Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54825.1

JCVISYN3A_0504

16S rRNA (cytidine(1402)-2'-O)-methyltransferase.
M. mycoides homolog: Q6MT46.
TIGRfam Classification: 2=Generic.
Category: Nonessential.

Statistics

Total GO Annotation: 35
Unique PROST Go: 6
Unique BLAST Go: 0
Unique Foldseek Go: 17

Total Homologs: 419
Unique PROST Homologs: 160
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 150

Literature

Danchin and Fang [1]: 16S rRNA 2'-O-ribose C1402 methyltransferase|associates with RsmH (equivalog category)
Yang and Tsui [2]: Ribosomal RNA small subunit methyltransferase I
Antczak et al. [3]: rsmI; 16S rRNA (cytidine(1402)-2'-O)-methyltransferase
Zhang et al. [4]: GO:0070677|rRNA (cytosine-2'-O-)-methyltr ansferase activity
Bianchi et al. [5]: rRNA methyltransferase rsmI-like

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P67088 (Ribosomal RNA small subunit methyltransferase I) with a FATCAT P-Value: 0 and RMSD of 2.31 angstrom. The sequence alignment identity is 31.6%.
Structural alignment shown in left. Query protein AVX54825.1 colored as red in alignment, homolog P67088 colored as blue. Query protein AVX54825.1 is also shown in right top, homolog P67088 showed in right bottom. They are colored based on secondary structures.

  AVX54825.1 MIIQKTYK---NNKPTVYLITTPIGNLEDISLRAIQTLKQVDVICCEDTRTSKVLLDKYQITNNLLSLHKFNENLRIEQIINLLNQNKNIAIISDAGVPI 97
      P67088 M---KQHQSADNSQGQLYIVPTPIGNLADITQRALEVLQAVDLIAAEDTRHTGLLLQHFGINARLFALHDHNEQQKAETLLAKLQEGQNIALVSDAGTPL 97

  AVX54825.1 ISDPASYIINQLKELEINCNITAI-GAGSAYLHALISSGFLIDNHYFY-GFLKNKNKISKQNELNQLINQYGDSIICLYESVHRLKDTITCLNQLLDKNH 195
      P67088 INDPGYHLVRTCREAGI--RVVPLPGPCAA-ITALSAAG-LPSDRFCYEGFLPAKSK-GRRDAL-KAIEAEPRTLI-FYESTHRLLDSLEDIVAVLGESR 190

  AVX54825.1 KIVIAKELTKINEEIIYG-NINQINQYINSEKFVLKGEFVIVI-NKKIIDQIINYTDS-QLIDLIDQEIKNGYKLKQ----ACEIINLKTKISKNVLYKL 288
      P67088 YVVLARELTK-TWETIHGAPVGELLAWVKEDENRRKGEMVLIVEGHKAQEEDLP-ADALRTLALLQAEL----PLKKAAALAAEIHGVK----KNALYK- 279

  AVX54825.1 YTFKKNF 295
      P67088 YALEQQG 286

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0000453	enzyme-directed rRNA 2'-O-methylation
1. PBF	GO:0070677	rRNA (cytosine-2'-O-)-methyltransferase activity
2. PF	GO:0046026	precorrin-4 C11-methyltransferase activity
2. PF	GO:0004164	diphthine synthase activity
2. PF	GO:0004851	uroporphyrin-III C-methyltransferase activity
2. PF	GO:0009236	cobalamin biosynthetic process
2. PF	GO:0017183	peptidyl-diphthamide biosynthetic process from peptidyl-histidine
2. PF	GO:0008168	methyltransferase activity
2. PF	GO:0030789	precorrin-3B C17-methyltransferase activity
2. PF	GO:0032259	methylation
2. PF	GO:0019354	siroheme biosynthetic process
4. PB	GO:0005737	cytoplasm
5. P	GO:0005886	plasma membrane
5. P	GO:0005524	ATP binding
5. P	GO:0015940	pantothenate biosynthetic process
5. P	GO:0008840	4-hydroxy-tetrahydrodipicolinate synthase activity
5. P	GO:0004592	pantoate-beta-alanine ligase activity
5. P	GO:2000765	regulation of cytoplasmic translation
6. F	GO:0030788	precorrin-2 C20-methyltransferase activity
6. F	GO:0046025	precorrin-6Y C5,15-methyltransferase (decarboxylating) activity
6. F	GO:0016993	precorrin-8X methylmutase activity
6. F	GO:0043778	cobalt-precorrin-8 methylmutase activity
6. F	GO:0008276	protein methyltransferase activity
6. F	GO:0051287	NAD binding
6. F	GO:0043115	precorrin-2 dehydrogenase activity
6. F	GO:0051266	sirohydrochlorin ferrochelatase activity
6. F	GO:0043781	cobalt-factor II C20-methyltransferase activity
6. F	GO:0046052	UTP catabolic process
6. F	GO:0043819	precorrin-6A synthase (deacetylating) activity
6. F	GO:0004852	uroporphyrinogen-III synthase activity
6. F	GO:0046872	metal ion binding
6. F	GO:0043777	cobalt-precorrin-7 C15-methyltransferase activity
6. F	GO:0046047	TTP catabolic process
6. F	GO:0046061	dATP catabolic process
6. F	GO:0046076	dTTP catabolic process

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0000453	enzyme-directed rRNA 2'-O-methylation
GO:0070677	rRNA (cytosine-2'-O-)-methyltransferase activity
GO:0005737	cytoplasm
GO:0006364	rRNA processing
GO:0008168	methyltransferase activity
GO:0032259	methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q9ZLS8	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.32e-32	8.85e-31	0.691
1. PBF	Q87B70	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.55e-38	4.44e-43	0.8023
1. PBF	P0A641	Ribosomal RNA small subunit methyltransferase I	0.00e+00	9.04e-41	1.58e-28	0.7516
1. PBF	Q053G0	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.47e-23	2.63e-13	0.8586
1. PBF	Q661J3	Ribosomal RNA small subunit methyltransferase I	0.00e+00	4.04e-14	3.64e-34	0.9408
1. PBF	Q89AY5	Ribosomal RNA small subunit methyltransferase I	0.00e+00	4.79e-48	7.57e-31	0.7397
1. PBF	Q9HVZ3	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.75e-45	3.32e-36	0.7814
1. PBF	Q98DM9	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.06e-48	1.87e-43	0.7461
1. PBF	Q9CN04	Ribosomal RNA small subunit methyltransferase I	0.00e+00	6.14e-39	3.33e-48	0.7796
1. PBF	P67088	Ribosomal RNA small subunit methyltransferase I	0.00e+00	3.51e-42	5.28e-41	0.752
1. PBF	Q9KGL2	Ribosomal RNA small subunit methyltransferase I	0.00e+00	7.98e-49	8.84e-48	0.7605
1. PBF	B4U6H0	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.24e-17	7.48e-39	0.899
1. PBF	Q08329	Ribosomal RNA small subunit methyltransferase I (Fragment)	0.00e+00	3.44e-30	5.64e-38	0.8087
1. PBF	P75046	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.14e-41	4.80e-37	0.7418
1. PBF	B0SPB4	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.34e-18	1.65e-41	0.8782
1. PBF	A0RMQ7	Ribosomal RNA small subunit methyltransferase I	0.00e+00	8.07e-45	5.71e-15	0.7395
1. PBF	P0DF47	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.62e-52	9.14e-54	0.7952
1. PBF	Q5XDL7	Ribosomal RNA small subunit methyltransferase I	0.00e+00	8.18e-52	9.84e-53	0.793
1. PBF	B5Y7N9	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.78e-10	1.23e-34	0.9055
1. PBF	Q98RF5	Ribosomal RNA small subunit methyltransferase I	0.00e+00	9.84e-11	2.03e-42	0.9256
1. PBF	Q9A186	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.94e-51	2.54e-53	0.7829
1. PBF	P45298	Ribosomal RNA small subunit methyltransferase I	0.00e+00	3.71e-36	2.17e-47	0.7857
1. PBF	O83940	Ribosomal RNA small subunit methyltransferase I	0.00e+00	8.86e-06	6.08e-25	0.759
1. PBF	Q2NAK3	Ribosomal RNA small subunit methyltransferase I	0.00e+00	8.14e-39	8.37e-37	0.7646
1. PBF	P57192	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.53e-53	3.42e-39	0.7822
1. PBF	Q9WZG8	Ribosomal RNA small subunit methyltransferase I	0.00e+00	3.76e-14	1.15e-40	0.9096
1. PBF	P37544	Ribosomal RNA small subunit methyltransferase I	0.00e+00	4.79e-56	3.61e-49	0.758
1. PBF	Q8KA29	Ribosomal RNA small subunit methyltransferase I	0.00e+00	4.96e-44	4.31e-35	0.7695
1. PBF	P9WGW6	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.34e-40	3.27e-28	0.7567
1. PBF	Q9ZCJ3	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.03e-40	7.65e-34	0.7617
1. PBF	P47302	Ribosomal RNA small subunit methyltransferase I	0.00e+00	9.46e-39	1.22e-33	0.7322
1. PBF	P74038	Ribosomal RNA small subunit methyltransferase I	0.00e+00	7.74e-41	4.21e-52	0.7546
1. PBF	Q9KUD9	Ribosomal RNA small subunit methyltransferase I	0.00e+00	1.79e-40	8.95e-41	0.7759
1. PBF	P0DF46	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.62e-52	9.14e-54	0.8014
1. PBF	Q8P2A6	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.30e-51	1.44e-53	0.794
1. PBF	Q9JXE3	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.12e-44	8.07e-40	0.7487
1. PBF	C5J6H5	Ribosomal RNA small subunit methyltransferase I	0.00e+00	2.98e-15	7.91e-36	0.8688
1. PBF	Q9JWJ7	Ribosomal RNA small subunit methyltransferase I	0.00e+00	5.40e-43	2.54e-39	0.7492
1. PBF	P56204	Ribosomal RNA small subunit methyltransferase I	2.22e-16	2.63e-35	2.57e-31	0.715
1. PBF	Q9PFV5	Ribosomal RNA small subunit methyltransferase I	0.00e+00	7.68e-37	4.08e-43	0.8031
2. PF	Q53138	Precorrin-4 C(11)-methyltransferase	6.43e-11	4.10e-08	NA	0.6643
2. PF	Q8TR14	Diphthine synthase	2.05e-06	1.64e-13	NA	0.5974
2. PF	P29564	Uroporphyrinogen-III C-methyltransferase	3.17e-10	8.53e-03	NA	0.6312
2. PF	C3NDY5	Diphthine synthase	2.68e-08	9.15e-06	NA	0.6462
2. PF	P37725	Uroporphyrinogen-III C-methyltransferase	3.69e-07	1.89e-09	NA	0.6511
2. PF	B6YXP9	Diphthine synthase	1.91e-07	3.18e-12	NA	0.6284
2. PF	P21922	Precorrin-4 C(11)-methyltransferase	7.71e-08	6.58e-08	NA	0.6294
2. PF	Q5V2B7	Diphthine synthase	1.41e-08	5.05e-08	NA	0.627
2. PF	Q754E7	Diphthine methyl ester synthase	1.80e-07	1.79e-11	NA	0.5337
2. PF	Q6LZN6	Diphthine synthase	2.47e-07	8.27e-12	NA	0.6139
2. PF	Q9HJT0	Diphthine synthase	3.03e-07	1.52e-08	NA	0.5618
2. PF	P29928	Uroporphyrinogen-III C-methyltransferase	2.67e-10	1.28e-04	NA	0.6688
2. PF	Q8ZXR9	Diphthine synthase	6.75e-07	8.60e-07	NA	0.6616
2. PF	A1RU15	Diphthine synthase	6.91e-10	6.31e-09	NA	0.6696
2. PF	Q8TXC7	Diphthine synthase	4.39e-08	1.24e-10	NA	0.6329
2. PF	C3MYP9	Diphthine synthase	2.52e-08	9.15e-06	NA	0.6353
2. PF	A7IA21	Diphthine synthase	2.59e-07	3.93e-07	NA	0.6328
2. PF	Q05590	Probable cobalt-factor III C(17)-methyltransferase	3.46e-11	8.72e-04	NA	0.6933
2. PF	Q6FXK9	Diphthine methyl ester synthase	2.98e-07	7.12e-13	NA	0.5451
2. PF	Q2NFJ8	Diphthine synthase	4.77e-07	2.86e-11	NA	0.6068
2. PF	C4KGZ7	Diphthine synthase	2.76e-08	9.15e-06	NA	0.6349
2. PF	A3CWF9	Diphthine synthase	9.84e-06	1.92e-08	NA	0.6126
2. PF	A4YHI8	Diphthine synthase	4.08e-11	5.95e-06	NA	0.6516
2. PF	B9LV13	Diphthine synthase	2.27e-07	5.15e-09	NA	0.6089
2. PF	Q9YDI2	Diphthine synthase	7.40e-06	5.19e-11	NA	0.6299
2. PF	C3MPQ5	Diphthine synthase	2.48e-08	9.15e-06	NA	0.6352
2. PF	A9A6D8	Diphthine synthase	4.22e-07	1.24e-11	NA	0.6153
2. PF	Q9I2W4	Uroporphyrinogen-III C-methyltransferase	4.54e-10	2.30e-05	NA	0.6385
2. PF	O29866	Diphthine synthase	7.54e-08	2.61e-10	NA	0.6481
2. PF	C3NHR8	Diphthine synthase	2.57e-08	9.15e-06	NA	0.6516
2. PF	Q7S949	Diphthine methyl ester synthase	9.45e-08	2.10e-10	NA	0.5665
2. PF	O87696	Cobalt-precorrin-4 C(11)-methyltransferase	2.29e-10	1.64e-11	NA	0.6447
2. PF	A3MU14	Diphthine synthase	2.71e-07	4.10e-08	NA	0.6447
2. PF	Q6C1E0	Diphthine methyl ester synthase	1.27e-07	3.46e-14	NA	0.5698
2. PF	C5A3K4	Diphthine synthase	2.13e-07	3.06e-11	NA	0.6167
2. PF	C3N5D1	Diphthine synthase	2.35e-08	9.15e-06	NA	0.6427
2. PF	Q18JS3	Diphthine synthase	4.00e-08	5.42e-07	NA	0.6508
2. PF	P0A2G9	Cobalt-precorrin-4 C(11)-methyltransferase	3.09e-07	1.79e-07	NA	0.5853
2. PF	Q12XB4	Diphthine synthase	8.55e-06	6.18e-12	NA	0.603
2. PF	P42451	Uroporphyrinogen-III C-methyltransferase	1.67e-09	1.17e-06	NA	0.5797
2. PF	A6US81	Diphthine synthase	2.14e-07	8.16e-12	NA	0.6141
2. PF	P21640	Precorrin-3B C(17)-methyltransferase	5.96e-08	7.88e-07	NA	0.6154
2. PF	P0A2H0	Cobalt-precorrin-4 C(11)-methyltransferase	3.24e-07	1.79e-07	NA	0.6001
2. PF	A6UU49	Diphthine synthase	7.52e-08	1.83e-10	NA	0.6216
2. PF	Q9HZP9	Precorrin-4 C(11)-methyltransferase	5.25e-11	1.79e-10	NA	0.6965
2. PF	Q55749	Uroporphyrinogen-III C-methyltransferase	2.02e-07	2.31e-06	NA	0.5758
2. PF	A4FYP1	Diphthine synthase	1.78e-07	4.44e-12	NA	0.6318
2. PF	B1YAU2	Diphthine synthase	7.19e-07	8.51e-10	NA	0.6635
2. PF	Q971V1	Diphthine synthase	1.93e-08	4.91e-05	NA	0.6512
2. PF	O68100	Precorrin-4 C(11)-methyltransferase	2.28e-10	3.46e-09	NA	0.6204
2. PF	A6VJP1	Diphthine synthase	8.86e-08	2.72e-11	NA	0.6241
2. PF	Q46BL0	S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase	7.63e-10	1.79e-05	NA	0.6308
2. PF	O34744	Uroporphyrinogen-III C-methyltransferase	3.15e-07	7.46e-07	NA	0.6315
2. PF	P9WGB0	Precorrin-4 C(11)-methyltransferase	1.37e-07	1.98e-07	NA	0.6275
2. PF	Q5BFG0	Diphthine methyl ester synthase	3.54e-07	1.64e-10	NA	0.5773
2. PF	Q3IS55	Diphthine synthase	2.54e-08	1.80e-09	NA	0.6016
2. PF	A2SQF6	Diphthine synthase	6.28e-07	1.14e-09	NA	0.6355
2. PF	Q4HZI0	Diphthine methyl ester synthase	2.34e-07	7.34e-12	NA	0.5428
2. PF	O19889	Uroporphyrinogen-III C-methyltransferase	3.71e-10	3.47e-06	NA	0.5869
2. PF	Q0W085	Diphthine synthase	6.62e-06	2.65e-09	NA	0.6164
2. PF	Q6MY91	Diphthine methyl ester synthase	3.09e-07	2.15e-11	NA	0.5639
2. PF	B8GIF8	Diphthine synthase	2.04e-06	8.02e-09	NA	0.6306
2. PF	Q2FQ45	Diphthine synthase	1.10e-07	4.30e-09	NA	0.6355
2. PF	Q97TX8	Diphthine synthase	3.26e-08	1.30e-06	NA	0.6544
2. PF	Q5E982	Diphthine methyl ester synthase	6.68e-07	1.88e-10	NA	0.5932
2. PF	Q6CIZ1	Diphthine methyl ester synthase	1.56e-07	4.93e-11	NA	0.5604
2. PF	Q6BN80	Diphthine methyl ester synthase	1.90e-07	2.34e-12	NA	0.542
4. PB	P9WGW7	Ribosomal RNA small subunit methyltransferase I	0.00e+00	9.04e-41	1.58e-28	NA
4. PB	P67087	Ribosomal RNA small subunit methyltransferase I	0.00e+00	3.51e-42	5.28e-41	NA
5. P	A4W6N7	Pantothenate synthetase	1.94e-02	1.48e-02	NA	NA
5. P	Q9UZ31	Diphthine synthase	2.87e-07	1.99e-11	NA	NA
5. P	B7JBM7	Pantothenate synthetase	8.83e-02	2.58e-02	NA	NA
5. P	Q0HRH5	Pantothenate synthetase	1.56e-02	1.90e-02	NA	NA
5. P	B7V1E2	Pantothenate synthetase	7.71e-02	2.93e-02	NA	NA
5. P	A1A7H9	Pantothenate synthetase	4.04e-02	1.37e-02	NA	NA
5. P	Q1LTN0	Pantothenate synthetase	3.43e-02	9.73e-03	NA	NA
5. P	Q75JG8	Diphthine methyl ester synthase	6.49e-07	2.36e-10	NA	NA
5. P	C0QHN3	Pantothenate synthetase	6.83e-02	3.56e-02	NA	NA
5. P	Q0TLJ9	Pantothenate synthetase	4.02e-02	1.50e-02	NA	NA
5. P	B6HZA8	Pantothenate synthetase	4.76e-02	1.44e-02	NA	NA
5. P	C5B9K5	Pantothenate synthetase	4.10e-02	1.43e-02	NA	NA
5. P	Q8U377	Diphthine synthase	1.41e-07	2.65e-11	NA	NA
5. P	B2UND0	Pantothenate synthetase	3.32e-02	2.90e-02	NA	NA
5. P	Q3Z5M7	Pantothenate synthetase	4.10e-02	1.21e-02	NA	NA
5. P	Q6LMJ5	Pantothenate synthetase	4.33e-02	2.17e-02	NA	NA
5. P	A9IRN9	Pantothenate synthetase	2.67e-02	1.26e-02	NA	NA
5. P	Q1RG57	Pantothenate synthetase	4.04e-02	1.37e-02	NA	NA
5. P	O27902	Diphthine synthase	4.50e-08	5.21e-09	NA	NA
5. P	Q3B2E3	Pantothenate synthetase	7.06e-02	3.27e-02	NA	NA
5. P	B7UII1	Pantothenate synthetase	4.04e-02	1.37e-02	NA	NA
5. P	Q8EIH0	Pantothenate synthetase	1.51e-02	8.45e-03	NA	NA
5. P	Q9HQK6	Diphthine synthase	2.06e-08	9.72e-08	NA	NA
5. P	A8M8F3	Pantothenate synthetase	2.72e-02	3.11e-02	NA	NA
5. P	Q58223	Probable cobalt-factor III C(17)-methyltransferase	1.19e-10	7.79e-07	NA	NA
5. P	B7NI93	Pantothenate synthetase	4.05e-02	1.88e-02	NA	NA
5. P	Q6MDD9	4-hydroxy-tetrahydrodipicolinate synthase	4.34e-02	3.65e-02	NA	NA
5. P	B5FB06	Pantothenate synthetase	7.12e-02	2.60e-02	NA	NA
5. P	Q0HMB2	Pantothenate synthetase	1.55e-02	1.56e-02	NA	NA
5. P	Q7VK57	Pantothenate synthetase	5.24e-02	7.88e-03	NA	NA
5. P	B7MNZ5	Pantothenate synthetase	3.84e-02	1.50e-02	NA	NA
5. P	A1KAA6	Pantothenate synthetase	4.22e-02	1.61e-02	NA	NA
5. P	Q58375	Uroporphyrinogen-III C-methyltransferase	1.72e-07	1.29e-05	NA	NA
5. P	B7M174	Pantothenate synthetase	6.32e-02	1.44e-02	NA	NA
5. P	B0KC91	Pantothenate synthetase	2.76e-02	2.54e-02	NA	NA
5. P	Q8Z9D3	Pantothenate synthetase	4.23e-02	3.16e-02	NA	NA
5. P	Q8KBY5	Pantothenate synthetase	3.34e-02	3.19e-02	NA	NA
5. P	B3EMN7	Pantothenate synthetase	3.85e-02	1.10e-02	NA	NA
5. P	Q326A4	Pantothenate synthetase	3.89e-02	1.21e-02	NA	NA
5. P	B1XCA8	Pantothenate synthetase	4.77e-02	1.44e-02	NA	NA
5. P	P31663	Pantothenate synthetase	4.80e-02	1.44e-02	NA	NA
5. P	B5YZH0	Pantothenate synthetase	4.01e-02	1.41e-02	NA	NA
5. P	B2K533	Pantothenate synthetase	4.15e-02	3.62e-02	NA	NA
5. P	Q6NEB8	Pantothenate synthetase	7.81e-02	9.07e-03	NA	NA
5. P	A3DLV7	Diphthine synthase	7.72e-08	2.12e-11	NA	NA
5. P	A9L2H4	Pantothenate synthetase	1.05e-02	1.34e-02	NA	NA
5. P	A9ETA6	Pantothenate synthetase	6.74e-02	6.20e-03	NA	NA
5. P	C6DC48	Pantothenate synthetase	6.43e-02	1.93e-02	NA	NA
5. P	P0CU37	Diphthine methyl ester synthase 2	1.41e-07	1.44e-11	NA	NA
5. P	C1DFJ9	Pantothenate synthetase	5.29e-02	1.38e-02	NA	NA
5. P	Q9X713	Pantothenate synthetase	5.68e-02	3.16e-02	NA	NA
5. P	Q9CWQ0	Diphthine methyl ester synthase	7.56e-07	1.20e-11	NA	NA
5. P	B1IQK7	Pantothenate synthetase	4.04e-02	9.81e-03	NA	NA
5. P	Q2S8W2	Pantothenate synthetase	4.44e-02	1.44e-02	NA	NA
5. P	Q11F81	Pantothenate synthetase	1.57e-02	8.38e-03	NA	NA
5. P	Q1DAN8	Pantothenate synthetase	8.09e-02	2.00e-02	NA	NA
5. P	Q8CX59	Pantothenate synthetase	3.63e-02	4.10e-02	NA	NA
5. P	O58456	Diphthine synthase	1.07e-07	5.27e-12	NA	NA
5. P	Q16DW6	Pantothenate synthetase	6.77e-02	1.43e-02	NA	NA
5. P	Q5JFE7	Diphthine synthase	2.23e-07	2.30e-11	NA	NA
5. P	A9MPM2	Pantothenate synthetase	3.98e-02	2.60e-02	NA	NA
5. P	A2SEX7	Pantothenate synthetase	4.76e-02	3.80e-02	NA	NA
5. P	C4L930	Pantothenate synthetase	5.17e-02	2.17e-02	NA	NA
5. P	Q6G456	Pantothenate synthetase	3.43e-02	2.14e-02	NA	NA
5. P	Q9H2P9	Diphthine methyl ester synthase	7.87e-07	2.72e-11	NA	NA
5. P	Q8ZBK7	Pantothenate synthetase	4.40e-02	4.61e-02	NA	NA
5. P	A7ZHM3	Pantothenate synthetase	4.78e-02	1.44e-02	NA	NA
5. P	Q1CLW1	Pantothenate synthetase	4.48e-02	4.61e-02	NA	NA
5. P	A0LF67	Pantothenate synthetase	6.62e-02	2.93e-02	NA	NA
5. P	A7ZW82	Pantothenate synthetase	6.32e-02	1.44e-02	NA	NA
5. P	Q8FL31	Pantothenate synthetase	4.03e-02	1.46e-02	NA	NA
5. P	A0L0R3	Pantothenate synthetase	3.89e-02	1.88e-02	NA	NA
5. P	P21631	Uroporphyrinogen-III C-methyltransferase	2.91e-06	1.50e-08	NA	NA
5. P	A0KP08	Pantothenate synthetase	5.68e-02	3.53e-02	NA	NA
5. P	A8LKQ5	4-hydroxy-tetrahydrodipicolinate synthase	3.45e-02	1.74e-02	NA	NA
5. P	A4YA62	Pantothenate synthetase	3.40e-02	8.83e-03	NA	NA
5. P	Q0T868	Pantothenate synthetase	4.00e-02	8.83e-03	NA	NA
5. P	Q6ALV3	Pantothenate synthetase	5.42e-02	1.86e-02	NA	NA
5. P	Q66EG4	Pantothenate synthetase	4.64e-02	3.62e-02	NA	NA
5. P	A1WUU4	Pantothenate synthetase	3.33e-02	3.35e-02	NA	NA
5. P	A9BV01	Pantothenate synthetase	1.31e-02	2.33e-02	NA	NA
5. P	Q2N659	Pantothenate synthetase	4.12e-02	3.65e-02	NA	NA
5. P	Q5E2T1	Pantothenate synthetase	5.77e-02	2.81e-02	NA	NA
5. P	Q9HV69	Pantothenate synthetase	7.67e-02	3.50e-02	NA	NA
5. P	A1B2L1	Pantothenate synthetase	2.86e-02	2.51e-02	NA	NA
5. P	B1GZJ9	Pantothenate synthetase	3.28e-02	7.40e-03	NA	NA
5. P	A6VCI6	Pantothenate synthetase	7.63e-02	4.24e-02	NA	NA
5. P	A8GIZ7	Pantothenate synthetase	4.03e-02	6.04e-03	NA	NA
5. P	B4S5G6	Pantothenate synthetase	5.01e-02	1.50e-02	NA	NA
5. P	A0B879	Diphthine synthase	8.87e-08	2.54e-10	NA	NA
5. P	P32469	Diphthine methyl ester synthase	1.18e-07	3.35e-12	NA	NA
5. P	Q21U08	Pantothenate synthetase	8.42e-02	4.24e-02	NA	NA
5. P	Q2G319	Pantothenate synthetase	3.65e-02	4.65e-02	NA	NA
5. P	A1RG66	Pantothenate synthetase	1.56e-02	8.83e-03	NA	NA
5. P	Q1GNR4	Pantothenate synthetase	1.65e-02	1.52e-02	NA	NA
5. P	B0R4W9	Diphthine synthase	1.69e-08	9.72e-08	NA	NA
5. P	A3D8A9	Pantothenate synthetase	3.96e-02	8.30e-03	NA	NA
5. P	Q8X930	Pantothenate synthetase	4.07e-02	1.41e-02	NA	NA
5. P	A1KTB2	Pantothenate synthetase	4.14e-02	3.93e-02	NA	NA
5. P	C6C1U6	Pantothenate synthetase	1.50e-02	3.22e-03	NA	NA
5. P	B4EUD2	Pantothenate synthetase	4.37e-02	9.39e-03	NA	NA
5. P	Q467Z4	Diphthine synthase	5.29e-07	8.38e-12	NA	NA
5. P	O81769	Probable diphthine methyl ester synthase	3.53e-07	1.68e-10	NA	NA
5. P	Q3A9L1	Pantothenate synthetase	2.91e-02	4.97e-02	NA	NA
5. P	Q1C3V7	Pantothenate synthetase	4.34e-02	4.61e-02	NA	NA
5. P	Q6G079	Pantothenate synthetase	8.67e-02	3.08e-02	NA	NA
5. P	C5CWV0	Pantothenate synthetase	8.03e-02	2.29e-02	NA	NA
5. P	B2VD18	Pantothenate synthetase	4.56e-02	1.02e-02	NA	NA
5. P	B5YJ91	Pantothenate synthetase	7.48e-03	4.73e-02	NA	NA
5. P	A9R1G3	Pantothenate synthetase	4.32e-02	4.61e-02	NA	NA
5. P	Q8PUH9	Diphthine synthase	8.16e-07	2.45e-11	NA	NA
5. P	A1TYE5	Pantothenate synthetase	7.41e-02	1.19e-02	NA	NA
5. P	Q0AB68	Pantothenate synthetase	5.76e-02	2.39e-02	NA	NA
5. P	Q02FU2	Pantothenate synthetase	7.60e-02	3.50e-02	NA	NA
5. P	B3QM10	Pantothenate synthetase	1.97e-02	3.71e-02	NA	NA
5. P	Q7UTQ8	Pantothenate synthetase	1.83e-02	9.64e-03	NA	NA
5. P	A7MGP7	Pantothenate synthetase	3.99e-02	6.78e-03	NA	NA
5. P	A4TPV4	Pantothenate synthetase	4.32e-02	4.61e-02	NA	NA
5. P	Q9A6C8	Pantothenate synthetase	1.72e-02	2.49e-02	NA	NA
5. P	Q7N870	Pantothenate synthetase	4.19e-02	5.19e-03	NA	NA
5. P	A4SG25	Pantothenate synthetase	7.26e-02	1.68e-02	NA	NA
5. P	Q58670	Diphthine synthase	6.25e-08	8.55e-11	NA	NA
5. P	B7LGJ5	Pantothenate synthetase	4.01e-02	1.44e-02	NA	NA
5. P	A1JJN7	Pantothenate synthetase	4.01e-02	1.61e-02	NA	NA
5. P	P9WGB1	Precorrin-4 C(11)-methyltransferase	9.63e-08	1.98e-07	NA	NA
5. P	Q83SM0	Pantothenate synthetase	3.99e-02	8.83e-03	NA	NA
5. P	Q59NX9	Diphthine methyl ester synthase 1	2.63e-07	1.44e-11	NA	NA
5. P	B7MBB6	Pantothenate synthetase	4.11e-02	9.15e-03	NA	NA
5. P	B7LW40	Pantothenate synthetase	4.01e-02	1.88e-02	NA	NA
5. P	B9KLD3	Pantothenate synthetase	2.69e-02	4.69e-02	NA	NA
5. P	Q5LWR2	Pantothenate synthetase	3.49e-02	3.38e-02	NA	NA
5. P	B5Y1P6	Pantothenate synthetase	4.04e-02	3.24e-02	NA	NA
5. P	C1KWK1	Pantothenate synthetase	5.97e-02	4.14e-02	NA	NA
5. P	Q3APW7	Pantothenate synthetase	8.62e-02	3.97e-02	NA	NA
5. P	Q6D1X5	Pantothenate synthetase	3.92e-02	3.30e-02	NA	NA
5. P	A8ERB8	Pantothenate synthetase	6.69e-02	3.03e-02	NA	NA
5. P	Q58973	Cobalt-precorrin-4 C(11)-methyltransferase	2.53e-10	3.21e-07	NA	NA
5. P	A6T4S9	Pantothenate synthetase	4.03e-02	3.35e-02	NA	NA
5. P	Q1GLQ5	Pantothenate synthetase	4.98e-02	1.76e-02	NA	NA
5. P	B1LGT5	Pantothenate synthetase	3.98e-02	1.73e-02	NA	NA
5. P	Q32JW8	Pantothenate synthetase	4.02e-02	9.31e-03	NA	NA
5. P	A6WJK9	Pantothenate synthetase	1.69e-02	1.39e-02	NA	NA
5. P	Q9KC86	Pantothenate synthetase	4.75e-02	4.97e-02	NA	NA
5. P	P57035	Pantothenate synthetase	4.39e-02	2.93e-02	NA	NA
5. P	Q2YAP0	Pantothenate synthetase	3.99e-02	4.61e-02	NA	NA
5. P	Q8D2A6	Pantothenate synthetase	4.30e-02	1.16e-02	NA	NA
5. P	Q3JCP8	Pantothenate synthetase	4.41e-02	4.71e-03	NA	NA
5. P	A4SJ60	Pantothenate synthetase	5.56e-02	7.27e-03	NA	NA
5. P	A4VPM7	Pantothenate synthetase	8.55e-02	2.74e-02	NA	NA
5. P	A7FM23	Pantothenate synthetase	4.63e-02	3.62e-02	NA	NA
5. P	B0K364	Pantothenate synthetase	2.77e-02	4.07e-02	NA	NA
5. P	A4QAA5	Pantothenate synthetase	8.34e-02	4.89e-02	NA	NA
5. P	B7N803	Pantothenate synthetase	4.00e-02	1.40e-02	NA	NA
5. P	B8EDX3	Pantothenate synthetase	1.55e-02	1.60e-02	NA	NA
5. P	Q7MAP3	Pantothenate synthetase	4.07e-02	2.03e-02	NA	NA
5. P	B5ES06	Pantothenate synthetase	8.89e-02	2.58e-02	NA	NA
5. P	B2U2Y0	Pantothenate synthetase	4.07e-02	1.21e-02	NA	NA
5. P	B1JK36	Pantothenate synthetase	4.17e-02	3.62e-02	NA	NA
5. P	O74898	Diphthine methyl ester synthase	1.03e-07	1.03e-13	NA	NA
5. P	C4ZRM6	Pantothenate synthetase	6.34e-02	1.44e-02	NA	NA
6. F	Q0SZU8	Siroheme synthase	1.55e-07	NA	NA	0.5886
6. F	A4XUX3	Siroheme synthase	1.12e-07	NA	NA	0.6412
6. F	A5W1H7	Siroheme synthase	4.64e-08	NA	NA	0.6455
6. F	Q65T49	Siroheme synthase	6.54e-07	NA	NA	0.6099
6. F	B7L4P2	Siroheme synthase	1.44e-07	NA	NA	0.6098
6. F	A9HZV6	Siroheme synthase	6.41e-05	NA	NA	0.6251
6. F	A0KP37	Siroheme synthase 2	3.27e-07	NA	NA	0.5726
6. F	Q1CLS2	Siroheme synthase 1	3.47e-07	NA	NA	0.6193
6. F	P37556	Uncharacterized protein YabN	2.16e-05	NA	NA	0.4841
6. F	C3JY53	Siroheme synthase	1.22e-07	NA	NA	0.6373
6. F	Q5NRM4	Siroheme synthase	5.89e-07	NA	NA	0.5958
6. F	B1X716	Siroheme synthase	1.40e-07	NA	NA	0.5851
6. F	Q31VS0	Siroheme synthase	1.45e-07	NA	NA	0.6152
6. F	Q0VQ05	Siroheme synthase	8.05e-08	NA	NA	0.669
6. F	P57500	Siroheme synthase	1.78e-05	NA	NA	0.6089
6. F	B3GZA0	Siroheme synthase	5.20e-05	NA	NA	0.6312
6. F	P9WGB2	Cobalamin biosynthesis protein CobIJ	3.54e-05	NA	NA	0.614
6. F	P21639	Precorrin-2 C(20)-methyltransferase	1.98e-10	NA	NA	0.6293
6. F	Q1C2P9	Siroheme synthase	2.89e-07	NA	NA	0.5291
6. F	C4LAG5	Siroheme synthase	1.16e-05	NA	NA	0.5589
6. F	A8A5H5	Siroheme synthase	1.39e-07	NA	NA	0.5847
6. F	A9LZ77	Siroheme synthase	3.45e-05	NA	NA	0.5966
6. F	A5WEG6	Siroheme synthase	1.28e-07	NA	NA	0.6453
6. F	Q74Y23	Siroheme synthase	2.73e-07	NA	NA	0.5397
6. F	Q3JCS0	Siroheme synthase	7.53e-08	NA	NA	0.6617
6. F	A8G9Y3	Siroheme synthase 1	3.76e-07	NA	NA	0.5901
6. F	C4ZUM4	Siroheme synthase	1.41e-07	NA	NA	0.5832
6. F	B5R2C7	Siroheme synthase	1.33e-07	NA	NA	0.5871
6. F	Q51701	Uroporphyrinogen-III C-methyltransferase	3.61e-07	NA	NA	0.6209
6. F	A0KLD7	Siroheme synthase 1	5.96e-05	NA	NA	0.5944
6. F	B2I985	Siroheme synthase	8.61e-05	NA	NA	0.6506
6. F	B0BTC2	Siroheme synthase	6.68e-05	NA	NA	0.6165
6. F	Q6D1A4	Siroheme synthase 1	4.96e-07	NA	NA	0.5955
6. F	A8GKQ1	Siroheme synthase 2	2.04e-07	NA	NA	0.5582
6. F	Q88FT3	Siroheme synthase	6.20e-08	NA	NA	0.6539
6. F	Q6LM67	Siroheme synthase	3.88e-07	NA	NA	0.6063
6. F	B4TY38	Siroheme synthase	1.39e-07	NA	NA	0.5868
6. F	A4WFH1	Siroheme synthase	1.37e-07	NA	NA	0.6064
6. F	A1AVU5	Siroheme synthase	1.34e-05	NA	NA	0.6073
6. F	B7UW11	Siroheme synthase	8.08e-08	NA	NA	0.6464
6. F	A6TF07	Siroheme synthase 2	1.39e-07	NA	NA	0.5903
6. F	P9WGA8	Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]	3.31e-04	NA	NA	0.6133
6. F	B7M1S1	Siroheme synthase	1.43e-07	NA	NA	0.5834
6. F	P21921	Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]	7.14e-05	NA	NA	0.6469
6. F	Q21K21	Siroheme synthase	3.17e-08	NA	NA	0.6615
6. F	Q9I0M7	Siroheme synthase	8.10e-08	NA	NA	0.6576
6. F	C5BGP8	Siroheme synthase	2.02e-07	NA	NA	0.6112
6. F	P42437	Uroporphyrinogen-III C-methyltransferase	3.24e-04	NA	NA	0.5918
6. F	Q4ZRL6	Siroheme synthase	1.63e-07	NA	NA	0.6328
6. F	A9H259	Siroheme synthase	1.90e-07	NA	NA	0.6264
6. F	Q9PF46	Siroheme synthase	4.85e-05	NA	NA	0.5999
6. F	Q3ILQ9	Siroheme synthase	4.71e-07	NA	NA	0.588
6. F	O27454	Probable cobalt-factor III C(17)-methyltransferase	2.57e-05	NA	NA	0.6778
6. F	Q05593	Cobalt-precorrin-2 C(20)-methyltransferase	2.87e-10	NA	NA	0.6869
6. F	Q2Y6L7	Siroheme synthase	1.46e-07	NA	NA	0.6452
6. F	Q57IZ5	Siroheme synthase	1.50e-07	NA	NA	0.5877
6. F	B1IP96	Siroheme synthase	1.42e-07	NA	NA	0.5843
6. F	A1WYD5	Siroheme synthase 2	2.76e-05	NA	NA	0.653
6. F	C1DKY7	Siroheme synthase	7.97e-08	NA	NA	0.6171
6. F	Q15YU1	Siroheme synthase	1.40e-07	NA	NA	0.6283
6. F	B1LHG9	Siroheme synthase	1.65e-07	NA	NA	0.5836
6. F	B7LS75	Siroheme synthase	1.42e-07	NA	NA	0.5845
6. F	A4TPZ1	Siroheme synthase 2	3.35e-07	NA	NA	0.6153
6. F	B5BH22	Siroheme synthase	1.30e-07	NA	NA	0.583
6. F	B0U4X0	Siroheme synthase	2.08e-05	NA	NA	0.6273
6. F	Q2NVN0	Siroheme synthase	4.21e-07	NA	NA	0.6137
6. F	Q7NZV7	Siroheme synthase	1.16e-07	NA	NA	0.6812
6. F	A9MME5	Siroheme synthase	1.58e-07	NA	NA	0.5977
6. F	B7MCY5	Siroheme synthase	1.42e-07	NA	NA	0.6124
6. F	Q8Z201	Siroheme synthase	1.36e-07	NA	NA	0.5822
6. F	B7UK79	Siroheme synthase	1.36e-07	NA	NA	0.6104
6. F	Q0A812	Siroheme synthase	1.96e-07	NA	NA	0.6417
6. F	A4SRH0	Siroheme synthase 2	5.08e-05	NA	NA	0.5599
6. F	Q1QAX7	Siroheme synthase	1.59e-05	NA	NA	0.6397
6. F	Q3SG32	Siroheme synthase	1.25e-05	NA	NA	0.6611
6. F	A7MJ67	Siroheme synthase 1	3.38e-07	NA	NA	0.614
6. F	Q1H3L5	Siroheme synthase	9.50e-08	NA	NA	0.6335
6. F	B6I2S7	Siroheme synthase	1.65e-07	NA	NA	0.5845
6. F	A6V4H6	Siroheme synthase	8.29e-08	NA	NA	0.6632
6. F	Q7VQG9	Siroheme synthase	1.38e-05	NA	NA	0.6313
6. F	Q820Q4	Siroheme synthase	1.24e-07	NA	NA	0.5893
6. F	A6TD45	Siroheme synthase 1	3.58e-07	NA	NA	0.6041
6. F	Q7WB57	Siroheme synthase	1.63e-07	NA	NA	0.6384
6. F	Q1R5R3	Siroheme synthase	1.50e-07	NA	NA	0.609
6. F	Q59294	Porphyrin biosynthesis protein HemD	5.69e-05	NA	NA	0.6107
6. F	P25924	Siroheme synthase	1.30e-07	NA	NA	0.5974
6. F	B5FJQ1	Siroheme synthase	1.42e-07	NA	NA	0.6128
6. F	Q9HZU0	Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]	7.43e-05	NA	NA	0.6566
6. F	Q6CZS0	Siroheme synthase 2	2.31e-07	NA	NA	0.6034
6. F	A7FNS9	Siroheme synthase 2	3.14e-07	NA	NA	0.5282
6. F	Q02NA3	Siroheme synthase	8.49e-08	NA	NA	0.6637
6. F	Q7WMM4	Siroheme synthase	1.60e-07	NA	NA	0.6377
6. F	O87689	Cobalt-factor III methyltransferase	1.01e-04	NA	NA	0.674
6. F	Q493N1	Siroheme synthase	7.23e-07	NA	NA	0.5351
6. F	B5F8J0	Siroheme synthase	1.44e-07	NA	NA	0.6137
6. F	B2U3H4	Siroheme synthase	1.55e-07	NA	NA	0.6094
6. F	Q6F8G6	Siroheme synthase	1.59e-07	NA	NA	0.6181
6. F	P95370	Siroheme synthase	3.69e-07	NA	NA	0.6063
6. F	Q0AHC1	Siroheme synthase	1.24e-07	NA	NA	0.6147
6. F	A6VPZ6	Siroheme synthase	4.32e-07	NA	NA	0.5962
6. F	A4VLU6	Siroheme synthase	6.46e-08	NA	NA	0.6506
6. F	Q2KWB0	Siroheme synthase	2.00e-07	NA	NA	0.6356
6. F	Q606C9	Siroheme synthase	1.57e-05	NA	NA	0.6135
6. F	Q3YWQ3	Siroheme synthase	1.55e-07	NA	NA	0.5886
6. F	Q7VZ77	Siroheme synthase	1.29e-07	NA	NA	0.6386
6. F	P66878	Cobalamin biosynthesis protein CobIJ	8.40e-05	NA	NA	0.6498
6. F	Q83JB3	Siroheme synthase	1.66e-07	NA	NA	0.6106
6. F	B7NMD7	Siroheme synthase	1.52e-07	NA	NA	0.5843
6. F	Q66EC9	Siroheme synthase 1	7.09e-07	NA	NA	0.6031
6. F	P0AEA9	Siroheme synthase	1.48e-07	NA	NA	0.5848
6. F	Q1IBC9	Siroheme synthase	7.05e-08	NA	NA	0.6611
6. F	Q1LTP4	Siroheme synthase	1.32e-05	NA	NA	0.5963
6. F	P0A2H2	Cobalt-precorrin-7 C(5)-methyltransferase	1.87e-10	NA	NA	0.7368
6. F	Q5FP95	Siroheme synthase	1.79e-07	NA	NA	0.6463
6. F	Q4K9V8	Siroheme synthase	7.08e-08	NA	NA	0.6544
6. F	A0KQJ4	Siroheme synthase 3	3.36e-05	NA	NA	0.5763
6. F	B4TKQ4	Siroheme synthase	1.29e-07	NA	NA	0.588
6. F	Q48H75	Siroheme synthase	8.85e-08	NA	NA	0.6577
6. F	A4TGU8	Siroheme synthase 1	3.52e-07	NA	NA	0.6069
6. F	Q664M6	Siroheme synthase 2	3.55e-07	NA	NA	0.5135
6. F	Q7N8L2	Siroheme synthase	3.30e-07	NA	NA	0.6223
6. F	Q31GG8	Siroheme synthase	1.24e-05	NA	NA	0.6153
6. F	A1WWP8	Siroheme synthase 1	1.26e-05	NA	NA	0.6548
6. F	A4SHL4	Siroheme synthase 1	3.63e-07	NA	NA	0.5619
6. F	A1JSB7	Siroheme synthase 2	3.15e-07	NA	NA	0.6078
6. F	A5CXE4	Siroheme synthase	1.11e-07	NA	NA	0.5979
6. F	Q2SJB7	Siroheme synthase	7.69e-08	NA	NA	0.6418
6. F	B4SVI1	Siroheme synthase	1.31e-07	NA	NA	0.5874
6. F	Q4FSU1	Siroheme synthase	3.06e-05	NA	NA	0.6232
6. F	A1SRP9	Siroheme synthase	3.47e-07	NA	NA	0.606
6. F	A8AQS4	Siroheme synthase	1.42e-07	NA	NA	0.5845
6. F	A7MKK9	Siroheme synthase 2	2.22e-07	NA	NA	0.594
6. F	A1JJS8	Siroheme synthase 1	4.44e-07	NA	NA	0.6198
6. F	B7NDX8	Siroheme synthase	1.42e-07	NA	NA	0.5845
6. F	A7ZSP4	Siroheme synthase	1.48e-07	NA	NA	0.6161
6. F	P21636	Precorrin-6A synthase [deacetylating]	1.58e-09	NA	NA	0.5996
6. F	B1JBD9	Siroheme synthase	6.11e-08	NA	NA	0.6365
6. F	Q87ZT0	Siroheme synthase	1.06e-07	NA	NA	0.6732
6. F	B5YTS6	Siroheme synthase	1.44e-07	NA	NA	0.5837
6. F	O29534	Cobalamin biosynthesis protein CbiHC	1.05e-05	NA	NA	0.6421
6. F	Q1CCP6	Siroheme synthase 2	2.73e-07	NA	NA	0.533
6. F	P0A2H1	Cobalt-precorrin-7 C(5)-methyltransferase	2.36e-10	NA	NA	0.7623
6. F	B8GUD3	Siroheme synthase	1.07e-07	NA	NA	0.5822
6. F	Q32AZ8	Siroheme synthase	1.41e-07	NA	NA	0.6096
6. F	A1KU10	Siroheme synthase	3.85e-07	NA	NA	0.5872
6. F	Q3KA85	Siroheme synthase	7.51e-08	NA	NA	0.6678
6. F	P57001	Siroheme synthase	7.40e-07	NA	NA	0.6039
6. F	A7FLY4	Siroheme synthase 1	3.37e-07	NA	NA	0.6203
6. F	C0Q0F3	Siroheme synthase	1.35e-07	NA	NA	0.5883
6. F	Q9HZU3	Precorrin-2 C(20)-methyltransferase	8.94e-11	NA	NA	0.5978