Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54829.1

JCVISYN3A_0512

Acyl-phosphate glycerol 3-phosphate acyltransferase.
M. mycoides homolog: Q6MT36.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 125
Unique PROST Go: 69
Unique BLAST Go: 5
Unique Foldseek Go: 11

Total Homologs: 331
Unique PROST Homologs: 71
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 186

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: plsC; 1-acyl-sn-glycerol-3-phosphate acyltransferase
Zhang et al. [4]: GO:0003841|1-acylglycerol-3-phosphate O-acyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q49402 (Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase) with a FATCAT P-Value: 0 and RMSD of 2.50 angstrom. The sequence alignment identity is 27.1%.
Structural alignment shown in left. Query protein AVX54829.1 colored as red in alignment, homolog Q49402 colored as blue. Query protein AVX54829.1 is also shown in right top, homolog Q49402 showed in right bottom. They are colored based on secondary structures.

  AVX54829.1 MNKMNQVNSMQEPISQNNKEQEKKIKDHIHVNPWKML--FMW---LPLLH----IKFKAAKIVRKN-KKQPDRYTEEYRYNWVKKAVSKLLYVLDVNIKV 90
      Q49402 -------------------------MDKLFKTSFRFIIRFLQILSLPVVFPYFLLSFLACLITSKNYESLPYNYPPEIRFKKVYRLVSMWLYI--KGIKV 73

  AVX54829.1 EGIENWID-----KGVILAANHQSNIDPAILFAINDFS--KQQ-PLAFIAKEELWTSKKFKNFVRLIDCIPLNRKSPR---SALEAFKEAKDLIVDYKR- 178
      Q49402 VTV-N--DKIIPKKPVLVVANHKSNLDPLVL--IKAFGRLKNSPPLTFVAKIELKDTVLFK-LMKLIDCVFIDRKNIRQIANALET---QQQLI----RQ 160

  AVX54829.1 --SLVIFPEGTRSHSQQMNSFQAASLKVAQMSHAPIIPVSIINSY-QVFAEKRPK----K----VEVKVVFGK---PISPNKHISLKTEDLTRFVEKIV- 263
      Q49402 GTAIAVFAEGTRILSNDIGEFKPGALKVAYNAFVPILPVSIVGSLGKMESNKRLKEHGVKKSSNYEVKVIFNKLINPISFNQ---IDSNNLANNIRSIIS 257

  AVX54829.1 D--TNLKEWENKEMKYELRKLTKKDIKQLKEEEKKQNSKKQEKKSIKDLFKIVD 315
      Q49402 DAYTSEKP-SND------------------------------------------ 268

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005783	endoplasmic reticulum
1. PBF	GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity
1. PBF	GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity
1. PBF	GO:0016024	CDP-diacylglycerol biosynthetic process
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0006654	phosphatidic acid biosynthetic process
1. PBF	GO:0106262	1-acylglycerophosphoethanolamine O-acyltransferase activity
1. PBF	GO:0008654	phospholipid biosynthetic process
1. PBF	GO:0005789	endoplasmic reticulum membrane
2. PF	GO:0035965	cardiolipin acyl-chain remodeling
2. PF	GO:0019107	myristoyltransferase activity
2. PF	GO:0046471	phosphatidylglycerol metabolic process
2. PF	GO:2001171	positive regulation of ATP biosynthetic process
2. PF	GO:0008374	O-acyltransferase activity
2. PF	GO:0009276	Gram-negative-bacterium-type cell wall
2. PF	GO:0000423	mitophagy
2. PF	GO:0032048	cardiolipin metabolic process
2. PF	GO:0003007	heart morphogenesis
2. PF	GO:0048137	spermatocyte division
2. PF	GO:0016746	acyltransferase activity
2. PF	GO:0097027	ubiquitin-protein transferase activator activity
2. PF	GO:0140042	lipid droplet formation
2. PF	GO:0036104	Kdo2-lipid A biosynthetic process
2. PF	GO:1900210	positive regulation of cardiolipin metabolic process
2. PF	GO:0036149	phosphatidylinositol acyl-chain remodeling
2. PF	GO:0007005	mitochondrion organization
2. PF	GO:0019432	triglyceride biosynthetic process
2. PF	GO:0034389	lipid droplet organization
2. PF	GO:0005741	mitochondrial outer membrane
2. PF	GO:0007007	inner mitochondrial membrane organization
3. BF	GO:0005886	plasma membrane
3. BF	GO:0008779	acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase activity
3. BF	GO:0004467	long-chain fatty acid-CoA ligase activity
3. BF	GO:0006631	fatty acid metabolic process
3. BF	GO:0008922	long-chain fatty acid [acyl-carrier-protein] ligase activity
4. PB	GO:0008544	epidermis development
4. PB	GO:0001961	positive regulation of cytokine-mediated signaling pathway
4. PB	GO:0016020	membrane
4. PB	GO:0006644	phospholipid metabolic process
4. PB	GO:0001819	positive regulation of cytokine production
5. P	GO:0045723	positive regulation of fatty acid biosynthetic process
5. P	GO:0050746	regulation of lipoprotein metabolic process
5. P	GO:0005811	lipid droplet
5. P	GO:0048229	gametophyte development
5. P	GO:0055089	fatty acid homeostasis
5. P	GO:0008951	palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity
5. P	GO:0047196	long-chain-alcohol O-fatty-acyltransferase activity
5. P	GO:0036148	phosphatidylglycerol acyl-chain remodeling
5. P	GO:0061959	response to (R)-carnitine
5. P	GO:0042632	cholesterol homeostasis
5. P	GO:0097250	mitochondrial respirasome assembly
5. P	GO:0004144	diacylglycerol O-acyltransferase activity
5. P	GO:0008913	lauroyltransferase activity
5. P	GO:0097006	regulation of plasma lipoprotein particle levels
5. P	GO:0060048	cardiac muscle contraction
5. P	GO:0032049	cardiolipin biosynthetic process
5. P	GO:0035356	cellular triglyceride homeostasis
5. P	GO:0007507	heart development
5. P	GO:0045722	positive regulation of gluconeogenesis
5. P	GO:0010152	pollen maturation
5. P	GO:0035336	long-chain fatty-acyl-CoA metabolic process
5. P	GO:0046467	membrane lipid biosynthetic process
5. P	GO:0046339	diacylglycerol metabolic process
5. P	GO:0006640	monoacylglycerol biosynthetic process
5. P	GO:0009103	lipopolysaccharide biosynthetic process
5. P	GO:0050892	intestinal absorption
5. P	GO:0012505	endomembrane system
5. P	GO:0005739	mitochondrion
5. P	GO:0006639	acylglycerol metabolic process
5. P	GO:0038183	bile acid signaling pathway
5. P	GO:0009247	glycolipid biosynthetic process
5. P	GO:0031966	mitochondrial membrane
5. P	GO:0042775	mitochondrial ATP synthesis coupled electron transport
5. P	GO:0102966	arachidoyl-CoA:1-dodecanol O-acyltransferase activity
5. P	GO:0071400	cellular response to oleic acid
5. P	GO:0042407	cristae formation
5. P	GO:0016411	acylglycerol O-acyltransferase activity
5. P	GO:0034383	low-density lipoprotein particle clearance
5. P	GO:0010344	seed oilbody biogenesis
5. P	GO:0006936	muscle contraction
5. P	GO:0046460	neutral lipid biosynthetic process
5. P	GO:0019915	lipid storage
5. P	GO:0030097	hemopoiesis
5. P	GO:0005743	mitochondrial inner membrane
5. P	GO:0006651	diacylglycerol biosynthetic process
5. P	GO:0071617	lysophospholipid acyltransferase activity
5. P	GO:0007519	skeletal muscle tissue development
5. P	GO:1905897	regulation of response to endoplasmic reticulum stress
5. P	GO:0090181	regulation of cholesterol metabolic process
5. P	GO:0050252	retinol O-fatty-acyltransferase activity
5. P	GO:0005737	cytoplasm
5. P	GO:0006071	glycerol metabolic process
5. P	GO:0048738	cardiac muscle tissue development
5. P	GO:0046322	negative regulation of fatty acid oxidation
5. P	GO:0016407	acetyltransferase activity
5. P	GO:0006629	lipid metabolic process
5. P	GO:1990578	perinuclear endoplasmic reticulum membrane
5. P	GO:0046462	monoacylglycerol metabolic process
5. P	GO:0003846	2-acylglycerol O-acyltransferase activity
5. P	GO:0002244	hematopoietic progenitor cell differentiation
5. P	GO:0010867	positive regulation of triglyceride biosynthetic process
5. P	GO:0045823	positive regulation of heart contraction
5. P	GO:0047144	2-acylglycerol-3-phosphate O-acyltransferase activity
5. P	GO:0060613	fat pad development
5. P	GO:0010025	wax biosynthetic process
5. P	GO:0030176	integral component of endoplasmic reticulum membrane
5. P	GO:0046488	phosphatidylinositol metabolic process
5. P	GO:0036155	acylglycerol acyl-chain remodeling
5. P	GO:0042171	lysophosphatidic acid acyltransferase activity
6. F	GO:0004366	glycerol-3-phosphate O-acyltransferase activity
6. F	GO:0106263	1-acylglycerophosphoserine O-acyltransferase activity
6. F	GO:0016287	glycerone-phosphate O-acyltransferase activity
6. F	GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity
6. F	GO:0047166	1-alkenylglycerophosphoethanolamine O-acyltransferase activity
6. F	GO:1990044	protein localization to lipid droplet
6. F	GO:0002071	glandular epithelial cell maturation
6. F	GO:0102420	sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity
6. F	GO:0008611	ether lipid biosynthetic process
6. F	GO:0006072	glycerol-3-phosphate metabolic process
6. F	GO:0071712	ER-associated misfolded protein catabolic process
7. B	GO:0031969	chloroplast membrane
7. B	GO:0042493
7. B	GO:0035579	specific granule membrane
7. B	GO:0005524	ATP binding
7. B	GO:0006655	phosphatidylglycerol biosynthetic process

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0016746	acyltransferase activity
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P75479	Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase	0.00e+00	7.57e-18	4.19e-29	0.8703
1. PBF	P0A258	1-acyl-sn-glycerol-3-phosphate acyltransferase	3.89e-15	3.01e-20	5.66e-04	0.7922
1. PBF	Q9JZ47	1-acyl-sn-glycerol-3-phosphate acyltransferase	1.78e-15	9.15e-19	0.003	0.7453
1. PBF	Q42670	1-acyl-sn-glycerol-3-phosphate acyltransferase	2.24e-09	4.91e-12	1.85e-10	0.7964
1. PBF	Q42868	1-acyl-sn-glycerol-3-phosphate acyltransferase	1.55e-15	1.41e-15	6.69e-12	0.8352
1. PBF	Q95JH0	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha	7.42e-12	4.36e-13	9.17e-09	0.656
1. PBF	Q8DNY1	1-acyl-sn-glycerol-3-phosphate acyltransferase	8.79e-11	1.66e-06	1.02e-11	0.6932
1. PBF	O25903	1-acyl-sn-glycerol-3-phosphate acyltransferase	5.36e-13	2.85e-20	1.45e-05	0.7344
1. PBF	Q9ZJN8	1-acyl-sn-glycerol-3-phosphate acyltransferase	2.50e-12	9.94e-16	2.17e-05	0.7505
1. PBF	P44848	1-acyl-sn-glycerol-3-phosphate acyltransferase	7.99e-15	9.94e-16	0.007	0.7633
1. PBF	O07584	1-acyl-sn-glycerol-3-phosphate acyltransferase	6.35e-12	1.87e-10	9.84e-10	0.7011
1. PBF	P0A257	1-acyl-sn-glycerol-3-phosphate acyltransferase	5.66e-15	3.01e-20	5.66e-04	0.7732
1. PBF	Q49402	Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase	0.00e+00	3.56e-18	1.33e-24	0.8658
1. PBF	Q95JH2	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha	7.23e-12	7.22e-14	8.76e-09	0.704
1. PBF	Q9JU41	1-acyl-sn-glycerol-3-phosphate acyltransferase	3.77e-15	5.12e-19	0.003	0.7588
1. PBF	Q42870	1-acyl-sn-glycerol-3-phosphate acyltransferase	2.74e-12	7.95e-16	1.91e-12	0.7077
1. PBF	Q59188	1-acyl-sn-glycerol-3-phosphate acyltransferase	0.00e+00	1.35e-16	5.71e-12	0.7418
2. PF	Q6IV77	Tafazzin	8.69e-06	8.17e-10	NA	0.6261
2. PF	O06659	Lipid A biosynthesis myristoyltransferase 2	4.68e-05	2.62e-07	NA	0.383
2. PF	P54174	Uncharacterized protein YpkP	1.70e-11	2.30e-06	NA	0.7542
2. PF	Q6IV76	Tafazzin	8.36e-06	7.74e-10	NA	0.6115
2. PF	Q6IV82	Tafazzin	6.72e-06	9.96e-09	NA	0.5287
2. PF	Q6IV83	Tafazzin	6.27e-06	1.62e-08	NA	0.5371
2. PF	P44567	Lipid A biosynthesis myristoyltransferase	3.94e-04	7.15e-05	NA	0.3363
2. PF	Q9HW50	Lyso-ornithine lipid O-acyltransferase	1.89e-15	1.24e-10	NA	0.7206
2. PF	Q5ZJD8	Transmembrane protein 68	1.24e-06	2.91e-09	NA	0.6521
2. PF	Q6IV78	Tafazzin	9.16e-06	7.74e-10	NA	0.535
2. PF	Q59601	1-acyl-sn-glycerol-3-phosphate acyltransferase	2.66e-15	6.73e-19	NA	0.7481
2. PF	Q6IV84	Tafazzin	5.99e-06	2.69e-09	NA	0.5521
2. PF	Q5E9R2	1-acyl-sn-glycerol-3-phosphate acyltransferase delta	6.64e-10	4.60e-02	NA	0.5589
2. PF	Q7APG1	Lyso-ornithine lipid O-acyltransferase	5.55e-16	7.26e-11	NA	0.7187
2. PF	D5AQD5	Lyso-ornithine lipid O-acyltransferase	1.07e-09	1.17e-09	NA	0.6678
2. PF	Q91WF0	Tafazzin	9.01e-06	2.07e-13	NA	0.6199
2. PF	Q0VCR6	Transmembrane protein 68	2.92e-08	1.72e-08	NA	0.6279
2. PF	Q2YQS9	Lyso-ornithine lipid O-acyltransferase	1.11e-16	1.78e-13	NA	0.7119
2. PF	P59198	Lipid A biosynthesis myristoyltransferase 1	2.50e-04	8.70e-08	NA	0.3908
3. BF	A8A3X0	Bifunctional protein Aas	1.97e-04	NA	0.008	0.6594
3. BF	B7N768	Bifunctional protein Aas	1.83e-04	NA	0.003	0.6686
3. BF	A6TDH2	Bifunctional protein Aas	1.19e-04	NA	0.027	0.6707
3. BF	B5Z4F4	Bifunctional protein Aas	1.45e-04	NA	0.008	0.6698
3. BF	A1AF47	Bifunctional protein Aas	1.76e-04	NA	0.003	0.6611
3. BF	B5XUP2	Bifunctional protein Aas	1.50e-04	NA	0.027	0.6589
3. BF	A8AP56	Bifunctional protein Aas	1.54e-04	NA	0.022	0.6752
3. BF	Q3YY21	Bifunctional protein Aas	1.93e-04	NA	0.008	0.6602
3. BF	B7UHQ4	Bifunctional protein Aas	1.96e-04	NA	0.003	0.6687
3. BF	A7MR36	Bifunctional protein Aas	1.52e-04	NA	0.005	0.6671
3. BF	Q0TDZ6	Bifunctional protein Aas	1.63e-04	NA	0.003	0.6681
3. BF	B1LR34	Bifunctional protein Aas	1.78e-04	NA	0.004	0.6666
3. BF	C4ZZY9	Bifunctional protein Aas	1.72e-04	NA	0.009	0.6574
3. BF	B6I6W1	Bifunctional protein Aas	1.52e-04	NA	0.008	0.6679
3. BF	B7NVY2	Bifunctional protein Aas	1.63e-04	NA	0.001	0.6676
3. BF	A8J0J0	1-acyl-sn-glycerol-3-phosphate acyltransferase CHLREDRAFT_174358	2.90e-09	NA	3.23e-10	0.7171
3. BF	Q8X6J8	Bifunctional protein Aas	1.73e-04	NA	0.008	0.6628
3. BF	B7MLI2	Bifunctional protein Aas	1.61e-04	NA	0.003	0.6666
3. BF	B1IU08	Bifunctional protein Aas	1.93e-04	NA	0.008	0.6607
3. BF	B2TYQ5	Bifunctional protein Aas	1.44e-04	NA	0.008	0.6661
3. BF	Q0T128	Bifunctional protein Aas	1.82e-04	NA	0.008	0.6628
3. BF	B1XDP2	Bifunctional protein Aas	1.55e-04	NA	0.009	0.6661
3. BF	B7LF13	Bifunctional protein Aas	1.58e-04	NA	0.008	0.6663
3. BF	Q1R7H5	Bifunctional protein Aas	1.36e-04	NA	0.003	0.662
3. BF	Q9LLY4	1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic	4.29e-11	NA	2.69e-12	0.6928
3. BF	Q83JV7	Bifunctional protein Aas	1.46e-04	NA	0.008	0.6667
3. BF	A7ZQU2	Bifunctional protein Aas	1.66e-04	NA	0.008	0.6624
3. BF	Q8FEA6	Bifunctional protein Aas	1.76e-04	NA	0.003	0.6632
4. PB	Q93841	Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-1	3.33e-16	3.14e-16	2.29e-05	NA
4. PB	Q99943	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha	5.64e-12	2.81e-14	2.55e-08	NA
4. PB	O15120	1-acyl-sn-glycerol-3-phosphate acyltransferase beta	2.22e-16	2.68e-17	0.009	NA
4. PB	O35083	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha	3.95e-12	2.10e-16	2.18e-09	NA
4. PB	Q8K3K7	1-acyl-sn-glycerol-3-phosphate acyltransferase beta	3.33e-16	4.58e-18	1.50e-07	NA
4. PB	P33333	1-acyl-sn-glycerol-3-phosphate acyltransferase	1.14e-12	4.29e-13	6.08e-10	NA
4. PB	Q9US20	Uncharacterized acyltransferase C1851.02	9.30e-13	2.21e-10	0.002	NA
4. PB	P26647	1-acyl-sn-glycerol-3-phosphate acyltransferase	2.44e-15	3.78e-20	7.11e-04	NA
5. P	Q06510	Tafazzin	7.67e-06	1.82e-05	NA	NA
5. P	Q86VF5	2-acylglycerol O-acyltransferase 3	1.33e-05	2.64e-06	NA	NA
5. P	Q12185	Uncharacterized acyltransferase YDR018C	6.32e-08	1.28e-09	NA	NA
5. P	Q8L4Y2	Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4	8.71e-08	6.15e-05	NA	NA
5. P	Q58HT5	Acyl-CoA wax alcohol acyltransferase 1	2.92e-05	2.40e-04	NA	NA
5. P	A0QWG5	Phosphatidylinositol mannoside acyltransferase	2.43e-04	3.72e-03	NA	NA
5. P	Q70VZ7	2-acylglycerol O-acyltransferase 1	7.98e-05	1.62e-02	NA	NA
5. P	Q6UWP7	Lysocardiolipin acyltransferase 1	2.19e-08	1.05e-05	NA	NA
5. P	Q9ZV87	N-acylphosphatidylethanolamine synthase	3.35e-06	2.03e-12	NA	NA
5. P	Q6P342	Diacylglycerol O-acyltransferase 2	2.29e-05	6.29e-05	NA	NA
5. P	Q28C88	2-acylglycerol O-acyltransferase 1	2.04e-04	3.84e-04	NA	NA
5. P	P0ACV3	Lipid A biosynthesis palmitoleoyltransferase	1.34e-03	6.69e-04	NA	NA
5. P	Q9NUQ2	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon	1.00e-07	3.03e-05	NA	NA
5. P	P32129	Probable acyltransferase YihG	7.99e-13	2.87e-13	NA	NA
5. P	P9WKT0	Uncharacterized protein MT0523	1.61e-06	2.07e-09	NA	NA
5. P	Q9US27	Putative lysophosphatidic acid:oleoyl-CoA acyltransferase	5.86e-06	1.19e-08	NA	NA
5. P	Q6ZPD8	Diacylglycerol O-acyltransferase 2-like protein 6	1.59e-04	3.45e-05	NA	NA
5. P	P0ACV0	Lipid A biosynthesis lauroyltransferase	1.19e-04	8.99e-04	NA	NA
5. P	Q6E1M8	Acyl-CoA wax alcohol acyltransferase 2	1.53e-06	1.32e-03	NA	NA
5. P	Q11087	Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12	1.14e-08	7.68e-08	NA	NA
5. P	Q3KPP4	2-acylglycerol O-acyltransferase 1	1.52e-04	3.29e-04	NA	NA
5. P	Q9ASU1	Diacylglycerol O-acyltransferase 2	1.70e-07	1.61e-04	NA	NA
5. P	Q91ZV4	2-acylglycerol O-acyltransferase 1	5.93e-05	2.35e-03	NA	NA
5. P	A2ADU8	Diacylglycerol O-acyltransferase 2-like protein 6	5.07e-04	2.54e-05	NA	NA
5. P	Q70VZ8	Diacylglycerol O-acyltransferase 2	2.39e-05	5.46e-05	NA	NA
5. P	P9WMB5	Phosphatidylinositol mannoside acyltransferase	9.30e-05	9.16e-05	NA	NA
5. P	Q9ZE57	Uncharacterized protein RP090	5.88e-05	2.69e-09	NA	NA
5. P	P34426	Lipid droplet-regulating VLDL assembly factor AUP1 homolog	4.65e-07	2.59e-02	NA	NA
5. P	Q9D850	Transmembrane protein 68	1.72e-08	2.69e-08	NA	NA
5. P	P64724	Uncharacterized protein Mb0514	5.08e-06	2.07e-09	NA	NA
5. P	Q96UY1	Diacylglycerol O-acyltransferase 2B	4.24e-05	2.01e-05	NA	NA
5. P	Q4V9F0	Diacylglycerol O-acyltransferase 2	2.22e-05	4.22e-04	NA	NA
5. P	Q5M7F4	2-acylglycerol O-acyltransferase 2-B	3.71e-06	3.34e-03	NA	NA
5. P	Q2KHS5	2-acylglycerol O-acyltransferase 2-A	3.63e-06	2.86e-05	NA	NA
5. P	P9WMB4	Phosphatidylinositol mannoside acyltransferase	9.05e-05	9.56e-05	NA	NA
5. P	Q3SYC2	2-acylglycerol O-acyltransferase 2	3.51e-05	3.50e-04	NA	NA
5. P	Q8GWG0	Glycerol-3-phosphate acyltransferase 9	4.15e-09	5.09e-06	NA	NA
5. P	Q16635	Tafazzin	1.87e-05	4.03e-09	NA	NA
5. P	P0ACV1	Lipid A biosynthesis lauroyltransferase	1.32e-04	8.99e-04	NA	NA
5. P	Q91YX5	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1	1.92e-08	2.38e-06	NA	NA
5. P	Q96UY2	Diacylglycerol O-acyltransferase 2A	4.44e-05	4.65e-03	NA	NA
5. P	Q96PD6	2-acylglycerol O-acyltransferase 1	5.60e-05	1.19e-02	NA	NA
5. P	P24205	Lipid A biosynthesis myristoyltransferase	2.49e-04	5.14e-07	NA	NA
5. P	Q96MH6	Transmembrane protein 68	2.21e-08	7.43e-07	NA	NA
5. P	P45239	Lipid A biosynthesis lauroyltransferase	1.02e-03	1.17e-03	NA	NA
5. P	Q54GC1	Diacylglycerol O-acyltransferase 2	1.54e-06	9.36e-04	NA	NA
5. P	Q6E213	Acyl-CoA wax alcohol acyltransferase 2	2.33e-05	9.07e-05	NA	NA
5. P	Q92604	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1	1.78e-08	2.49e-07	NA	NA
5. P	Q5FVP8	Diacylglycerol O-acyltransferase 2	5.27e-05	4.99e-02	NA	NA
5. P	Q6PAZ3	Diacylglycerol O-acyltransferase 2	2.45e-05	1.02e-05	NA	NA
5. P	O94361	Uncharacterized acyltransferase C428.14	3.57e-08	6.14e-08	NA	NA
5. P	Q06508	Lysophosphatidic acid:oleoyl-CoA acyltransferase 1	9.81e-04	3.62e-11	NA	NA
5. P	Q22267	Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2	4.00e-15	1.21e-17	NA	NA
5. P	Q9LHN4	Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5	1.84e-08	1.20e-02	NA	NA
5. P	F1QCP6	Tafazzin	1.88e-07	1.62e-16	NA	NA
5. P	P9WKT1	Uncharacterized protein Rv0502	1.05e-06	2.07e-09	NA	NA
5. P	Q924S1	1-acyl-sn-glycerol-3-phosphate acyltransferase delta	3.79e-08	3.77e-02	NA	NA
5. P	Q54DX7	Taffazin	2.32e-05	1.28e-14	NA	NA
5. P	O74850	Diacylglycerol O-acyltransferase 1	3.75e-06	2.87e-04	NA	NA
5. P	A2ADU9	Acyl-CoA wax alcohol acyltransferase 1	2.80e-05	1.61e-03	NA	NA
5. P	P0ACV2	Lipid A biosynthesis palmitoleoyltransferase	1.33e-03	6.69e-04	NA	NA
5. P	Q5M8H5	2-acylglycerol O-acyltransferase 2	4.01e-06	1.81e-02	NA	NA
5. P	P54878	Uncharacterized protein ML2427	2.56e-07	5.56e-08	NA	NA
5. P	P38226	2-acyl-1-lysophosphatidylinositol acyltransferase	1.11e-09	1.21e-08	NA	NA
5. P	Q8K4X7	1-acyl-sn-glycerol-3-phosphate acyltransferase delta	3.71e-08	4.40e-02	NA	NA
5. P	Q9DCV3	Diacylglycerol O-acyltransferase 2	5.28e-05	1.46e-02	NA	NA
5. P	A6QP72	Diacylglycerol O-acyltransferase 2-like protein 6	2.26e-04	1.15e-04	NA	NA
5. P	Q80W94	2-acylglycerol O-acyltransferase 2	4.03e-05	1.52e-03	NA	NA
5. P	Q9D1E8	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon	1.25e-07	6.71e-05	NA	NA
5. P	Q08750	Protein MUM3	1.38e-02	2.32e-05	NA	NA
5. P	K7K424	Diacylglycerol O-acyltransferase 2D	1.54e-06	8.54e-04	NA	NA
6. F	A6TGV0	Glycerol-3-phosphate acyltransferase	3.63e-04	NA	NA	0.4567
6. F	A1JPF0	Bifunctional protein Aas	1.44e-04	NA	NA	0.6711
6. F	A4W5F4	Glycerol-3-phosphate acyltransferase	2.62e-04	NA	NA	0.4508
6. F	B1XC40	Glycerol-3-phosphate acyltransferase	2.72e-04	NA	NA	0.4594
6. F	A3N1B3	Glycerol-3-phosphate acyltransferase	7.11e-04	NA	NA	0.4499
6. F	Q8ZMA4	Bifunctional protein Aas	1.36e-04	NA	NA	0.6691
6. F	A9N1L4	Glycerol-3-phosphate acyltransferase	2.86e-04	NA	NA	0.5333
6. F	Q1C0T9	Glycerol-3-phosphate acyltransferase	3.71e-04	NA	NA	0.463
6. F	Q5PEN7	Bifunctional protein Aas	1.58e-04	NA	NA	0.6682
6. F	B1JBS6	Glycerol-3-phosphate acyltransferase	5.93e-04	NA	NA	0.5467
6. F	Q1R3P5	Glycerol-3-phosphate acyltransferase	3.19e-04	NA	NA	0.4286
6. F	Q0SXQ8	Glycerol-3-phosphate acyltransferase	3.19e-04	NA	NA	0.4298
6. F	Q6IWY1	1-acyl-sn-glycerol-3-phosphate acyltransferase 2	3.00e-08	NA	NA	0.4971
6. F	A1AIL8	Glycerol-3-phosphate acyltransferase	3.28e-04	NA	NA	0.4555
6. F	Q9PEJ7	Glycerol-3-phosphate acyltransferase	1.13e-03	NA	NA	0.4586
6. F	Q42713	Glycerol-3-phosphate acyltransferase, chloroplastic	1.05e-05	NA	NA	0.5348
6. F	B7M7V4	Glycerol-3-phosphate acyltransferase	2.76e-04	NA	NA	0.4225
6. F	Q8DD48	Glycerol-3-phosphate acyltransferase	5.97e-04	NA	NA	0.4498
6. F	B4T503	Bifunctional protein Aas	1.31e-04	NA	NA	0.6679
6. F	C0PXJ8	Bifunctional protein Aas	1.59e-04	NA	NA	0.6692
6. F	B8ZRA3	Glycerol-3-phosphate acyltransferase	6.81e-04	NA	NA	0.5364
6. F	A9N3H8	Bifunctional protein Aas	1.76e-04	NA	NA	0.6645
6. F	C3LPT5	Glycerol-3-phosphate acyltransferase	2.73e-04	NA	NA	0.4504
6. F	Q6D107	Bifunctional protein Aas	1.73e-04	NA	NA	0.6779
6. F	B5FUB9	Bifunctional protein Aas	1.53e-04	NA	NA	0.681
6. F	Q5GJ77	Glycerol-3-phosphate acyltransferase 1, mitochondrial	4.89e-04	NA	NA	0.4545
6. F	B5FQQ9	Glycerol-3-phosphate acyltransferase	2.51e-04	NA	NA	0.4619
6. F	A5UDX7	Glycerol-3-phosphate acyltransferase	2.99e-04	NA	NA	0.4206
6. F	B4EYR5	Glycerol-3-phosphate acyltransferase	3.52e-04	NA	NA	0.4333
6. F	A8A7E1	Glycerol-3-phosphate acyltransferase	3.13e-04	NA	NA	0.4563
6. F	Q9CLN7	Glycerol-3-phosphate acyltransferase	2.94e-04	NA	NA	0.4039
6. F	Q57KA7	Bifunctional protein Aas	1.43e-04	NA	NA	0.6668
6. F	Q327U8	Glycerol-3-phosphate acyltransferase	3.32e-04	NA	NA	0.4535
6. F	Q12ID7	Glycerol-3-phosphate acyltransferase	3.78e-04	NA	NA	0.4417
6. F	B5F1Q4	Glycerol-3-phosphate acyltransferase	3.00e-04	NA	NA	0.4574
6. F	Q87EJ1	Glycerol-3-phosphate acyltransferase	9.69e-04	NA	NA	0.5019
6. F	B5RDY6	Bifunctional protein Aas	1.59e-04	NA	NA	0.6647
6. F	C0Q4E0	Glycerol-3-phosphate acyltransferase	2.88e-04	NA	NA	0.533
6. F	B7LNJ2	Bifunctional protein Aas	1.28e-04	NA	NA	0.6633
6. F	Q57GZ2	Glycerol-3-phosphate acyltransferase	3.26e-04	NA	NA	0.4575
6. F	Q68F37	Glycerol-3-phosphate acyltransferase 3	5.98e-07	NA	NA	0.5448
6. F	A8GKB6	Glycerol-3-phosphate acyltransferase	2.82e-04	NA	NA	0.4579
6. F	B5BJV8	Glycerol-3-phosphate acyltransferase	3.13e-04	NA	NA	0.4576
6. F	Q8ZKH9	Glycerol-3-phosphate acyltransferase	2.47e-04	NA	NA	0.4583
6. F	Q0HDL6	Glycerol-3-phosphate acyltransferase	2.94e-04	NA	NA	0.4478
6. F	Q8ZJ18	Glycerol-3-phosphate acyltransferase	2.94e-04	NA	NA	0.4642
6. F	B0U229	Glycerol-3-phosphate acyltransferase	2.07e-03	NA	NA	0.5114
6. F	A1KLH6	Glycerol-3-phosphate acyltransferase	6.76e-04	NA	NA	0.5384
6. F	Q4KHJ1	Glycerol-3-phosphate acyltransferase	1.39e-03	NA	NA	0.4722
6. F	Q9HXW7	Glycerol-3-phosphate acyltransferase	1.09e-03	NA	NA	0.4279
6. F	A9KUW7	Glycerol-3-phosphate acyltransferase	3.21e-04	NA	NA	0.4571
6. F	P9WI60	Glycerol-3-phosphate acyltransferase	7.25e-04	NA	NA	0.5389
6. F	B7LL13	Glycerol-3-phosphate acyltransferase	2.99e-04	NA	NA	0.4588
6. F	Q1I610	Glycerol-3-phosphate acyltransferase	6.12e-04	NA	NA	0.4798
6. F	Q7N7A9	Bifunctional protein Aas	9.09e-05	NA	NA	0.6538
6. F	B7N2P8	Glycerol-3-phosphate acyltransferase	3.45e-04	NA	NA	0.4578
6. F	C3K4R1	Glycerol-3-phosphate acyltransferase	1.34e-03	NA	NA	0.4955
6. F	B5FCB3	Glycerol-3-phosphate acyltransferase	5.48e-04	NA	NA	0.4368
6. F	A0L2D7	Glycerol-3-phosphate acyltransferase	3.81e-04	NA	NA	0.4516
6. F	P9WI58	Putative acyltransferase plsB1	4.23e-05	NA	NA	0.5366
6. F	B4TGR5	Bifunctional protein Aas	1.54e-04	NA	NA	0.6641
6. F	Q7TYH5	Glycerol-3-phosphate acyltransferase	7.37e-04	NA	NA	0.4682
6. F	C6DE43	Bifunctional protein Aas	1.78e-04	NA	NA	0.6556
6. F	Q3YUU3	Glycerol-3-phosphate acyltransferase	3.40e-04	NA	NA	0.4271
6. F	A7FFD1	Bifunctional protein Aas	1.24e-04	NA	NA	0.7134
6. F	Q0I2G8	Glycerol-3-phosphate acyltransferase	2.81e-04	NA	NA	0.4362
6. F	A4YC03	Glycerol-3-phosphate acyltransferase	3.23e-04	NA	NA	0.4632
6. F	Q15MZ1	Glycerol-3-phosphate acyltransferase	6.24e-04	NA	NA	0.4757
6. F	A4TRU7	Glycerol-3-phosphate acyltransferase	2.80e-04	NA	NA	0.459
6. F	P44857	Glycerol-3-phosphate acyltransferase	2.87e-04	NA	NA	0.4296
6. F	Q7MQ86	Glycerol-3-phosphate acyltransferase	5.53e-04	NA	NA	0.4477
6. F	A9ULG4	Lipid droplet-regulating VLDL assembly factor AUP1	1.71e-06	NA	NA	0.5055
6. F	B0TNU4	Glycerol-3-phosphate acyltransferase	2.96e-04	NA	NA	0.4531
6. F	B8F321	Glycerol-3-phosphate acyltransferase	1.19e-03	NA	NA	0.4306
6. F	Q48F46	Glycerol-3-phosphate acyltransferase	5.37e-04	NA	NA	0.4891
6. F	B1JQC1	Bifunctional protein Aas	1.44e-04	NA	NA	0.6662
6. F	Q5F3X0	Lysocardiolipin acyltransferase 1	3.65e-10	NA	NA	0.5722
6. F	Q886Q7	Glycerol-3-phosphate acyltransferase	5.52e-04	NA	NA	0.4588
6. F	B5BFH6	Bifunctional protein Aas	1.58e-04	NA	NA	0.6676
6. F	Q8Z406	Bifunctional protein Aas	1.60e-04	NA	NA	0.6671
6. F	A1JRU2	Glycerol-3-phosphate acyltransferase	2.73e-04	NA	NA	0.4569
6. F	B5QWU2	Bifunctional protein Aas	1.49e-04	NA	NA	0.6665
6. F	B6I5Q6	Glycerol-3-phosphate acyltransferase	3.30e-04	NA	NA	0.4236
6. F	A4WE11	Bifunctional protein Aas	2.17e-04	NA	NA	0.6552
6. F	B0KS79	Glycerol-3-phosphate acyltransferase	1.03e-03	NA	NA	0.4593
6. F	Q88MQ0	Glycerol-3-phosphate acyltransferase	1.20e-03	NA	NA	0.4528
6. F	B8CUW9	Glycerol-3-phosphate acyltransferase	3.03e-04	NA	NA	0.4684
6. F	A7FN98	Glycerol-3-phosphate acyltransferase	3.69e-04	NA	NA	0.4616
6. F	Q9KVP8	Glycerol-3-phosphate acyltransferase	2.70e-04	NA	NA	0.457
6. F	B7V2U0	Glycerol-3-phosphate acyltransferase	1.05e-03	NA	NA	0.4249
6. F	B1H1N7	Lipid droplet-regulating VLDL assembly factor AUP1	2.61e-05	NA	NA	0.507
6. F	Q8P3E3	Glycerol-3-phosphate acyltransferase	9.47e-04	NA	NA	0.4658
6. F	B1JNE5	Glycerol-3-phosphate acyltransferase	2.98e-04	NA	NA	0.4641
6. F	A5F4F5	Glycerol-3-phosphate acyltransferase	6.57e-04	NA	NA	0.4532
6. F	B1IUL1	Glycerol-3-phosphate acyltransferase	2.71e-04	NA	NA	0.4283
6. F	A9MGP8	Glycerol-3-phosphate acyltransferase	2.47e-04	NA	NA	0.5329
6. F	B4TUM9	Bifunctional protein Aas	1.57e-04	NA	NA	0.6678
6. F	A3QIU8	Glycerol-3-phosphate acyltransferase	3.70e-04	NA	NA	0.5158
6. F	A6WU04	Glycerol-3-phosphate acyltransferase	3.25e-04	NA	NA	0.4655
6. F	A4XWX9	Glycerol-3-phosphate acyltransferase	6.78e-04	NA	NA	0.4928
6. F	A4TLD3	Bifunctional protein Aas	1.88e-04	NA	NA	0.6635
6. F	A5U5H8	Glycerol-3-phosphate acyltransferase	1.00e-03	NA	NA	0.4482
6. F	B1LPK6	Glycerol-3-phosphate acyltransferase	3.37e-04	NA	NA	0.4541
6. F	B5XXZ1	Glycerol-3-phosphate acyltransferase	2.59e-04	NA	NA	0.4264
6. F	Q02RE5	Glycerol-3-phosphate acyltransferase	5.01e-04	NA	NA	0.3986
6. F	A0KEQ0	Glycerol-3-phosphate acyltransferase	6.91e-04	NA	NA	0.417
6. F	Q4R581	1-acyl-sn-glycerol-3-phosphate acyltransferase delta	3.23e-08	NA	NA	0.5638
6. F	A8H9R9	Glycerol-3-phosphate acyltransferase	2.57e-04	NA	NA	0.4467
6. F	Q1CE96	Glycerol-3-phosphate acyltransferase	4.25e-04	NA	NA	0.466
6. F	B5QZ60	Glycerol-3-phosphate acyltransferase	2.46e-04	NA	NA	0.4217
6. F	Q667F1	Bifunctional protein Aas	1.52e-04	NA	NA	0.6684
6. F	Q7UBC6	Glycerol-3-phosphate acyltransferase	3.16e-04	NA	NA	0.4279
6. F	B5Z182	Glycerol-3-phosphate acyltransferase	3.18e-04	NA	NA	0.4514
6. F	A1SBC6	Glycerol-3-phosphate acyltransferase	3.66e-04	NA	NA	0.4693
6. F	Q4QMF0	Glycerol-3-phosphate acyltransferase	3.09e-04	NA	NA	0.4549
6. F	A5W867	Glycerol-3-phosphate acyltransferase	1.15e-03	NA	NA	0.4213
6. F	B2HNJ0	Glycerol-3-phosphate acyltransferase	6.34e-04	NA	NA	0.4706
6. F	P10349	Glycerol-3-phosphate acyltransferase ATS12, chloroplastic	2.91e-05	NA	NA	0.5286
6. F	B0BQ47	Glycerol-3-phosphate acyltransferase	7.32e-04	NA	NA	0.4607
6. F	P58130	Glycerol-3-phosphate acyltransferase	2.71e-04	NA	NA	0.4285
6. F	Q87KN0	Glycerol-3-phosphate acyltransferase	2.52e-04	NA	NA	0.4603
6. F	C5A134	Glycerol-3-phosphate acyltransferase	2.69e-04	NA	NA	0.4225
6. F	Q66FG9	Glycerol-3-phosphate acyltransferase	3.12e-04	NA	NA	0.4632
6. F	B5R7T4	Glycerol-3-phosphate acyltransferase	2.48e-04	NA	NA	0.4581
6. F	B4TDL8	Glycerol-3-phosphate acyltransferase	2.52e-04	NA	NA	0.4263
6. F	Q48AL2	Glycerol-3-phosphate acyltransferase	6.63e-04	NA	NA	0.4517
6. F	C6DKD0	Glycerol-3-phosphate acyltransferase	3.17e-04	NA	NA	0.4612
6. F	Q1CAS8	Bifunctional protein Aas	1.32e-04	NA	NA	0.6683
6. F	Q5R757	1-acyl-sn-glycerol-3-phosphate acyltransferase delta	1.00e-09	NA	NA	0.555
6. F	Q9X7B0	Glycerol-3-phosphate acyltransferase	7.05e-04	NA	NA	0.5405
6. F	A3FPG8	Glycerol-3-phosphate acyltransferase 4	2.14e-06	NA	NA	0.577
6. F	Q089E1	Glycerol-3-phosphate acyltransferase	3.28e-04	NA	NA	0.4328
6. F	B4T1T0	Glycerol-3-phosphate acyltransferase	3.00e-04	NA	NA	0.4571
6. F	Q74RZ6	Bifunctional protein Aas	1.51e-04	NA	NA	0.6648
6. F	Q3IF27	Glycerol-3-phosphate acyltransferase	9.32e-04	NA	NA	0.4558
6. F	Q9XFW4	1-acyl-sn-glycerol-3-phosphate acyltransferase 2	2.38e-08	NA	NA	0.5431
6. F	A4IF87	Dihydroxyacetone phosphate acyltransferase	1.65e-04	NA	NA	0.5017
6. F	Q6D9I7	Glycerol-3-phosphate acyltransferase	2.88e-04	NA	NA	0.4627
6. F	B4TQQ3	Glycerol-3-phosphate acyltransferase	2.54e-04	NA	NA	0.4601
6. F	A6V1B5	Glycerol-3-phosphate acyltransferase	1.11e-03	NA	NA	0.4249
6. F	Q4ZWU3	Glycerol-3-phosphate acyltransferase	6.65e-04	NA	NA	0.5028
6. F	B5F4V4	Bifunctional protein Aas	1.29e-04	NA	NA	0.6674
6. F	B2VFS7	Bifunctional protein Aas	1.58e-04	NA	NA	0.6812
6. F	C5B706	Glycerol-3-phosphate acyltransferase	2.89e-04	NA	NA	0.4614
6. F	A7ZUR3	Glycerol-3-phosphate acyltransferase	2.71e-04	NA	NA	0.4309
6. F	Q7VNI5	Glycerol-3-phosphate acyltransferase	7.39e-04	NA	NA	0.4486
6. F	B7LAY9	Glycerol-3-phosphate acyltransferase	2.68e-04	NA	NA	0.426
6. F	B7NS05	Glycerol-3-phosphate acyltransferase	2.81e-04	NA	NA	0.4237
6. F	Q3KHC9	Glycerol-3-phosphate acyltransferase	1.33e-03	NA	NA	0.4787
6. F	B7MJ31	Glycerol-3-phosphate acyltransferase	2.75e-04	NA	NA	0.4287
6. F	B1KM69	Glycerol-3-phosphate acyltransferase	2.88e-04	NA	NA	0.4489
6. F	Q8Z1T6	Glycerol-3-phosphate acyltransferase	2.98e-04	NA	NA	0.4471
6. F	Q5PL16	Glycerol-3-phosphate acyltransferase	2.98e-04	NA	NA	0.4565
6. F	P65735	Putative acyltransferase plsB1	4.10e-05	NA	NA	0.6157
6. F	Q5E208	Glycerol-3-phosphate acyltransferase	6.51e-04	NA	NA	0.4267
6. F	B7VM97	Glycerol-3-phosphate acyltransferase	5.30e-04	NA	NA	0.4489
6. F	A8FPP1	Glycerol-3-phosphate acyltransferase	3.33e-04	NA	NA	0.4675
6. F	Q8PES0	Glycerol-3-phosphate acyltransferase	3.05e-03	NA	NA	0.4696
6. F	Q6DCK1	Lysophospholipid acyltransferase LPCAT4	1.44e-06	NA	NA	0.5501
6. F	A5UHQ2	Glycerol-3-phosphate acyltransferase	3.11e-04	NA	NA	0.4099
6. F	A9R2S1	Bifunctional protein Aas	1.49e-04	NA	NA	0.6645
6. F	B4S1W8	Glycerol-3-phosphate acyltransferase	6.27e-04	NA	NA	0.4653
6. F	Q31TU9	Glycerol-3-phosphate acyltransferase	3.44e-04	NA	NA	0.4261
6. F	B7UPK2	Glycerol-3-phosphate acyltransferase	2.67e-04	NA	NA	0.4225
6. F	B2TX75	Glycerol-3-phosphate acyltransferase	2.73e-04	NA	NA	0.4526
6. F	Q2NR08	Glycerol-3-phosphate acyltransferase	2.87e-04	NA	NA	0.447
6. F	Q5RA57	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma	5.88e-08	NA	NA	0.5766
6. F	B2I7N1	Glycerol-3-phosphate acyltransferase	2.14e-03	NA	NA	0.4874
6. F	P0A7A8	Glycerol-3-phosphate acyltransferase	2.78e-04	NA	NA	0.4226
6. F	Q5ZLL8	Glycerol-3-phosphate acyltransferase 3	5.53e-07	NA	NA	0.5179
6. F	B2JZ75	Bifunctional protein Aas	1.51e-04	NA	NA	0.6657
6. F	B7NFY5	Glycerol-3-phosphate acyltransferase	3.23e-04	NA	NA	0.4594
6. F	A1RE94	Glycerol-3-phosphate acyltransferase	3.14e-04	NA	NA	0.463
6. F	A3CYX8	Glycerol-3-phosphate acyltransferase	3.09e-04	NA	NA	0.4531
6. F	Q28C60	Lysophospholipid acyltransferase LPCAT4	1.42e-06	NA	NA	0.5343
6. F	B8ECL8	Glycerol-3-phosphate acyltransferase	2.81e-04	NA	NA	0.4636
6. F	Q8E8Q9	Glycerol-3-phosphate acyltransferase	3.59e-04	NA	NA	0.5168
6. F	B3GXZ3	Glycerol-3-phosphate acyltransferase	7.50e-04	NA	NA	0.446
6. F	B6ENU1	Glycerol-3-phosphate acyltransferase	6.75e-04	NA	NA	0.4155
6. F	B2K1U5	Glycerol-3-phosphate acyltransferase	3.04e-04	NA	NA	0.4623
6. F	Q5R6J7	Glycerol-3-phosphate acyltransferase 4	1.29e-06	NA	NA	0.5973
6. F	C4K8M7	Glycerol-3-phosphate acyltransferase	6.20e-04	NA	NA	0.4048
6. F	Q7MZB7	Glycerol-3-phosphate acyltransferase	3.60e-04	NA	NA	0.4368
6. F	C1AEU7	Glycerol-3-phosphate acyltransferase	6.98e-04	NA	NA	0.4719
6. F	A6VQ68	Glycerol-3-phosphate acyltransferase	6.82e-04	NA	NA	0.4464
6. F	Q0HPW7	Glycerol-3-phosphate acyltransferase	3.16e-04	NA	NA	0.517
7. B	P31119	Bifunctional protein Aas	1.80e-04	NA	0.009	NA
7. B	Q8GXU8	1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic	1.27e-10	NA	8.48e-12	NA