribosomal protein L27 | 1.44e-15 | 1.29e-07 | 8.16e-20 | 0.9287 |
1. PBF | Q2NCD6 | 50S ribosomal protein L27 | 0.00e+00 | 1.57e-09 | 1.34e-18 | 0.9455 |
1. PBF | Q4K5T7 | 50S ribosomal protein L27 | 5.13e-14 | 1.80e-18 | 2.03e-21 | 0.907 |
1. PBF | Q4UK85 | 50S ribosomal protein L27 | 2.22e-16 | 8.86e-14 | 8.61e-24 | 0.9369 |
1. PBF | Q3ZYN4 | 50S ribosomal protein L27 | 0.00e+00 | 5.73e-18 | 1.32e-24 | 0.926 |
1. PBF | Q5E872 | 50S ribosomal protein L27 | 9.99e-16 | 9.30e-13 | 8.43e-23 | 0.9163 |
1. PBF | Q0AHG6 | 50S ribosomal protein L27 | 4.85e-14 | 4.13e-11 | 1.90e-21 | 0.9118 |
1. PBF | Q9CBZ3 | 50S ribosomal protein L27 | 0.00e+00 | 1.33e-12 | 1.74e-24 | 0.9216 |
1. PBF | Q0SH50 | 50S ribosomal protein L27 | 0.00e+00 | 1.34e-11 | 1.48e-25 | 0.9307 |
1. PBF | Q72ZY3 | 50S ribosomal protein L27 | 8.67e-14 | 4.12e-40 | 7.01e-41 | 0.8823 |
1. PBF | A9H0E8 | 50S ribosomal protein L27 | 9.99e-16 | 3.57e-13 | 3.23e-22 | 0.9304 |
1. PBF | B9MDZ6 | 50S ribosomal protein L27 | 2.87e-13 | 5.98e-16 | 2.32e-23 | 0.8904 |
1. PBF | Q8DUQ4 | 50S ribosomal protein L27 | 0.00e+00 | 1.16e-43 | 6.27e-36 | 0.8919 |
1. PBF | B1VGM0 | 50S ribosomal protein L27 | 5.66e-15 | 7.16e-12 | 5.15e-27 | 0.9226 |
1. PBF | Q1LIP9 | 50S ribosomal protein L27 | 6.66e-16 | 2.24e-12 | 6.64e-25 | 0.8831 |
1. PBF | C5C3W6 | 50S ribosomal protein L27 | 0.00e+00 | 5.70e-14 | 2.08e-21 | 0.9278 |
1. PBF | B2I6V7 | 50S ribosomal protein L27 | 1.33e-15 | 3.19e-18 | 5.38e-21 | 0.9128 |
1. PBF | A8FFT0 | 50S ribosomal protein L27 | 0.00e+00 | 8.59e-49 | 8.37e-45 | 0.919 |
1. PBF | A8H0U3 | 50S ribosomal protein L27 | 1.20e-13 | 1.89e-18 | 2.32e-22 | 0.8832 |
1. PBF | A0LPF8 | 50S ribosomal protein L27 | 0.00e+00 | 2.61e-09 | 8.06e-22 | 0.9603 |
1. PBF | Q5KWP3 | 50S ribosomal protein L27 | 0.00e+00 | 2.27e-44 | 2.76e-43 | 0.9555 |
1. PBF | Q13U14 | 50S ribosomal protein L27 | 2.22e-16 | 8.46e-11 | 2.05e-23 | 0.8885 |
1. PBF | B8JBP3 | 50S ribosomal protein L27 | 2.22e-16 | 2.53e-16 | 1.64e-20 | 0.9502 |
1. PBF | O87885 | 50S ribosomal protein L27 | 9.89e-14 | 1.11e-16 | 1.41e-18 | 0.8798 |
1. PBF | A9WUU3 | 50S ribosomal protein L27 | 0.00e+00 | 2.48e-14 | 1.56e-21 | 0.9416 |
1. PBF | B8HUY8 | 50S ribosomal protein L27 | 1.67e-15 | 1.35e-09 | 6.22e-31 | 0.9414 |
1. PBF | B1Y281 | 50S ribosomal protein L27 | 2.89e-14 | 1.47e-14 | 2.22e-23 | 0.9071 |
1. PBF | B2TK69 | 50S ribosomal protein L27 | 3.13e-14 | 1.52e-27 | 1.87e-38 | 0.9202 |
1. PBF | A6WDN0 | 50S ribosomal protein L27 | 1.11e-16 | 1.77e-17 | 2.79e-23 | 0.9208 |
1. PBF | Q3AF53 | 50S ribosomal protein L27 | 8.03e-14 | 8.99e-15 | 7.71e-32 | 0.8855 |
1. PBF | B8F874 | 50S ribosomal protein L27 | 5.47e-14 | 4.12e-21 | 1.53e-23 | 0.9149 |
1. PBF | B2A6B5 | 50S ribosomal protein L27 | 1.78e-15 | 1.15e-23 | 1.46e-32 | 0.9255 |
1. PBF | Q6MGS4 | 50S ribosomal protein L27 | 1.55e-15 | 3.41e-12 | 7.30e-24 | 0.9462 |
1. PBF | Q31W62 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-16 | 1.27e-21 | 0.9273 |
1. PBF | C4K900 | 50S ribosomal protein L27 | 7.77e-16 | 3.13e-16 | 3.34e-24 | 0.9221 |
1. PBF | Q9Z3H6 | 50S ribosomal protein L27 | 0.00e+00 | 5.89e-13 | 6.25e-31 | 0.9706 |
1. PBF | Q04KI2 | 50S ribosomal protein L27 | 1.08e-13 | 2.72e-43 | 6.26e-35 | 0.8686 |
1. PBF | A6WXR7 | 50S ribosomal protein L27 | 0.00e+00 | 2.30e-12 | 2.61e-23 | 0.9667 |
1. PBF | Q5LGR6 | 50S ribosomal protein L27 | 5.22e-15 | 1.04e-10 | 7.25e-26 | 0.949 |
1. PBF | Q7U8R7 | 50S ribosomal protein L27 | 2.22e-16 | 1.33e-12 | 3.89e-25 | 0.893 |
1. PBF | Q2A2E5 | 50S ribosomal protein L27 | 4.41e-14 | 1.58e-16 | 2.92e-22 | 0.9099 |
1. PBF | B0KMF5 | 50S ribosomal protein L27 | 2.32e-14 | 5.91e-18 | 8.66e-22 | 0.9092 |
1. PBF | Q0I1P7 | 50S ribosomal protein L27 | 8.63e-14 | 4.72e-21 | 8.71e-23 | 0.8948 |
1. PBF | Q68VZ8 | 50S ribosomal protein L27 | 0.00e+00 | 5.39e-15 | 7.46e-24 | 0.9532 |
1. PBF | Q2G9U8 | 50S ribosomal protein L27 | 0.00e+00 | 1.84e-10 | 2.46e-19 | 0.9505 |
1. PBF | B5FIN4 | 50S ribosomal protein L27 | 1.09e-14 | 7.84e-19 | 2.00e-22 | 0.9083 |
1. PBF | A0K4A9 | 50S ribosomal protein L27 | 7.54e-14 | 6.50e-17 | 1.90e-23 | 0.9046 |
1. PBF | P66131 | 50S ribosomal protein L27 | 4.88e-15 | 7.84e-19 | 2.00e-22 | 0.9136 |
1. PBF | B3EP07 | 50S ribosomal protein L27 | 1.11e-16 | 3.92e-21 | 4.81e-15 | 0.957 |
1. PBF | C4L4N3 | 50S ribosomal protein L27 | 8.96e-13 | 7.81e-48 | 5.15e-42 | 0.8686 |
1. PBF | A1R0K3 | 50S ribosomal protein L27 | 0.00e+00 | 9.06e-19 | 1.07e-19 | 0.9287 |
1. PBF | A5FJP6 | 50S ribosomal protein L27 | 0.00e+00 | 3.19e-18 | 2.13e-23 | 0.9722 |
1. PBF | B2FTD2 | 50S ribosomal protein L27 | 1.54e-14 | 9.49e-12 | 7.30e-21 | 0.9105 |
1. PBF | B2K2P0 | 50S ribosomal protein L27 | 2.84e-14 | 1.23e-15 | 5.77e-24 | 0.8983 |
1. PBF | Q65ZZ4 | 50S ribosomal protein L27 | 0.00e+00 | 3.03e-19 | 3.14e-20 | 0.9371 |
1. PBF | B2HXU8 | 50S ribosomal protein L27 | 3.33e-16 | 1.28e-15 | 4.30e-20 | 0.933 |
1. PBF | Q5NR21 | 50S ribosomal protein L27 | 0.00e+00 | 6.69e-09 | 3.74e-17 | 0.9418 |
1. PBF | B9DNE8 | 50S ribosomal protein L27 | 2.66e-15 | 1.68e-45 | 2.00e-38 | 0.8854 |
1. PBF | B4SFQ9 | 50S ribosomal protein L27 | 5.33e-15 | 1.82e-23 | 1.32e-21 | 0.9321 |
1. PBF | Q89ZR3 | 50S ribosomal protein L27 | 2.44e-15 | 4.59e-13 | 2.62e-26 | 0.9038 |
1. PBF | Q9RY65 | 50S ribosomal protein L27 | 1.11e-15 | 1.87e-09 | 3.31e-17 | 0.9495 |
1. PBF | Q7VZX5 | 50S ribosomal protein L27 | 2.12e-13 | 3.21e-14 | 7.71e-24 | 0.8959 |
1. PBF | Q72DK1 | 50S ribosomal protein L27 | 6.66e-16 | 5.31e-14 | 2.14e-22 | 0.9005 |
1. PBF | Q4G3B1 | 50S ribosomal protein L27, chloroplastic | 1.35e-11 | 7.56e-13 | 4.63e-20 | 0.8656 |
1. PBF | Q6F8G2 | 50S ribosomal protein L27 | 1.02e-14 | 6.81e-18 | 1.20e-19 | 0.9208 |
1. PBF | B2RLC1 | 50S ribosomal protein L27 | 7.77e-16 | 1.32e-19 | 2.07e-22 | 0.9387 |
1. PBF | Q4FP47 | 50S ribosomal protein L27 | 1.11e-16 | 8.86e-15 | 2.31e-21 | 0.9479 |
1. PBF | A1JIV4 | 50S ribosomal protein L27 | 1.33e-15 | 6.65e-16 | 6.07e-23 | 0.9132 |
1. PBF | Q3AZG4 | 50S ribosomal protein L27 | 1.11e-16 | 1.55e-12 | 1.51e-24 | 0.9018 |
1. PBF | P07844 | 50S ribosomal protein L27 | 0.00e+00 | 4.92e-19 | 5.08e-39 | 0.9249 |
1. PBF | Q8NN51 | 50S ribosomal protein L27 | 0.00e+00 | 8.97e-16 | 2.15e-25 | 0.9377 |
1. PBF | A1WY49 | 50S ribosomal protein L27 | 1.05e-13 | 2.03e-14 | 9.65e-20 | 0.8905 |
1. PBF | B5FGF8 | 50S ribosomal protein L27 | 4.44e-16 | 9.30e-13 | 8.43e-23 | 0.9168 |
1. PBF | P41545 | 50S ribosomal protein L27, chloroplastic | 1.33e-15 | 5.32e-17 | 3.77e-19 | 0.9345 |
1. PBF | B1JMJ6 | 50S ribosomal protein L27 | 1.65e-14 | 1.23e-15 | 5.77e-24 | 0.8999 |
1. PBF | Q5HX71 | 50S ribosomal protein L27 | 0.00e+00 | 3.20e-17 | 1.04e-24 | 0.9417 |
1. PBF | B1ZZL7 | 50S ribosomal protein L27 | 1.75e-14 | 4.47e-20 | 2.49e-18 | 0.8695 |
1. PBF | B8E0B3 | 50S ribosomal protein L27 | 0.00e+00 | 1.70e-13 | 2.73e-20 | 0.9319 |
1. PBF | C3K1X7 | 50S ribosomal protein L27 | 6.66e-16 | 6.50e-18 | 1.26e-20 | 0.9033 |
1. PBF | B2STB9 | 50S ribosomal protein L27 | 2.11e-15 | 9.83e-13 | 3.57e-21 | 0.9129 |
1. PBF | Q87BL1 | 50S ribosomal protein L27 | 3.44e-15 | 3.19e-18 | 5.38e-21 | 0.9092 |
1. PBF | B3E330 | 50S ribosomal protein L27 | 0.00e+00 | 1.68e-14 | 1.13e-31 | 0.9522 |
1. PBF | Q0AKX6 | 50S ribosomal protein L27 | 0.00e+00 | 7.31e-08 | 3.52e-20 | 0.9463 |
1. PBF | B0KAC0 | 50S ribosomal protein L27 | 1.62e-13 | 1.11e-26 | 2.00e-37 | 0.9639 |
1. PBF | B0TUI1 | 50S ribosomal protein L27 | 3.33e-16 | 1.89e-18 | 2.32e-22 | 0.89 |
1. PBF | A9VYM7 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-11 | 8.28e-21 | 0.9333 |
1. PBF | B4TWF5 | 50S ribosomal protein L27 | 4.73e-14 | 7.84e-19 | 2.00e-22 | 0.894 |
1. PBF | B5XSV6 | 50S ribosomal protein L27 | 2.78e-15 | 2.35e-16 | 2.08e-23 | 0.9098 |
1. PBF | B0VSH6 | 50S ribosomal protein L27 | 4.44e-16 | 1.28e-15 | 4.30e-20 | 0.9337 |
1. PBF | Q1R6F2 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9203 |
1. PBF | Q7MA29 | 50S ribosomal protein L27 | 0.00e+00 | 1.34e-15 | 6.96e-28 | 0.9679 |
1. PBF | Q8EB81 | 50S ribosomal protein L27 | 7.99e-15 | 2.69e-17 | 2.59e-22 | 0.9161 |
1. PBF | B6J9K3 | 50S ribosomal protein L27 | 0.00e+00 | 9.65e-14 | 5.80e-19 | 0.9477 |
1. PBF | Q5WTF0 | 50S ribosomal protein L27 | 0.00e+00 | 7.06e-10 | 1.14e-23 | 0.9515 |
1. PBF | Q0K6P5 | 50S ribosomal protein L27 | 3.89e-15 | 1.14e-12 | 2.03e-24 | 0.8802 |
1. PBF | A8HRT6 | 50S ribosomal protein L27 | 0.00e+00 | 1.09e-11 | 5.20e-25 | 0.9673 |
1. PBF | Q3B2R5 | 50S ribosomal protein L27 | 0.00e+00 | 1.90e-21 | 3.87e-20 | 0.9125 |
1. PBF | Q0VSE7 | 50S ribosomal protein L27 | 1.33e-15 | 3.00e-18 | 2.73e-22 | 0.9251 |
1. PBF | Q14I63 | 50S ribosomal protein L27 | 1.83e-13 | 6.71e-18 | 4.69e-23 | 0.9048 |
1. PBF | Q5PLB5 | 50S ribosomal protein L27 | 2.66e-15 | 7.84e-19 | 2.00e-22 | 0.9136 |
1. PBF | A3NDS9 | 50S ribosomal protein L27 | 1.15e-13 | 4.34e-13 | 5.44e-23 | 0.8969 |
1. PBF | C1CZK0 | 50S ribosomal protein L27 | 2.55e-14 | 5.21e-10 | 3.65e-17 | 0.9441 |
1. PBF | Q2NIJ9 | 50S ribosomal protein L27 | 0.00e+00 | 9.00e-43 | 4.30e-38 | 0.9344 |
1. PBF | Q8D278 | 50S ribosomal protein L27 | 7.77e-15 | 9.75e-12 | 9.79e-17 | 0.9314 |
1. PBF | A9WWX2 | 50S ribosomal protein L27 | 6.62e-14 | 3.33e-13 | 6.88e-24 | 0.9521 |
1. PBF | Q4L6Z1 | 50S ribosomal protein L27 | 0.00e+00 | 1.05e-45 | 2.97e-39 | 0.9297 |
1. PBF | P51210 | 50S ribosomal protein L27, chloroplastic | 0.00e+00 | 1.16e-12 | 1.69e-25 | 0.9496 |
1. PBF | Q9ZCI8 | 50S ribosomal protein L27 | 0.00e+00 | 3.12e-14 | 2.85e-24 | 0.9348 |
1. PBF | A3PQI8 | 50S ribosomal protein L27 | 2.13e-14 | 8.21e-10 | 1.08e-18 | 0.8968 |
1. PBF | B8DVU0 | 50S ribosomal protein L27 | 0.00e+00 | 3.97e-17 | 1.79e-17 | 0.9299 |
1. PBF | A4QG84 | 50S ribosomal protein L27 | 0.00e+00 | 8.97e-16 | 2.15e-25 | 0.942 |
1. PBF | B4RNP1 | 50S ribosomal protein L27 | 0.00e+00 | 4.13e-11 | 7.22e-22 | 0.9138 |
1. PBF | A1SSB5 | 50S ribosomal protein L27 | 9.55e-15 | 2.29e-18 | 4.07e-22 | 0.9184 |
1. PBF | P41552 | 50S ribosomal protein L27, chloroplastic (Fragment) | 0.00e+00 | 4.04e-07 | 7.55e-17 | 0.9713 |
1. PBF | Q15PE9 | 50S ribosomal protein L27 | 2.22e-16 | 1.81e-15 | 3.33e-21 | 0.8985 |
1. PBF | B3DPS3 | 50S ribosomal protein L27 | 0.00e+00 | 3.16e-20 | 3.42e-19 | 0.9211 |
1. PBF | Q0T099 | 50S ribosomal protein L27 | 4.44e-16 | 1.01e-16 | 1.27e-21 | 0.9187 |
1. PBF | Q6KHY5 | 50S ribosomal protein L27 | 0.00e+00 | 1.70e-12 | 1.31e-23 | 0.9291 |
1. PBF | B0BU26 | 50S ribosomal protein L27 | 0.00e+00 | 4.18e-20 | 4.14e-23 | 0.9082 |
1. PBF | B3EUD7 | 50S ribosomal protein L27 | 0.00e+00 | 7.58e-14 | 5.74e-23 | 0.9697 |
1. PBF | Q88WN3 | 50S ribosomal protein L27 | 4.61e-14 | 1.05e-39 | 8.76e-34 | 0.9273 |
1. PBF | Q2GCN3 | 50S ribosomal protein L27 | 0.00e+00 | 3.25e-23 | 1.33e-17 | 0.9675 |
1. PBF | Q8G4U1 | 50S ribosomal protein L27 | 0.00e+00 | 3.16e-20 | 3.42e-19 | 0.9205 |
1. PBF | B2V8X4 | 50S ribosomal protein L27 | 8.88e-16 | 1.38e-16 | 7.13e-25 | 0.924 |
1. PBF | Q1CUK6 | 50S ribosomal protein L27 | 1.04e-12 | 1.56e-13 | 1.47e-26 | 0.8734 |
1. PBF | B3GZE6 | 50S ribosomal protein L27 | 9.86e-14 | 4.18e-20 | 4.14e-23 | 0.9129 |
1. PBF | A9KEJ8 | 50S ribosomal protein L27 | 0.00e+00 | 1.28e-13 | 1.18e-18 | 0.9486 |
1. PBF | A4XAG2 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-16 | 5.78e-26 | 0.9163 |
1. PBF | Q4A5L3 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-16 | 5.22e-30 | 0.9411 |
1. PBF | B3PRY9 | 50S ribosomal protein L27 | 2.33e-15 | 2.40e-12 | 5.49e-25 | 0.9096 |
1. PBF | B4UIU3 | 50S ribosomal protein L27 | 1.11e-16 | 2.53e-16 | 1.64e-20 | 0.9552 |
1. PBF | C4L9M2 | 50S ribosomal protein L27 | 1.71e-14 | 4.92e-16 | 3.25e-23 | 0.9235 |
1. PBF | P66136 | 50S ribosomal protein L27 | 0.00e+00 | 6.27e-42 | 6.19e-35 | 0.8126 |
1. PBF | B7JZA3 | 50S ribosomal protein L27 | 0.00e+00 | 3.11e-13 | 1.18e-27 | 0.9703 |
1. PBF | B1WWL8 | 50S ribosomal protein L27 | 0.00e+00 | 5.26e-12 | 5.62e-30 | 0.9467 |
1. PBF | A9IM57 | 50S ribosomal protein L27 | 0.00e+00 | 2.08e-11 | 1.72e-25 | 0.9598 |
1. PBF | B1JVA0 | 50S ribosomal protein L27 | 1.94e-14 | 6.50e-17 | 1.90e-23 | 0.911 |
1. PBF | Q0BZ41 | 50S ribosomal protein L27 | 2.22e-16 | 1.71e-09 | 1.09e-15 | 0.9599 |
1. PBF | A1R788 | 50S ribosomal protein L27 | 0.00e+00 | 4.40e-13 | 4.77e-23 | 0.9193 |
1. PBF | Q7NME2 | 50S ribosomal protein L27 | 0.00e+00 | 3.03e-04 | 9.74e-32 | 0.9092 |
1. PBF | B7HE75 | 50S ribosomal protein L27 | 7.77e-16 | 4.12e-40 | 7.01e-41 | 0.9184 |
1. PBF | B5E957 | 50S ribosomal protein L27 | 1.65e-14 | 2.52e-18 | 3.25e-31 | 0.9502 |
1. PBF | Q0RPF7 | 50S ribosomal protein L27 | 2.33e-15 | 7.90e-10 | 6.48e-23 | 0.9186 |
1. PBF | P66128 | 50S ribosomal protein L27 | 0.00e+00 | 1.17e-14 | 1.41e-24 | 0.9236 |
1. PBF | Q493U6 | 50S ribosomal protein L27 | 1.33e-15 | 3.51e-17 | 4.89e-19 | 0.925 |
1. PBF | Q2S9T2 | 50S ribosomal protein L27 | 5.55e-16 | 6.45e-16 | 6.24e-23 | 0.9242 |
1. PBF | A8FRU3 | 50S ribosomal protein L27 | 1.44e-12 | 1.28e-17 | 7.94e-23 | 0.8778 |
1. PBF | Q39JU8 | 50S ribosomal protein L27 | 1.34e-14 | 6.50e-17 | 1.90e-23 | 0.9147 |
1. PBF | A8GTK7 | 50S ribosomal protein L27 | 0.00e+00 | 7.69e-14 | 1.96e-24 | 0.9344 |
1. PBF | A1BHN8 | 50S ribosomal protein L27 | 2.22e-16 | 1.28e-21 | 7.07e-20 | 0.9442 |
1. PBF | B3QSH7 | 50S ribosomal protein L27 | 4.66e-15 | 5.81e-16 | 7.04e-18 | 0.9231 |
1. PBF | A5VSI8 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9648 |
1. PBF | P9WHB2 | 50S ribosomal protein L27 | 1.22e-15 | 1.17e-14 | 1.41e-24 | 0.9121 |
1. PBF | B8EQH6 | 50S ribosomal protein L27 | 0.00e+00 | 4.68e-08 | 3.21e-21 | 0.9607 |
1. PBF | C3L6X4 | 50S ribosomal protein L27 | 0.00e+00 | 2.43e-39 | 4.78e-41 | 0.9507 |
1. PBF | Q64XL7 | 50S ribosomal protein L27 | 5.44e-14 | 1.04e-10 | 7.25e-26 | 0.8974 |
1. PBF | B7KSH3 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-11 | 8.28e-21 | 0.9361 |
1. PBF | C3P9C8 | 50S ribosomal protein L27 | 4.44e-16 | 2.43e-39 | 4.78e-41 | 0.9222 |
1. PBF | A1S9H4 | 50S ribosomal protein L27 | 3.41e-13 | 2.48e-18 | 2.37e-22 | 0.8968 |
1. PBF | Q1B628 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-13 | 1.09e-24 | 0.9188 |
1. PBF | P66132 | 50S ribosomal protein L27 | 1.33e-15 | 7.84e-19 | 2.00e-22 | 0.9167 |
1. PBF | Q9L1I1 | 50S ribosomal protein L27 | 1.11e-16 | 9.30e-24 | 8.20e-26 | 0.9184 |
1. PBF | A0T0V7 | 50S ribosomal protein L27, chloroplastic | 1.11e-16 | 1.09e-19 | 4.87e-24 | 0.9617 |
1. PBF | A6H1P8 | 50S ribosomal protein L27 | 0.00e+00 | 2.46e-20 | 2.14e-24 | 0.9625 |
1. PBF | B2VGT1 | 50S ribosomal protein L27 | 1.33e-15 | 8.62e-18 | 3.57e-20 | 0.9237 |
1. PBF | Q3SKG3 | 50S ribosomal protein L27 | 3.11e-15 | 4.07e-12 | 1.28e-22 | 0.9288 |
1. PBF | A8EZV2 | 50S ribosomal protein L27 | 1.11e-16 | 1.28e-13 | 1.42e-23 | 0.9409 |
1. PBF | Q24SN8 | 50S ribosomal protein L27 | 0.00e+00 | 1.11e-29 | 7.09e-33 | 0.9619 |
1. PBF | Q5HB48 | 50S ribosomal protein L27 | 1.11e-16 | 6.21e-14 | 4.89e-18 | 0.9513 |
1. PBF | A3QB94 | 50S ribosomal protein L27 | 7.77e-16 | 8.06e-17 | 7.04e-23 | 0.9144 |
1. PBF | B2UNV3 | 50S ribosomal protein L27 | 8.33e-15 | 3.14e-12 | 1.39e-21 | 0.8358 |
1. PBF | B4TJ23 | 50S ribosomal protein L27 | 5.36e-13 | 7.84e-19 | 2.00e-22 | 0.8919 |
1. PBF | Q72NQ6 | 50S ribosomal protein L27 | 1.29e-14 | 4.32e-19 | 4.66e-24 | 0.9349 |
1. PBF | A0AIY9 | 50S ribosomal protein L27 | 0.00e+00 | 2.32e-34 | 5.05e-38 | 0.9518 |
1. PBF | A1UJ08 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-13 | 1.09e-24 | 0.9176 |
1. PBF | B6J1S9 | 50S ribosomal protein L27 | 0.00e+00 | 9.65e-14 | 5.80e-19 | 0.9417 |
1. PBF | P66134 | 50S ribosomal protein L27 | 1.10e-11 | 5.71e-45 | 3.62e-40 | 0.8425 |
1. PBF | C5CDI0 | 50S ribosomal protein L27 | 0.00e+00 | 1.24e-19 | 1.79e-20 | 0.9433 |
1. PBF | O78430 | 50S ribosomal protein L27, chloroplastic | 0.00e+00 | 2.07e-15 | 6.81e-26 | 0.9685 |
1. PBF | B5ZA63 | 50S ribosomal protein L27 | 0.00e+00 | 1.56e-13 | 1.47e-26 | 0.9199 |
1. PBF | Q6YRC7 | 50S ribosomal protein L27 | 8.55e-14 | 9.00e-43 | 4.30e-38 | 0.8577 |
1. PBF | Q18B22 | 50S ribosomal protein L27 | 0.00e+00 | 2.09e-37 | 7.66e-38 | 0.9263 |
1. PBF | C4Z9Z8 | 50S ribosomal protein L27 | 1.11e-16 | 4.82e-39 | 2.38e-39 | 0.9387 |
1. PBF | Q65S55 | 50S ribosomal protein L27 | 7.22e-15 | 8.92e-19 | 2.84e-22 | 0.9062 |
1. PBF | A5WDV1 | 50S ribosomal protein L27 | 2.49e-14 | 2.41e-19 | 1.65e-19 | 0.9167 |
1. PBF | A9N752 | 50S ribosomal protein L27 | 2.44e-15 | 7.84e-19 | 2.00e-22 | 0.9115 |
1. PBF | A1TYY3 | 50S ribosomal protein L27 | 6.78e-14 | 3.56e-17 | 6.79e-25 | 0.9022 |
1. PBF | Q2GGS4 | 50S ribosomal protein L27 | 1.11e-16 | 1.12e-15 | 2.43e-17 | 0.9621 |
1. PBF | B5YEQ2 | 50S ribosomal protein L27 | 0.00e+00 | 9.51e-19 | 3.11e-20 | 0.931 |
1. PBF | A8A500 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9193 |
1. PBF | B2U1Z2 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-16 | 1.27e-21 | 0.925 |
1. PBF | A1W4A9 | 50S ribosomal protein L27 | 2.01e-13 | 5.98e-16 | 2.32e-23 | 0.8925 |
1. PBF | A6WK50 | 50S ribosomal protein L27 | 1.39e-13 | 4.18e-18 | 2.08e-22 | 0.8852 |
1. PBF | Q5WES5 | 50S ribosomal protein L27 | 1.89e-15 | 6.43e-41 | 5.59e-39 | 0.8896 |
1. PBF | Q0AAD7 | 50S ribosomal protein L27 | 9.99e-16 | 1.17e-18 | 1.45e-20 | 0.9241 |
1. PBF | B8ZPV1 | 50S ribosomal protein L27 | 2.29e-12 | 2.72e-43 | 6.26e-35 | 0.7894 |
1. PBF | A3MR89 | 50S ribosomal protein L27 | 9.10e-15 | 4.34e-13 | 5.44e-23 | 0.9079 |
1. PBF | Q73LW3 | 50S ribosomal protein L27 | 3.33e-16 | 1.72e-18 | 4.25e-16 | 0.9271 |
1. PBF | P75458 | 50S ribosomal protein L27 | 2.03e-13 | 1.38e-34 | 1.06e-37 | 0.822 |
1. PBF | Q10ZG7 | 50S ribosomal protein L27 | 6.22e-14 | 8.32e-06 | 1.38e-26 | 0.9109 |
1. PBF | A5CVV8 | 50S ribosomal protein L27 | 3.33e-15 | 1.30e-19 | 2.50e-21 | 0.9115 |
1. PBF | C1C7A1 | 50S ribosomal protein L27 | 2.00e-11 | 2.72e-43 | 6.26e-35 | 0.7798 |
1. PBF | Q1RGM8 | 50S ribosomal protein L27 | 0.00e+00 | 1.19e-12 | 1.96e-23 | 0.9413 |
1. PBF | Q02GB0 | 50S ribosomal protein L27 | 6.48e-14 | 1.86e-19 | 7.07e-21 | 0.9085 |
1. PBF | Q1MA80 | 50S ribosomal protein L27 | 0.00e+00 | 2.14e-09 | 1.75e-24 | 0.9638 |
1. PBF | B7NKQ2 | 50S ribosomal protein L27 | 1.11e-16 | 1.01e-16 | 1.27e-21 | 0.9219 |
1. PBF | A4TRJ8 | 50S ribosomal protein L27 | 0.00e+00 | 1.23e-15 | 5.77e-24 | 0.8875 |
1. PBF | Q5L6S0 | 50S ribosomal protein L27 | 0.00e+00 | 1.35e-18 | 8.29e-26 | 0.9513 |
1. PBF | B6EL42 | 50S ribosomal protein L27 | 2.55e-15 | 5.78e-14 | 1.03e-22 | 0.9173 |
1. PBF | Q5H2E6 | 50S ribosomal protein L27 | 5.00e-15 | 9.83e-13 | 3.57e-21 | 0.9105 |
1. PBF | Q1GZ52 | 50S ribosomal protein L27 | 4.44e-16 | 5.95e-14 | 5.59e-22 | 0.933 |
1. PBF | Q2YLL8 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9612 |
1. PBF | A7H030 | 50S ribosomal protein L27 | 4.12e-14 | 2.86e-16 | 2.23e-25 | 0.9202 |
1. PBF | Q0BL03 | 50S ribosomal protein L27 | 1.10e-14 | 1.58e-16 | 2.92e-22 | 0.9084 |
1. PBF | Q6G507 | 50S ribosomal protein L27 | 0.00e+00 | 2.94e-13 | 6.94e-26 | 0.9526 |
1. PBF | Q73XP4 | 50S ribosomal protein L27 | 0.00e+00 | 2.54e-15 | 2.69e-23 | 0.9091 |
1. PBF | A9WGJ4 | 50S ribosomal protein L27 | 0.00e+00 | 2.66e-06 | 6.10e-22 | 0.9478 |
1. PBF | A4F9L2 | 50S ribosomal protein L27 | 0.00e+00 | 4.52e-18 | 1.57e-28 | 0.9334 |
1. PBF | A1URM7 | 50S ribosomal protein L27 | 0.00e+00 | 8.49e-14 | 3.91e-25 | 0.9569 |
1. PBF | B5F6V4 | 50S ribosomal protein L27 | 6.88e-14 | 7.84e-19 | 2.00e-22 | 0.8941 |
1. PBF | Q1AVU2 | 50S ribosomal protein L27 | 0.00e+00 | 9.81e-15 | 6.36e-29 | 0.9369 |
1. PBF | Q6HD83 | 50S ribosomal protein L27 | 5.34e-13 | 2.43e-39 | 4.78e-41 | 0.8956 |
1. PBF | A3PEH9 | 50S ribosomal protein L27 | 3.33e-16 | 9.67e-15 | 4.84e-25 | 0.8947 |
1. PBF | B6IR00 | 50S ribosomal protein L27 | 0.00e+00 | 8.48e-05 | 7.92e-22 | 0.9023 |
1. PBF | A4SVA2 | 50S ribosomal protein L27 | 3.89e-15 | 1.65e-15 | 2.30e-26 | 0.925 |
1. PBF | B2SDE7 | 50S ribosomal protein L27 | 1.17e-14 | 6.71e-18 | 4.69e-23 | 0.911 |
1. PBF | Q5M158 | 50S ribosomal protein L27 | 8.11e-10 | 9.50e-47 | 1.10e-35 | 0.7844 |
1. PBF | A6VMT9 | 50S ribosomal protein L27 | 0.00e+00 | 8.92e-19 | 2.84e-22 | 0.9079 |
1. PBF | C5CAZ4 | 50S ribosomal protein L27 | 0.00e+00 | 4.52e-18 | 8.24e-23 | 0.9248 |
1. PBF | Q5XCS5 | 50S ribosomal protein L27 | 3.83e-14 | 1.60e-39 | 1.64e-35 | 0.8879 |
1. PBF | A7IH94 | 50S ribosomal protein L27 | 0.00e+00 | 1.35e-08 | 4.77e-24 | 0.9411 |
1. PBF | Q049M5 | 50S ribosomal protein L27 | 0.00e+00 | 2.63e-34 | 1.20e-35 | 0.8272 |
1. PBF | B2SYV3 | 50S ribosomal protein L27 | 1.43e-13 | 2.57e-11 | 4.67e-23 | 0.8892 |
1. PBF | B7LHP5 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9222 |
1. PBF | Q83ED9 | 50S ribosomal protein L27 | 0.00e+00 | 9.65e-14 | 5.80e-19 | 0.9423 |
1. PBF | Q3SVI4 | 50S ribosomal protein L27 | 0.00e+00 | 2.54e-08 | 5.17e-21 | 0.9541 |
1. PBF | A8G6F6 | 50S ribosomal protein L27 | 1.55e-15 | 9.67e-15 | 4.84e-25 | 0.8927 |
1. PBF | Q605N3 | 50S ribosomal protein L27 | 2.22e-16 | 3.95e-10 | 8.24e-23 | 0.9317 |
1. PBF | Q47AD1 | 50S ribosomal protein L27 | 0.00e+00 | 1.91e-10 | 2.11e-22 | 0.9329 |
1. PBF | A0RR38 | 50S ribosomal protein L27 | 0.00e+00 | 1.03e-15 | 2.41e-25 | 0.933 |
1. PBF | A5UI24 | 50S ribosomal protein L27 | 3.33e-16 | 3.74e-19 | 4.59e-22 | 0.8942 |
1. PBF | Q3Z6W2 | 50S ribosomal protein L27 | 0.00e+00 | 8.63e-19 | 2.98e-24 | 0.9198 |
1. PBF | Q165Y3 | 50S ribosomal protein L27 | 0.00e+00 | 1.30e-10 | 2.06e-20 | 0.9446 |
1. PBF | C3PI04 | 50S ribosomal protein L27 | 0.00e+00 | 3.53e-07 | 2.65e-27 | 0.9067 |
1. PBF | A8AWF9 | 50S ribosomal protein L27 | 9.52e-13 | 6.83e-43 | 2.69e-35 | 0.8474 |
1. PBF | B8GQQ2 | 50S ribosomal protein L27 | 1.53e-13 | 2.90e-15 | 8.04e-25 | 0.8834 |
1. PBF | C3LRG7 | 50S ribosomal protein L27 | 1.33e-15 | 7.35e-13 | 8.52e-22 | 0.9197 |
1. PBF | B1AIJ8 | 50S ribosomal protein L27 | 0.00e+00 | 1.05e-30 | 2.70e-36 | 0.8595 |
1. PBF | P59513 | 50S ribosomal protein L27 | 1.11e-16 | 2.78e-11 | 4.37e-23 | 0.9396 |
1. PBF | B8CSY4 | 50S ribosomal protein L27 | 2.74e-13 | 1.89e-18 | 2.32e-22 | 0.884 |
1. PBF | A1WPR6 | 50S ribosomal protein L27 | 0.00e+00 | 1.05e-12 | 1.30e-20 | 0.9318 |
1. PBF | B7LR52 | 50S ribosomal protein L27 | 0.00e+00 | 1.01e-16 | 1.27e-21 | 0.9251 |
1. PBF | A8L1V7 | 50S ribosomal protein L27 | 5.21e-14 | 1.46e-04 | 1.56e-21 | 0.897 |
1. PBF | A2RLA2 | 50S ribosomal protein L27 | 4.92e-12 | 5.35e-42 | 1.57e-34 | 0.8515 |
1. PBF | Q6MEQ7 | 50S ribosomal protein L27 | 3.55e-15 | 4.25e-19 | 5.25e-25 | 0.907 |
1. PBF | Q7V0C1 | 50S ribosomal protein L27 | 2.00e-15 | 7.54e-15 | 3.97e-25 | 0.8902 |
1. PBF | B8ZRN4 | 50S ribosomal protein L27 | 0.00e+00 | 1.33e-12 | 1.74e-24 | 0.9241 |
1. PBF | C1AVK1 | 50S ribosomal protein L27 | 0.00e+00 | 1.05e-12 | 1.70e-25 | 0.9349 |
1. PBF | Q2YT85 | 50S ribosomal protein L27 | 3.60e-11 | 5.71e-45 | 3.62e-40 | 0.8326 |
1. PBF | A4VI53 | 50S ribosomal protein L27 | 0.00e+00 | 6.36e-19 | 3.47e-21 | 0.9156 |
1. PBF | A3NZJ1 | 50S ribosomal protein L27 | 1.10e-12 | 4.34e-13 | 5.44e-23 | 0.8928 |
1. PBF | Q1Q9X2 | 50S ribosomal protein L27 | 5.55e-16 | 2.07e-17 | 2.40e-17 | 0.9271 |
1. PBF | B0UMS2 | 50S ribosomal protein L27 | 0.00e+00 | 3.37e-04 | 5.81e-20 | 0.9221 |
1. PBF | Q6G8S4 | 50S ribosomal protein L27 | 0.00e+00 | 5.71e-45 | 3.62e-40 | 0.8287 |
1. PBF | A6VBV4 | 50S ribosomal protein L27 | 1.28e-14 | 1.86e-19 | 7.07e-21 | 0.9163 |
1. PBF | A5FV28 | 50S ribosomal protein L27 | 7.77e-16 | 1.71e-11 | 4.11e-22 | 0.9348 |
1. PBF | A1B9H4 | 50S ribosomal protein L27 | 0.00e+00 | 1.07e-10 | 1.11e-21 | 0.955 |
1. PBF | A7GHK3 | 50S ribosomal protein L27 | 0.00e+00 | 1.65e-24 | 1.27e-40 | 0.958 |
1. PBF | Q2JDP3 | 50S ribosomal protein L27 | 6.95e-14 | 1.40e-11 | 2.71e-21 | 0.908 |
1. PBF | A3DBS4 | 50S ribosomal protein L27 | 2.22e-16 | 5.26e-44 | 1.56e-40 | 0.934 |
1. PBF | P66125 | 50S ribosomal protein L27 | 0.00e+00 | 2.32e-34 | 5.05e-38 | 0.9309 |
1. PBF | Q7UPR5 | 50S ribosomal protein L27 | 1.29e-11 | 5.36e-20 | 6.92e-19 | 0.9063 |
1. PBF | A7NDG1 | 50S ribosomal protein L27 | 2.26e-13 | 1.58e-16 | 2.92e-22 | 0.903 |
1. PBF | Q83I11 | 50S ribosomal protein L27 | 0.00e+00 | 3.88e-13 | 7.63e-24 | 0.944 |
1. PBF | Q9PQT2 | 50S ribosomal protein L27 | 2.53e-11 | 1.05e-30 | 2.70e-36 | 0.885 |
1. PBF | A9MP21 | 50S ribosomal protein L27 | 1.14e-14 | 7.84e-19 | 2.00e-22 | 0.9004 |
1. PBF | A5F8P1 | 50S ribosomal protein L27 | 8.10e-15 | 7.35e-13 | 8.52e-22 | 0.9077 |
1. PBF | P66133 | 50S ribosomal protein L27 | 1.60e-11 | 5.71e-45 | 3.62e-40 | 0.837 |
1. PBF | Q3IFF5 | 50S ribosomal protein L27 | 2.89e-15 | 7.02e-17 | 4.88e-23 | 0.9198 |
1. PBF | Q0BIH9 | 50S ribosomal protein L27 | 5.73e-14 | 6.50e-17 | 1.90e-23 | 0.9064 |
1. PBF | A1VF57 | 50S ribosomal protein L27 | 2.33e-15 | 5.31e-14 | 2.14e-22 | 0.896 |
1. PBF | Q5P7Z5 | 50S ribosomal protein L27 | 2.22e-16 | 5.54e-14 | 1.07e-24 | 0.9231 |
1. PBF | B0RDG4 | 50S ribosomal protein L27 | 2.22e-16 | 4.93e-20 | 4.25e-26 | 0.9328 |
1. PBF | Q3J6S1 | 50S ribosomal protein L27 | 1.11e-16 | 1.24e-14 | 8.40e-19 | 0.9352 |
1. PBF | C1CKH0 | 50S ribosomal protein L27 | 5.13e-11 | 2.72e-43 | 6.26e-35 | 0.7846 |
1. PBF | B0UVI0 | 50S ribosomal protein L27 | 8.88e-16 | 4.72e-21 | 8.71e-23 | 0.9226 |
1. PBF | Q6B931 | 50S ribosomal protein L27, chloroplastic | 2.66e-15 | 1.75e-11 | 5.87e-21 | 0.9254 |
1. PBF | A8GPP8 | 50S ribosomal protein L27 | 3.54e-14 | 4.22e-14 | 2.30e-23 | 0.8816 |
1. PBF | A4VUF9 | 50S ribosomal protein L27 | 1.60e-14 | 4.49e-41 | 4.13e-35 | 0.9217 |
1. PBF | B1JF58 | 50S ribosomal protein L27 | 4.44e-16 | 1.50e-19 | 4.37e-23 | 0.907 |
1. PBF | A6TEK4 | 50S ribosomal protein L27 | 2.39e-14 | 2.35e-16 | 2.08e-23 | 0.8991 |
1. PBF | A6QHI7 | 50S ribosomal protein L27 | 8.44e-11 | 5.71e-45 | 3.62e-40 | 0.8312 |
1. PBF | Q8FYL8 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9618 |
1. PBF | Q5R033 | 50S ribosomal protein L27 | 0.00e+00 | 8.19e-17 | 8.29e-22 | 0.8991 |
1. PBF | Q7NBB0 | 50S ribosomal protein L27 | 1.70e-14 | 3.66e-45 | 5.59e-35 | 0.8683 |
1. PBF | B8I178 | 50S ribosomal protein L27 | 1.55e-15 | 2.82e-40 | 1.58e-33 | 0.9222 |
1. PBF | B3QZT2 | 50S ribosomal protein L27 | 0.00e+00 | 1.51e-36 | 5.51e-35 | 0.926 |
1. PBF | A1RMV7 | 50S ribosomal protein L27 | 7.99e-14 | 2.69e-17 | 2.59e-22 | 0.9023 |
1. PBF | B4T716 | 50S ribosomal protein L27 | 7.22e-15 | 7.84e-19 | 2.00e-22 | 0.9076 |
1. PBF | A5ITG9 | 50S ribosomal protein L27 | 1.33e-11 | 5.71e-45 | 3.62e-40 | 0.8379 |
1. PBF | A5FQ13 | 50S ribosomal protein L27 | 1.21e-12 | 5.73e-18 | 1.32e-24 | 0.9138 |
1. PBF | B9JEQ8 | 50S ribosomal protein L27 | 0.00e+00 | 6.29e-09 | 1.09e-24 | 0.9121 |
1. PBF | Q0TCS5 | 50S ribosomal protein L27 | 6.13e-14 | 8.36e-18 | 2.93e-20 | 0.898 |
1. PBF | Q8RBA7 | 50S ribosomal protein L27 | 2.22e-16 | 1.32e-23 | 1.73e-36 | 0.9405 |
1. PBF | P66126 | 50S ribosomal protein L27 | 8.88e-16 | 2.32e-34 | 5.05e-38 | 0.904 |
1. PBF | Q7NZS2 | 50S ribosomal protein L27 | 1.67e-14 | 2.82e-13 | 1.42e-20 | 0.9155 |
1. PBF | B2V0A7 | 50S ribosomal protein L27 | 2.17e-13 | 2.53e-25 | 1.97e-38 | 0.9 |
1. PBF | A0RJ49 | 50S ribosomal protein L27 | 3.38e-14 | 2.43e-39 | 4.78e-41 | 0.9073 |
1. PBF | B8J4L4 | 50S ribosomal protein L27 | 0.00e+00 | 1.77e-13 | 2.02e-19 | 0.9199 |
1. PBF | Q65GM5 | 50S ribosomal protein L27 | 7.22e-15 | 4.37e-48 | 2.66e-44 | 0.9212 |
1. PBF | B1ZL17 | 50S ribosomal protein L27 | 0.00e+00 | 3.87e-11 | 6.09e-21 | 0.9394 |
1. PBF | B8FM67 | 50S ribosomal protein L27 | 0.00e+00 | 1.37e-14 | 1.55e-22 | 0.9775 |
1. PBF | B3R899 | 50S ribosomal protein L27 | 2.16e-12 | 1.46e-12 | 1.11e-24 | 0.8877 |
1. PBF | Q48NL3 | 50S ribosomal protein L27 | 0.00e+00 | 1.21e-09 | 4.05e-20 | 0.9361 |
1. PBF | B1IQT8 | 50S ribosomal protein L27 | 2.22e-16 | 1.01e-16 | 1.27e-21 | 0.9256 |
1. PBF | B4RD67 | 50S ribosomal protein L27 | 0.00e+00 | 8.85e-07 | 7.63e-23 | 0.9676 |
1. PBF | B9LJ75 | 50S ribosomal protein L27 | 0.00e+00 | 2.66e-06 | 6.10e-22 | 0.9472 |
1. PBF | Q9ZMD8 | 50S ribosomal protein L27 | 2.89e-15 | 8.80e-13 | 3.03e-26 | 0.9382 |
1. PBF | B7HQK0 | 50S ribosomal protein L27 | 1.33e-15 | 4.12e-40 | 7.01e-41 | 0.9104 |
1. PBF | A4XJS7 | 50S ribosomal protein L27 | 3.33e-16 | 3.66e-31 | 3.33e-36 | 0.8895 |
1. PBF | P05657 | 50S ribosomal protein L27 | 1.33e-15 | 7.81e-48 | 2.06e-44 | 0.9017 |
1. PBF | A7HIF9 | 50S ribosomal protein L27 | 0.00e+00 | 6.71e-15 | 1.86e-19 | 0.95 |
1. PBF | B1YSU6 | 50S ribosomal protein L27 | 1.34e-14 | 6.50e-17 | 1.90e-23 | 0.9131 |
1. PBF | A5UWR7 | 50S ribosomal protein L27 | 0.00e+00 | 3.56e-19 | 3.75e-23 | 0.9716 |
1. PBF | P66139 | 50S ribosomal protein L27 | 5.32e-14 | 1.60e-39 | 1.64e-35 | 0.9028 |
1. PBF | Q8K9G2 | 50S ribosomal protein L27 | 1.11e-16 | 8.63e-20 | 7.64e-22 | 0.9367 |
1. PBF | Q1LSJ8 | 50S ribosomal protein L27 | 2.22e-16 | 1.88e-17 | 6.99e-24 | 0.9411 |
1. PBF | A8ZRY0 | 50S ribosomal protein L27 | 0.00e+00 | 1.86e-17 | 1.87e-17 | 0.9568 |
1. PBF | B7J428 | 50S ribosomal protein L27 | 2.55e-14 | 6.26e-19 | 2.34e-22 | 0.8961 |
1. PBF | Q8F7U1 | 50S ribosomal protein L27 | 2.60e-14 | 4.32e-19 | 4.66e-24 | 0.9292 |
1. PBF | A5GN79 | 50S ribosomal protein L27 | 1.89e-15 | 1.04e-11 | 4.98e-25 | 0.8856 |
1. PBF | Q5ZS69 | 50S ribosomal protein L27 | 0.00e+00 | 7.06e-10 | 1.14e-23 | 0.9284 |
1. PBF | Q1XDS7 | 50S ribosomal protein L27, chloroplastic | 0.00e+00 | 3.62e-11 | 5.00e-25 | 0.9602 |
1. PBF | Q0HLU1 | 50S ribosomal protein L27 | 1.55e-15 | 7.70e-17 | 2.12e-22 | 0.9228 |
1. PBF | B5ELU3 | 50S ribosomal protein L27 | 2.37e-13 | 6.26e-19 | 2.34e-22 | 0.9003 |
1. PBF | Q3MCZ8 | 50S ribosomal protein L27 | 0.00e+00 | 3.77e-06 | 8.50e-27 | 0.9154 |
1. PBF | Q9PJ31 | 50S ribosomal protein L27 | 0.00e+00 | 3.20e-17 | 1.04e-24 | 0.9643 |
1. PBF | A7FXU7 | 50S ribosomal protein L27 | 1.11e-16 | 1.65e-24 | 1.27e-40 | 0.9375 |
1. PBF | Q87SU3 | 50S ribosomal protein L27 | 7.77e-15 | 4.94e-14 | 1.01e-22 | 0.9074 |
1. PBF | C4LJU5 | 50S ribosomal protein L27 | 0.00e+00 | 1.92e-09 | 3.99e-27 | 0.9208 |
1. PBF | A4IZ44 | 50S ribosomal protein L27 | 1.18e-12 | 6.71e-18 | 4.69e-23 | 0.8951 |
1. PBF | B0VEJ5 | 50S ribosomal protein L27 | 2.44e-15 | 1.28e-15 | 4.30e-20 | 0.9211 |
1. PBF | C0R0P3 | 50S ribosomal protein L27 | 6.33e-15 | 7.06e-21 | 1.54e-18 | 0.927 |
1. PBF | B0TYK1 | 50S ribosomal protein L27 | 2.98e-14 | 8.91e-20 | 7.27e-23 | 0.9057 |
1. PBF | A7GTC2 | 50S ribosomal protein L27 | 3.38e-13 | 6.73e-41 | 2.27e-41 | 0.8924 |
1. PBF | Q3BW47 | 50S ribosomal protein L27 | 1.19e-13 | 3.06e-13 | 2.52e-21 | 0.8965 |
1. PBF | B5BGK9 | 50S ribosomal protein L27 | 4.99e-13 | 7.84e-19 | 2.00e-22 | 0.8835 |
1. PBF | B4F2A7 | 50S ribosomal protein L27 | 4.11e-15 | 6.20e-18 | 3.03e-22 | 0.9186 |
1. PBF | Q0HRZ7 | 50S ribosomal protein L27 | 7.11e-15 | 7.70e-17 | 2.12e-22 | 0.9183 |
1. PBF | P60493 | 50S ribosomal protein L27 | 6.66e-16 | 1.56e-17 | 1.86e-23 | 0.9501 |
1. PBF | A5EVR0 | 50S ribosomal protein L27 | 1.11e-16 | 2.36e-12 | 1.70e-18 | 0.9397 |
1. PBF | A7H1G9 | 50S ribosomal protein L27 | 0.00e+00 | 3.20e-17 | 1.04e-24 | 0.9664 |
1. PBF | Q03M32 | 50S ribosomal protein L27 | 0.00e+00 | 9.50e-47 | 1.10e-35 | 0.8316 |
1. PBF | Q1CEJ8 | 50S ribosomal protein L27 | 6.00e-15 | 1.23e-15 | 5.77e-24 | 0.907 |
1. PBF | B2S1C2 | 50S ribosomal protein L27 | 0.00e+00 | 5.96e-19 | 1.26e-19 | 0.9245 |
1. PBF | Q39QR5 | 50S ribosomal protein L27 | 0.00e+00 | 6.33e-15 | 1.16e-33 | 0.9614 |
1. PBF | Q8FN77 | 50S ribosomal protein L27 | 1.94e-14 | 3.26e-14 | 1.37e-27 | 0.9264 |
1. PBF | Q6AFY2 | 50S ribosomal protein L27 | 0.00e+00 | 2.60e-18 | 6.01e-26 | 0.952 |
1. PBF | O51721 | 50S ribosomal protein L27 | 0.00e+00 | 3.50e-19 | 9.68e-22 | 0.9471 |
1. PBF | Q2SS74 | 50S ribosomal protein L27 | 8.57e-14 | 7.26e-86 | 2.78e-61 | 0.8573 |
1. PBF | Q8REI3 | 50S ribosomal protein L27 | 2.18e-14 | 6.73e-41 | 3.12e-31 | 0.8982 |
1. PBF | Q6NFV6 | 50S ribosomal protein L27 | 2.89e-15 | 1.24e-16 | 2.76e-27 | 0.9283 |
1. PBF | Q2L060 | 50S ribosomal protein L27 | 5.71e-13 | 1.60e-15 | 2.81e-23 | 0.8876 |
1. PBF | C6E8U2 | 50S ribosomal protein L27 | 0.00e+00 | 3.67e-17 | 9.30e-31 | 0.9035 |
1. PBF | Q8UBR6 | 50S ribosomal protein L27 | 1.33e-15 | 4.31e-09 | 4.82e-23 | 0.9354 |
1. PBF | B9IZ18 | 50S ribosomal protein L27 | 8.99e-15 | 4.12e-40 | 7.01e-41 | 0.9181 |
1. PBF | P56050 | 50S ribosomal protein L27 | 0.00e+00 | 1.56e-13 | 1.47e-26 | 0.9249 |
1. PBF | C0M7I0 | 50S ribosomal protein L27 | 0.00e+00 | 2.18e-45 | 9.50e-36 | 0.8513 |
1. PBF | A9VIR7 | 50S ribosomal protein L27 | 1.11e-12 | 2.43e-39 | 4.78e-41 | 0.8677 |
1. PBF | Q054P5 | 50S ribosomal protein L27 | 1.29e-14 | 4.32e-19 | 4.66e-24 | 0.9265 |
1. PBF | C6DKH7 | 50S ribosomal protein L27 | 9.99e-16 | 4.60e-14 | 3.05e-21 | 0.9172 |
1. PBF | Q7WQL7 | 50S ribosomal protein L27 | 2.96e-13 | 3.21e-14 | 7.71e-24 | 0.8926 |
1. PBF | B8CXZ1 | 50S ribosomal protein L27 | 4.33e-15 | 1.95e-11 | 2.92e-33 | 0.9467 |
1. PBF | B7NDG9 | 50S ribosomal protein L27 | 5.55e-16 | 1.01e-16 | 1.27e-21 | 0.9161 |
1. PBF | Q9KUS9 | 50S ribosomal protein L27 | 1.25e-14 | 7.35e-13 | 8.52e-22 | 0.9046 |
1. PBF | A3CMS1 | 50S ribosomal protein L27 | 0.00e+00 | 9.35e-45 | 2.81e-35 | 0.8501 |
1. PBF | Q9HVL7 | 50S ribosomal protein L27 | 2.33e-15 | 1.86e-19 | 7.07e-21 | 0.9288 |
1. PBF | P0DE29 | 50S ribosomal protein L27 | 2.71e-11 | 1.60e-39 | 1.64e-35 | 0.8032 |
1. PBF | Q4JWU0 | 50S ribosomal protein L27 | 0.00e+00 | 1.37e-13 | 1.55e-25 | 0.9333 |
1. PBF | Q62GV3 | 50S ribosomal protein L27 | 0.00e+00 | 4.34e-13 | 5.44e-23 | 0.8991 |
1. PBF | Q3AHR5 | 50S ribosomal protein L27 | 2.09e-14 | 1.41e-12 | 1.31e-24 | 0.8397 |
1. PBF | A3D179 | 50S ribosomal protein L27 | 4.36e-13 | 4.18e-18 | 2.08e-22 | 0.882 |
1. PBF | Q3IXY1 | 50S ribosomal protein L27 | 2.66e-15 | 8.21e-10 | 1.08e-18 | 0.9024 |
1. PBF | B7MBV4 | 50S ribosomal protein L27 | 1.11e-16 | 1.01e-16 | 1.27e-21 | 0.9268 |
1. PBF | B0SRT6 | 50S ribosomal protein L27 | 0.00e+00 | 1.40e-21 | 5.35e-24 | 0.9528 |
1. PBF | Q8DEC5 | 50S ribosomal protein L27 | 2.35e-14 | 2.44e-14 | 3.90e-22 | 0.8996 |
1. PBF | B6JKM6 | 50S ribosomal protein L27 | 6.45e-11 | 1.56e-13 | 1.47e-26 | 0.8624 |
1. PBF | A0R150 | 50S ribosomal protein L27 | 0.00e+00 | 2.19e-11 | 4.34e-25 | 0.9282 |
1. PBF | Q49Y83 | 50S ribosomal protein L27 | 7.67e-14 | 4.11e-45 | 7.71e-39 | 0.87 |
1. PBF | B1KZR4 | 50S ribosomal protein L27 | 8.88e-15 | 1.65e-24 | 1.27e-40 | 0.9062 |
1. PBF | A4SFT3 | 50S ribosomal protein L27 | 3.30e-13 | 2.15e-18 | 5.76e-19 | 0.906 |
1. PBF | B9M3W2 | 50S ribosomal protein L27 | 0.00e+00 | 1.10e-13 | 4.71e-31 | 0.977 |
1. PBF | Q82V19 | 50S ribosomal protein L27 | 1.89e-14 | 6.46e-10 | 1.10e-21 | 0.9168 |
1. PBF | A6U2B3 | 50S ribosomal protein L27 | 3.97e-12 | 5.71e-45 | 3.62e-40 | 0.8323 |
1. PBF | C1D505 | 50S ribosomal protein L27 | 7.33e-15 | 1.98e-10 | 6.91e-19 | 0.9219 |
1. PBF | P57468 | 50S ribosomal protein L27 | 0.00e+00 | 3.99e-19 | 3.45e-23 | 0.9398 |
1. PBF | Q931Q3 | 50S ribosomal protein L27 | 0.00e+00 | 5.71e-45 | 3.62e-40 | 0.8362 |
1. PBF | A5GV22 | 50S ribosomal protein L27 | 3.55e-15 | 2.15e-12 | 1.24e-25 | 0.9048 |
1. PBF | Q72HR3 | 50S ribosomal protein L27 | 1.41e-13 | 5.46e-18 | 7.59e-24 | 0.9143 |
1. PBF | Q6A9I2 | 50S ribosomal protein L27 | 1.14e-14 | 1.26e-10 | 3.31e-16 | 0.9223 |
1. PBF | B7M091 | 50S ribosomal protein L27 | 1.11e-16 | 1.01e-16 | 1.27e-21 | 0.9212 |
1. PBF | A9IFF7 | 50S ribosomal protein L27 | 0.00e+00 | 1.78e-15 | 7.80e-24 | 0.9391 |
1. PBF | Q2IH83 | 50S ribosomal protein L27 | 1.22e-15 | 2.53e-16 | 1.64e-20 | 0.9485 |
1. PBF | B5YJ66 | 50S ribosomal protein L27 | 1.89e-15 | 1.62e-11 | 2.79e-30 | 0.9557 |
1. PBF | Q2NW36 | 50S ribosomal protein L27 | 7.44e-14 | 1.19e-15 | 3.28e-25 | 0.891 |
1. PBF | B4U6N4 | 50S ribosomal protein L27 | 0.00e+00 | 2.86e-13 | 3.07e-25 | 0.9411 |
1. PBF | Q0I800 | 50S ribosomal protein L27 | 0.00e+00 | 3.83e-13 | 3.94e-26 | 0.8607 |
1. PBF | Q92LB7 | 50S ribosomal protein L27 | 3.33e-15 | 1.59e-09 | 7.15e-23 | 0.9323 |
1. PBF | C0QT35 | 50S ribosomal protein L27 | 0.00e+00 | 1.43e-14 | 2.16e-25 | 0.941 |
1. PBF | A9M886 | 50S ribosomal protein L27 | 0.00e+00 | 3.33e-13 | 6.88e-24 | 0.9657 |
1. PBF | B8DHK8 | 50S ribosomal protein L27 | 1.63e-13 | 2.32e-34 | 5.05e-38 | 0.8745 |
1. PBF | A9R588 | 50S ribosomal protein L27 | 2.33e-15 | 1.23e-15 | 5.77e-24 | 0.9101 |
1. PBF | A4J7J1 | 50S ribosomal protein L27 | 2.49e-11 | 7.01e-15 | 1.34e-33 | 0.9105 |
1. PBF | C1CRK7 | 50S ribosomal protein L27 | 2.03e-11 | 2.72e-43 | 6.26e-35 | 0.8369 |
1. PBF | Q8EPP8 | 50S ribosomal protein L27 | 1.11e-16 | 4.41e-43 | 4.99e-41 | 0.9119 |
1. PBF | Q5M5P6 | 50S ribosomal protein L27 | 7.52e-13 | 9.50e-47 | 1.10e-35 | 0.8464 |
1. PBF | Q2Y808 | 50S ribosomal protein L27 | 1.11e-16 | 1.56e-16 | 1.46e-22 | 0.9321 |
1. PBF | B5Y806 | 50S ribosomal protein L27 | 0.00e+00 | 1.58e-16 | 6.85e-19 | 0.9404 |
1. PBF | Q12K22 | 50S ribosomal protein L27 | 1.11e-16 | 1.38e-17 | 4.83e-22 | 0.9114 |
1. PBF | B0S9A2 | 50S ribosomal protein L27 | 1.11e-16 | 1.40e-21 | 5.35e-24 | 0.9598 |
1. PBF | A5VKS3 | 50S ribosomal protein L27 | 0.00e+00 | 2.36e-31 | 1.61e-33 | 0.8665 |
1. PBF | Q5PAS8 | 50S ribosomal protein L27 | 1.02e-12 | 1.68e-14 | 3.79e-19 | 0.9415 |
1. PBF | P41550 | 50S ribosomal protein L27, chloroplastic (Fragment) | 0.00e+00 | 2.19e-11 | 5.60e-12 | 0.9784 |
3. BF | B9L2M3 | 50S ribosomal protein L27 | 4.05e-14 | NA | 9.06e-28 | 0.9062 |
3. BF | Q6BIE4 | 54S ribosomal protein L2, mitochondrial | 1.27e-07 | NA | 1.71e-15 | 0.8134 |
3. BF | P0CQ49 | 54S ribosomal protein L27, mitochondrial | 1.05e-10 | NA | 4.89e-15 | 0.7557 |
3. BF | P48535 | 54S ribosomal protein L2, mitochondrial | 7.13e-05 | NA | 2.09e-16 | 0.842 |
3. BF | B2IV09 | 50S ribosomal protein L27 | 0.00e+00 | NA | 2.22e-28 | 0.9059 |
3. BF | P30155 | 50S ribosomal protein L27, chloroplastic | 9.99e-16 | NA | 5.44e-27 | 0.9129 |
3. BF | Q32PC3 | 39S ribosomal protein L27, mitochondrial | 3.59e-08 | NA | 3.37e-12 | 0.7799 |
3. BF | A0LSX0 | 50S ribosomal protein L27 | 1.11e-16 | NA | 1.48e-25 | 0.9194 |
3. BF | Q75ET6 | 54S ribosomal protein L2, mitochondrial | 5.49e-05 | NA | 7.75e-16 | 0.7496 |
3. BF | P82190 | 50S ribosomal protein L27, chloroplastic | 1.75e-08 | NA | 3.28e-26 | 0.8995 |
3. BF | Q6C9C4 | 54S ribosomal protein L2, mitochondrial | 2.53e-05 | NA | 3.37e-11 | 0.8424 |
3. BF | P0CQ48 | 54S ribosomal protein L27, mitochondrial | 2.81e-11 | NA | 4.89e-15 | 0.7777 |
3. BF | Q6FS31 | 54S ribosomal protein L2, mitochondrial | 2.61e-05 | NA | 2.12e-13 | 0.8436 |
3. BF | Q057J1 | 50S ribosomal protein L27 | 0.00e+00 | NA | 6.03e-19 | 0.8857 |
3. BF | C1A930 | 50S ribosomal protein L27 | 7.77e-16 | NA | 2.73e-19 | 0.9106 |
4. PB | Q9HDV5 | 54S ribosomal protein L27, mitochondrial | 1.07e-08 | 3.20e-06 | 1.30e-17 | NA |
4. PB | P0A7L8 | 50S ribosomal protein L27 | 1.67e-15 | 1.01e-16 | 1.27e-21 | NA |
4. PB | Q99N92 | 39S ribosomal protein L27, mitochondrial | 2.18e-08 | 2.60e-03 | 4.62e-10 | NA |
4. PB | Q2FXT0 | 50S ribosomal protein L27 | 1.46e-11 | 5.71e-45 | 3.62e-40 | NA |
4. PB | Q9P0M9 | 39S ribosomal protein L27, mitochondrial | 9.30e-09 | 3.62e-03 | 4.35e-12 | NA |
4. PB | P9WHB3 | 50S ribosomal protein L27 | 0.00e+00 | 1.17e-14 | 1.41e-24 | NA |
5. P | P49630 | 60S ribosomal protein L36 | 9.22e-01 | 3.38e-02 | NA | NA |
7. B | P41553 | 50S ribosomal protein L27, chloroplastic (Fragment) | 1.17e-07 | NA | 4.00e-12 | NA |
7. B | P12687 | 54S ribosomal protein L2, mitochondrial | 7.26e-05 | NA | 8.71e-15 | NA |
7. B | O65037 | 50S ribosomal protein L27, chloroplastic | 1.12e-14 | NA | 1.49e-25 | NA |
7. B | P41551 | 50S ribosomal protein L27, chloroplastic (Fragment) | 2.18e-07 | NA | 1.52e-11 | NA |
7. B | Q54XK0 | Probable 39S ribosomal protein L27, mitochondrial | 1.81e-10 | NA | 3.71e-18 | NA |
7. B | Q9FLN4 | 50S ribosomal protein L27, chloroplastic | 6.67e-14 | NA | 5.72e-25 | NA |