Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54830.1
JCVISYN3A_0513
ACP synthase.
M. mycoides homolog: Q6MT35.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 18
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 4
Total Homologs: 586
Unique PROST Homologs: 87
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 8
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q2SS83
(Holo-[acyl-carrier-protein] synthase) with a FATCAT P-Value: 0 and RMSD of 0.24 angstrom. The sequence alignment identity is 86.4%.
Structural alignment shown in left. Query protein AVX54830.1 colored as red in alignment, homolog Q2SS83 colored as blue.
Query protein AVX54830.1 is also shown in right top, homolog Q2SS83 showed in right bottom. They are colored based on secondary structures.
AVX54830.1 MINNVGIDIVENKRIKLKKEFIIKVLSTNEIQTFNTKTKKQKKEFLAGRWAVKEAIIKTLDQAISMNKIDIEYVNQKPVIQNKELQNILISISHEKKYAI 100 Q2SS83 MINNVGIDIVENKRIKLKEEFIVKVLSANEIKTFNIKNKKQKREFLAGRWAIKEAIIKTLDQPISMNKIDIEYINDKPVIKNQELQNILISISHEKKYAV 100 AVX54830.1 GIALKQSDNK 110 Q2SS83 GIALKQCDNK 110
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0000287 | magnesium ion binding |
| 1. PBF | GO:0008897 | holo-[acyl-carrier-protein] synthase activity |
| 1. PBF | GO:0006633 | fatty acid biosynthetic process |
| 2. PF | GO:0031108 | holo-[acyl-carrier-protein] biosynthetic process |
| 2. PF | GO:0008610 | lipid biosynthetic process |
| 3. BF | GO:0005835 | fatty acid synthase complex |
| 3. BF | GO:0042759 | long-chain fatty acid biosynthetic process |
| 3. BF | GO:0102131 | obsolete 3-oxo-glutaryl-[acp] methyl ester reductase activity |
| 3. BF | GO:0004316 | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity |
| 3. BF | GO:0004315 | 3-oxoacyl-[acyl-carrier-protein] synthase activity |
| 3. BF | GO:0102132 | obsolete 3-oxo-pimeloyl-[acp] methyl ester reductase activity |
| 3. BF | GO:0004321 | fatty-acyl-CoA synthase activity |
| 4. PB | GO:0018070 | peptidyl-serine phosphopantetheinylation |
| 6. F | GO:0017000 | antibiotic biosynthetic process |
| 6. F | GO:0005829 | cytosol |
| 6. F | GO:1900192 | positive regulation of single-species biofilm formation |
| 6. F | GO:0045461 | sterigmatocystin biosynthetic process |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0006629 | lipid metabolic process |
| GO:0008897 | holo-[acyl-carrier-protein] synthase activity |
| GO:0018215 | protein phosphopantetheinylation |
| GO:0006633 | fatty acid biosynthetic process |
| GO:0006631 | fatty acid metabolic process |
| GO:0005737 | cytoplasm |
| GO:0046872 | metal ion binding |
| GO:0000287 | magnesium ion binding |
| GO:0044238 | primary metabolic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q8NMS4 | Holo-[acyl-carrier-protein] synthase | 1.97e-09 | 1.14e-20 | 1.49e-04 | 0.7667 |
| 1. PBF | B3WAR1 | Holo-[acyl-carrier-protein] synthase | 1.85e-14 | 3.11e-27 | 3.15e-07 | 0.862 |
| 1. PBF | Q3ZZK3 | Holo-[acyl-carrier-protein] synthase | 1.55e-09 | 1.49e-25 | 1.85e-05 | 0.7721 |
| 1. PBF | Q053N9 | Holo-[acyl-carrier-protein] synthase | 4.54e-10 | 1.62e-29 | 3.22e-05 | 0.8047 |
| 1. PBF | Q04U76 | Holo-[acyl-carrier-protein] synthase | 2.02e-10 | 1.62e-29 | 3.22e-05 | 0.8051 |
| 1. PBF | P59475 | Holo-[acyl-carrier-protein] synthase | 2.51e-12 | 1.81e-30 | 0.009 | 0.8371 |
| 1. PBF | B1YF32 | Holo-[acyl-carrier-protein] synthase | 2.70e-14 | 1.71e-25 | 9.14e-12 | 0.9005 |
| 1. PBF | Q5LY70 | Holo-[acyl-carrier-protein] synthase | 4.77e-15 | 4.85e-38 | 1.15e-09 | 0.9077 |
| 1. PBF | A7MZA4 | Holo-[acyl-carrier-protein] synthase | 1.24e-12 | 7.29e-32 | 1.92e-04 | 0.847 |
| 1. PBF | B2V003 | Holo-[acyl-carrier-protein] synthase | 1.09e-11 | 3.76e-33 | 1.48e-06 | 0.8054 |
| 1. PBF | C3PP12 | Holo-[acyl-carrier-protein] synthase | 3.77e-13 | 2.60e-27 | 4.25e-04 | 0.8897 |
| 1. PBF | Q890W8 | Holo-[acyl-carrier-protein] synthase | 2.89e-11 | 9.35e-33 | 0.005 | 0.7995 |
| 1. PBF | B8D0V9 | Holo-[acyl-carrier-protein] synthase | 3.50e-11 | 3.45e-29 | 1.48e-08 | 0.844 |
| 1. PBF | Q1J544 | Holo-[acyl-carrier-protein] synthase | 9.99e-15 | 4.05e-40 | 1.31e-07 | 0.9005 |
| 1. PBF | Q04J73 | Holo-[acyl-carrier-protein] synthase | 4.33e-15 | 2.05e-39 | 2.33e-08 | 0.9108 |
| 1. PBF | Q6GF02 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 4.43e-41 | 5.74e-12 | 0.8817 |
| 1. PBF | B3R1Z5 | Holo-[acyl-carrier-protein] synthase | 2.40e-13 | 1.51e-25 | 8.38e-05 | 0.8832 |
| 1. PBF | O25488 | Holo-[acyl-carrier-protein] synthase | 1.49e-09 | 1.65e-30 | 3.59e-05 | 0.7661 |
| 1. PBF | Q0SW89 | Holo-[acyl-carrier-protein] synthase | 4.32e-11 | 6.60e-24 | 2.71e-04 | 0.799 |
| 1. PBF | P0CZ51 | Holo-[acyl-carrier-protein] synthase | 1.10e-14 | 4.05e-40 | 1.31e-07 | 0.9005 |
| 1. PBF | Q9ZB79 | Holo-[acyl-carrier-protein] synthase | 3.33e-16 | 8.86e-42 | 1.69e-07 | 0.8752 |
| 1. PBF | B5YJG8 | Holo-[acyl-carrier-protein] synthase | 6.63e-12 | 1.24e-38 | 2.10e-08 | 0.8351 |
| 1. PBF | A0PY92 | Holo-[acyl-carrier-protein] synthase | 8.04e-11 | 4.12e-16 | 7.41e-08 | 0.8479 |
| 1. PBF | A8GW65 | Holo-[acyl-carrier-protein] synthase | 1.89e-13 | 3.59e-31 | 9.78e-06 | 0.8393 |
| 1. PBF | Q7VRR2 | Holo-[acyl-carrier-protein] synthase | 2.77e-13 | 3.23e-30 | 6.72e-04 | 0.8575 |
| 1. PBF | Q31HN9 | Holo-[acyl-carrier-protein] synthase | 2.71e-13 | 7.74e-30 | 1.73e-09 | 0.8597 |
| 1. PBF | Q8CNK6 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 9.37e-47 | 9.71e-10 | 0.8772 |
| 1. PBF | Q5HME4 | Holo-[acyl-carrier-protein] synthase | 1.33e-15 | 9.37e-47 | 9.71e-10 | 0.8779 |
| 1. PBF | B7MYJ4 | Holo-[acyl-carrier-protein] synthase | 1.75e-13 | 1.92e-31 | 0.011 | 0.8336 |
| 1. PBF | Q5L3G7 | Holo-[acyl-carrier-protein] synthase | 7.11e-15 | 6.45e-31 | 3.45e-13 | 0.8835 |
| 1. PBF | Q9PQ97 | Holo-[acyl-carrier-protein] synthase | 1.63e-13 | 6.67e-47 | 2.22e-04 | 0.7805 |
| 1. PBF | B1AJ32 | Holo-[acyl-carrier-protein] synthase | 1.31e-13 | 6.67e-47 | 2.22e-04 | 0.7797 |
| 1. PBF | Q5M2S6 | Holo-[acyl-carrier-protein] synthase | 4.88e-15 | 4.85e-38 | 1.15e-09 | 0.9079 |
| 1. PBF | Q9KFG1 | Holo-[acyl-carrier-protein] synthase | 9.99e-16 | 2.66e-38 | 1.71e-13 | 0.8639 |
| 1. PBF | Q0K8N7 | Holo-[acyl-carrier-protein] synthase | 3.02e-13 | 1.23e-24 | 4.51e-04 | 0.8554 |
| 1. PBF | A6VUP9 | Holo-[acyl-carrier-protein] synthase | 2.52e-13 | 2.42e-39 | 6.69e-04 | 0.8937 |
| 1. PBF | A1AE93 | Holo-[acyl-carrier-protein] synthase | 1.82e-13 | 1.92e-31 | 0.011 | 0.8496 |
| 1. PBF | B2G5M8 | Holo-[acyl-carrier-protein] synthase | 3.54e-14 | 4.02e-37 | 3.36e-10 | 0.8814 |
| 1. PBF | A7NPN5 | Holo-[acyl-carrier-protein] synthase | 3.39e-08 | 7.98e-20 | 8.73e-06 | 0.7647 |
| 1. PBF | A9BJX6 | Holo-[acyl-carrier-protein] synthase | 9.33e-15 | 1.22e-28 | 2.91e-11 | 0.8999 |
| 1. PBF | O84102 | Holo-[acyl-carrier-protein] synthase | 5.65e-11 | 1.85e-31 | 0.032 | 0.8065 |
| 1. PBF | A2RLV5 | Holo-[acyl-carrier-protein] synthase | 1.52e-14 | 2.17e-42 | 2.62e-09 | 0.8865 |
| 1. PBF | C0R3N6 | Holo-[acyl-carrier-protein] synthase | 4.19e-14 | 1.34e-34 | 0.012 | 0.8448 |
| 1. PBF | B4U177 | Holo-[acyl-carrier-protein] synthase | 1.03e-14 | 2.01e-36 | 4.43e-09 | 0.88 |
| 1. PBF | B9MKY6 | Holo-[acyl-carrier-protein] synthase | 2.43e-11 | 3.82e-26 | 1.07e-10 | 0.8172 |
| 1. PBF | C1L1F5 | Holo-[acyl-carrier-protein] synthase | 8.55e-15 | 3.76e-39 | 7.40e-09 | 0.8505 |
| 1. PBF | B7GIY1 | Holo-[acyl-carrier-protein] synthase | 4.66e-15 | 3.53e-39 | 2.02e-12 | 0.8335 |
| 1. PBF | Q6MAG4 | Holo-[acyl-carrier-protein] synthase | 5.13e-12 | 2.02e-33 | 1.32e-08 | 0.8357 |
| 1. PBF | Q88Z44 | Holo-[acyl-carrier-protein] synthase | 6.00e-15 | 1.08e-37 | 9.20e-06 | 0.8611 |
| 1. PBF | A4SCZ9 | Holo-[acyl-carrier-protein] synthase | 1.71e-11 | 1.21e-25 | 2.52e-06 | 0.8348 |
| 1. PBF | P63472 | Holo-[acyl-carrier-protein] synthase | 9.88e-15 | 4.11e-38 | 8.39e-07 | 0.9022 |
| 1. PBF | Q030B5 | Holo-[acyl-carrier-protein] synthase | 1.61e-14 | 2.17e-42 | 2.62e-09 | 0.8862 |
| 1. PBF | B2A4X6 | Holo-[acyl-carrier-protein] synthase | 1.68e-12 | 2.23e-33 | 1.44e-04 | 0.8312 |
| 1. PBF | B8IZX1 | Holo-[acyl-carrier-protein] synthase | 3.68e-11 | 9.14e-30 | 4.15e-08 | 0.8304 |
| 1. PBF | P63471 | Holo-[acyl-carrier-protein] synthase | 9.55e-15 | 4.11e-38 | 8.39e-07 | 0.9028 |
| 1. PBF | Q3YSD5 | Holo-[acyl-carrier-protein] synthase | 7.02e-14 | 4.10e-31 | 0.002 | 0.8132 |
| 1. PBF | Q81JG3 | Holo-[acyl-carrier-protein] synthase | 5.55e-16 | 2.27e-37 | 4.29e-09 | 0.9175 |
| 1. PBF | B0B9K8 | Holo-[acyl-carrier-protein] synthase | 7.32e-11 | 2.65e-32 | 0.017 | 0.8035 |
| 1. PBF | Q1JF93 | Holo-[acyl-carrier-protein] synthase | 1.07e-14 | 4.05e-40 | 1.31e-07 | 0.9005 |
| 1. PBF | A5CDM0 | Holo-[acyl-carrier-protein] synthase | 1.89e-14 | 2.38e-27 | 4.40e-07 | 0.8568 |
| 1. PBF | B0SM94 | Holo-[acyl-carrier-protein] synthase | 6.77e-09 | 9.21e-25 | 1.46e-07 | 0.7868 |
| 1. PBF | Q8ESK9 | Holo-[acyl-carrier-protein] synthase | 2.55e-15 | 6.42e-45 | 6.32e-06 | 0.8606 |
| 1. PBF | Q92H90 | Holo-[acyl-carrier-protein] synthase | 3.81e-13 | 2.66e-28 | 4.25e-04 | 0.8788 |
| 1. PBF | Q32CV8 | Holo-[acyl-carrier-protein] synthase | 1.88e-13 | 1.82e-31 | 0.011 | 0.8524 |
| 1. PBF | O66995 | Holo-[acyl-carrier-protein] synthase | 3.40e-09 | 5.86e-30 | 1.42e-05 | 0.7442 |
| 1. PBF | P75480 | Holo-[acyl-carrier-protein] synthase | 5.58e-14 | 7.09e-41 | 1.26e-04 | 0.8645 |
| 1. PBF | Q492D3 | Holo-[acyl-carrier-protein] synthase | 4.33e-13 | 1.29e-28 | 1.04e-04 | 0.8571 |
| 1. PBF | Q72AT2 | Holo-[acyl-carrier-protein] synthase | 4.83e-12 | 2.26e-29 | 9.45e-05 | 0.833 |
| 1. PBF | C0MEB8 | Holo-[acyl-carrier-protein] synthase | 1.09e-14 | 1.28e-35 | 2.86e-09 | 0.8882 |
| 1. PBF | Q6HPE3 | Holo-[acyl-carrier-protein] synthase | 5.55e-16 | 2.27e-37 | 4.29e-09 | 0.9181 |
| 1. PBF | A9VQF0 | Holo-[acyl-carrier-protein] synthase | 8.88e-16 | 1.07e-38 | 8.49e-09 | 0.8934 |
| 1. PBF | A2RCT2 | Holo-[acyl-carrier-protein] synthase | 1.05e-14 | 4.05e-40 | 1.31e-07 | 0.9008 |
| 1. PBF | A4XIB7 | Holo-[acyl-carrier-protein] synthase | 2.74e-11 | 1.32e-29 | 4.59e-09 | 0.843 |
| 1. PBF | Q8Y0H7 | Holo-[acyl-carrier-protein] synthase | 2.47e-13 | 1.29e-30 | 8.34e-05 | 0.8585 |
| 1. PBF | B7HRY9 | Holo-[acyl-carrier-protein] synthase | 7.77e-16 | 5.26e-39 | 1.04e-08 | 0.8929 |
| 1. PBF | B5E746 | Holo-[acyl-carrier-protein] synthase | 4.44e-15 | 2.05e-39 | 2.33e-08 | 0.9107 |
| 1. PBF | Q820E7 | Holo-[acyl-carrier-protein] synthase | 2.27e-11 | 7.71e-35 | 0.005 | 0.8089 |
| 1. PBF | B2TQY6 | Holo-[acyl-carrier-protein] synthase | 3.76e-11 | 9.07e-34 | 1.24e-05 | 0.8008 |
| 1. PBF | C1CM35 | Holo-[acyl-carrier-protein] synthase | 5.00e-15 | 2.05e-39 | 2.33e-08 | 0.9103 |
| 1. PBF | Q034T8 | Holo-[acyl-carrier-protein] synthase | 2.03e-14 | 3.11e-27 | 3.15e-07 | 0.8668 |
| 1. PBF | Q8KB56 | Holo-[acyl-carrier-protein] synthase | 7.82e-12 | 9.76e-41 | 7.51e-07 | 0.8319 |
| 1. PBF | A7Z1L9 | Holo-[acyl-carrier-protein] synthase | 1.89e-15 | 4.83e-41 | 7.05e-12 | 0.8608 |
| 1. PBF | Q72U18 | Holo-[acyl-carrier-protein] synthase | 2.77e-10 | 4.22e-29 | 3.76e-05 | 0.7954 |
| 1. PBF | B7UH03 | Holo-[acyl-carrier-protein] synthase | 1.82e-13 | 1.92e-31 | 0.011 | 0.8491 |
| 1. PBF | Q5HED0 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 8.72e-43 | 2.73e-11 | 0.8618 |
| 1. PBF | Q49Z25 | Holo-[acyl-carrier-protein] synthase | 1.78e-15 | 5.37e-41 | 3.47e-13 | 0.8923 |
| 1. PBF | Q1GBP7 | Holo-[acyl-carrier-protein] synthase | 8.27e-14 | 1.95e-14 | 3.36e-07 | 0.8777 |
| 1. PBF | Q9FCV3 | Holo-[acyl-carrier-protein] synthase | 1.73e-14 | 7.95e-42 | 1.16e-10 | 0.8914 |
| 1. PBF | B7JLE6 | Holo-[acyl-carrier-protein] synthase | 6.66e-16 | 2.27e-37 | 4.29e-09 | 0.9174 |
| 1. PBF | C0ZK19 | Holo-[acyl-carrier-protein] synthase | 5.30e-14 | 3.35e-33 | 3.05e-08 | 0.8366 |
| 1. PBF | A4QGP6 | Holo-[acyl-carrier-protein] synthase | 2.46e-09 | 2.63e-20 | 1.61e-04 | 0.7642 |
| 1. PBF | Q1JA49 | Holo-[acyl-carrier-protein] synthase | 8.10e-15 | 3.78e-37 | 4.30e-08 | 0.907 |
| 1. PBF | Q48RM7 | Holo-[acyl-carrier-protein] synthase | 1.04e-14 | 2.01e-40 | 4.39e-08 | 0.9008 |
| 1. PBF | B7MIP8 | Holo-[acyl-carrier-protein] synthase | 1.65e-13 | 1.92e-31 | 0.011 | 0.8331 |
| 1. PBF | Q0TUE3 | Holo-[acyl-carrier-protein] synthase | 5.81e-11 | 1.44e-24 | 1.22e-04 | 0.8014 |
| 1. PBF | A6Q7U5 | Holo-[acyl-carrier-protein] synthase | 1.99e-09 | 4.63e-24 | 0.003 | 0.7675 |
| 1. PBF | A8EYA8 | Holo-[acyl-carrier-protein] synthase | 6.84e-13 | 1.14e-27 | 0.004 | 0.8403 |
| 1. PBF | Q8XNP1 | Holo-[acyl-carrier-protein] synthase | 8.78e-11 | 1.15e-24 | 4.94e-04 | 0.7987 |
| 1. PBF | Q6KHG5 | Holo-[acyl-carrier-protein] synthase | 3.03e-13 | 1.53e-39 | 1.38e-07 | 0.8376 |
| 1. PBF | A8Z4X4 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 8.72e-43 | 2.73e-11 | 0.8723 |
| 1. PBF | Q03T07 | Holo-[acyl-carrier-protein] synthase | 5.66e-15 | 3.33e-34 | 2.97e-09 | 0.9022 |
| 1. PBF | Q74LB3 | Holo-[acyl-carrier-protein] synthase | 5.25e-14 | 1.20e-31 | 4.85e-06 | 0.8809 |
| 1. PBF | Q2FF54 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 8.72e-43 | 2.73e-11 | 0.8733 |
| 1. PBF | B3QR46 | Holo-[acyl-carrier-protein] synthase | 1.67e-11 | 5.21e-40 | 4.17e-08 | 0.8123 |
| 1. PBF | C1CSW0 | Holo-[acyl-carrier-protein] synthase | 5.44e-15 | 2.05e-39 | 2.33e-08 | 0.8934 |
| 1. PBF | Q6LMS5 | Holo-[acyl-carrier-protein] synthase | 9.29e-13 | 1.10e-26 | 0.021 | 0.8592 |
| 1. PBF | C0M6I4 | Holo-[acyl-carrier-protein] synthase | 1.09e-14 | 1.28e-35 | 2.86e-09 | 0.8881 |
| 1. PBF | Q3AU14 | Holo-[acyl-carrier-protein] synthase | 2.76e-11 | 8.38e-34 | 0.009 | 0.7974 |
| 1. PBF | Q2SS83 | Holo-[acyl-carrier-protein] synthase | 0.00e+00 | 1.34e-78 | 7.46e-64 | 0.9974 |
| 1. PBF | B3QTH9 | Holo-[acyl-carrier-protein] synthase | 2.50e-13 | 8.69e-35 | 9.25e-06 | 0.8612 |
| 1. PBF | B9DVI4 | Holo-[acyl-carrier-protein] synthase | 1.49e-14 | 3.79e-38 | 1.66e-07 | 0.8984 |
| 1. PBF | Q92DD0 | Holo-[acyl-carrier-protein] synthase | 6.99e-15 | 4.02e-37 | 5.45e-07 | 0.8782 |
| 1. PBF | A8FA63 | Holo-[acyl-carrier-protein] synthase | 3.00e-15 | 1.69e-43 | 4.92e-05 | 0.8611 |
| 1. PBF | Q81IT7 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 6.05e-37 | 2.57e-04 | 0.894 |
| 1. PBF | A0L8S4 | Holo-[acyl-carrier-protein] synthase | 1.20e-12 | 4.29e-22 | 3.44e-04 | 0.8202 |
| 1. PBF | A1K608 | Holo-[acyl-carrier-protein] synthase | 2.80e-13 | 1.35e-32 | 8.10e-04 | 0.8662 |
| 1. PBF | B3CQ27 | Holo-[acyl-carrier-protein] synthase | 1.67e-14 | 2.03e-26 | 7.77e-07 | 0.8873 |
| 1. PBF | Q4L7V6 | Holo-[acyl-carrier-protein] synthase | 9.10e-15 | 2.69e-39 | 1.92e-09 | 0.8402 |
| 1. PBF | A5F5H4 | Holo-[acyl-carrier-protein] synthase | 5.68e-13 | 4.26e-31 | 1.69e-07 | 0.8654 |
| 1. PBF | Q9ZCX5 | Holo-[acyl-carrier-protein] synthase | 3.30e-13 | 9.78e-38 | 4.99e-04 | 0.8694 |
| 1. PBF | P63468 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8883 |
| 1. PBF | B9E8C4 | Holo-[acyl-carrier-protein] synthase | 0.00e+00 | 3.35e-37 | 1.10e-08 | 0.8992 |
| 1. PBF | C3LK79 | Holo-[acyl-carrier-protein] synthase | 6.66e-16 | 2.27e-37 | 4.29e-09 | 0.9171 |
| 1. PBF | P0CZ50 | Holo-[acyl-carrier-protein] synthase | 1.11e-14 | 4.05e-40 | 1.31e-07 | 0.9007 |
| 1. PBF | Q68WF9 | Holo-[acyl-carrier-protein] synthase | 3.84e-13 | 3.60e-34 | 5.25e-05 | 0.8758 |
| 1. PBF | Q3KMS0 | Holo-[acyl-carrier-protein] synthase | 5.53e-11 | 1.85e-31 | 0.032 | 0.8055 |
| 1. PBF | Q8R857 | Holo-[acyl-carrier-protein] synthase | 9.69e-11 | 2.65e-24 | 0.006 | 0.7738 |
| 1. PBF | C1EU95 | Holo-[acyl-carrier-protein] synthase | 5.55e-16 | 2.27e-37 | 4.29e-09 | 0.9183 |
| 1. PBF | P63474 | Holo-[acyl-carrier-protein] synthase | 1.10e-14 | 4.05e-40 | 1.31e-07 | 0.9007 |
| 1. PBF | C4K1J2 | Holo-[acyl-carrier-protein] synthase | 2.41e-13 | 1.56e-29 | 3.45e-04 | 0.8898 |
| 1. PBF | Q8FF19 | Holo-[acyl-carrier-protein] synthase | 2.03e-13 | 1.92e-31 | 0.011 | 0.8492 |
| 1. PBF | Q4UKX9 | Holo-[acyl-carrier-protein] synthase | 3.04e-13 | 4.60e-27 | 3.26e-05 | 0.8831 |
| 1. PBF | A9NHV3 | Holo-[acyl-carrier-protein] synthase | 7.55e-15 | 2.95e-36 | 6.49e-05 | 0.8696 |
| 1. PBF | B0BB87 | Holo-[acyl-carrier-protein] synthase | 6.32e-11 | 2.65e-32 | 0.017 | 0.804 |
| 1. PBF | B0SE17 | Holo-[acyl-carrier-protein] synthase | 6.48e-09 | 9.21e-25 | 1.46e-07 | 0.7845 |
| 1. PBF | B0K5Y6 | Holo-[acyl-carrier-protein] synthase | 1.36e-09 | 1.69e-16 | 2.15e-07 | 0.7949 |
| 1. PBF | B5Y8E2 | Holo-[acyl-carrier-protein] synthase | 5.43e-09 | 6.41e-42 | 4.00e-05 | 0.7617 |
| 1. PBF | Q03IX7 | Holo-[acyl-carrier-protein] synthase | 4.77e-15 | 5.48e-39 | 1.47e-09 | 0.9075 |
| 1. PBF | A8GP44 | Holo-[acyl-carrier-protein] synthase | 3.51e-13 | 8.92e-36 | 1.06e-05 | 0.8389 |
| 1. PBF | Q8XA39 | Holo-[acyl-carrier-protein] synthase | 2.03e-13 | 1.82e-31 | 0.011 | 0.853 |
| 1. PBF | A7X4P8 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.882 |
| 1. PBF | Q7MHP2 | Holo-[acyl-carrier-protein] synthase | 3.48e-13 | 5.24e-31 | 2.23e-05 | 0.8627 |
| 1. PBF | B5FAG6 | Holo-[acyl-carrier-protein] synthase | 3.76e-13 | 1.94e-33 | 3.36e-06 | 0.8655 |
| 1. PBF | B2GA64 | Holo-[acyl-carrier-protein] synthase | 4.55e-14 | 9.98e-35 | 7.08e-07 | 0.8874 |
| 1. PBF | A4VXE0 | Holo-[acyl-carrier-protein] synthase | 1.63e-14 | 1.65e-41 | 1.15e-09 | 0.9025 |
| 1. PBF | C1C8T7 | Holo-[acyl-carrier-protein] synthase | 4.55e-15 | 2.05e-39 | 2.33e-08 | 0.8934 |
| 1. PBF | Q8F136 | Holo-[acyl-carrier-protein] synthase | 1.77e-09 | 4.22e-29 | 3.76e-05 | 0.7579 |
| 1. PBF | Q2RGI1 | Holo-[acyl-carrier-protein] synthase | 2.94e-09 | 5.32e-23 | 3.60e-05 | 0.7847 |
| 1. PBF | Q7NB74 | Holo-[acyl-carrier-protein] synthase | 9.99e-16 | 1.63e-39 | 1.37e-07 | 0.8502 |
| 1. PBF | Q0TES5 | Holo-[acyl-carrier-protein] synthase | 1.92e-13 | 1.92e-31 | 0.011 | 0.849 |
| 1. PBF | C5D4D1 | Holo-[acyl-carrier-protein] synthase | 7.77e-16 | 1.10e-41 | 3.72e-13 | 0.8734 |
| 1. PBF | B5XI22 | Holo-[acyl-carrier-protein] synthase | 1.09e-14 | 4.05e-40 | 1.31e-07 | 0.9008 |
| 1. PBF | Q03DZ1 | Holo-[acyl-carrier-protein] synthase | 2.88e-14 | 2.59e-41 | 2.41e-09 | 0.8927 |
| 1. PBF | Q5XAA3 | Holo-[acyl-carrier-protein] synthase | 1.09e-14 | 4.05e-40 | 1.31e-07 | 0.9004 |
| 1. PBF | C1CFR8 | Holo-[acyl-carrier-protein] synthase | 5.33e-15 | 2.05e-39 | 2.33e-08 | 0.9047 |
| 1. PBF | P63470 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8817 |
| 1. PBF | A5FS12 | Holo-[acyl-carrier-protein] synthase | 1.63e-09 | 1.49e-25 | 1.85e-05 | 0.7719 |
| 1. PBF | P0A2W7 | Holo-[acyl-carrier-protein] synthase | 4.88e-15 | 2.05e-39 | 2.33e-08 | 0.9047 |
| 1. PBF | B9DMJ0 | Holo-[acyl-carrier-protein] synthase | 3.00e-15 | 1.47e-42 | 1.01e-09 | 0.8434 |
| 1. PBF | Q3Z9B0 | Holo-[acyl-carrier-protein] synthase | 1.77e-09 | 3.09e-31 | 2.97e-04 | 0.7913 |
| 1. PBF | Q6MT35 | Holo-[acyl-carrier-protein] synthase | 0.00e+00 | 3.75e-112 | 1.88e-72 | 0.9989 |
| 1. PBF | P96618 | Holo-[acyl-carrier-protein] synthase | 9.55e-15 | 5.80e-40 | 6.00e-12 | 0.8546 |
| 1. PBF | Q38V63 | Holo-[acyl-carrier-protein] synthase | 9.21e-15 | 6.71e-45 | 1.92e-10 | 0.8733 |
| 1. PBF | Q4FLS7 | Holo-[acyl-carrier-protein] synthase | 5.60e-13 | 6.56e-27 | 3.80e-05 | 0.884 |
| 1. PBF | Q254H8 | Holo-[acyl-carrier-protein] synthase | 3.34e-11 | 6.25e-34 | 0.003 | 0.8023 |
| 1. PBF | Q5GTK4 | Holo-[acyl-carrier-protein] synthase | 5.36e-13 | 5.33e-40 | 0.010 | 0.8439 |
| 1. PBF | B8DG74 | Holo-[acyl-carrier-protein] synthase | 8.99e-15 | 3.02e-38 | 2.75e-08 | 0.8506 |
| 1. PBF | A8A373 | Holo-[acyl-carrier-protein] synthase | 2.11e-13 | 1.82e-31 | 0.011 | 0.8529 |
| 1. PBF | Q5FMB3 | Holo-[acyl-carrier-protein] synthase | 8.44e-14 | 1.38e-32 | 6.95e-07 | 0.8112 |
| 1. PBF | A5US51 | Holo-[acyl-carrier-protein] synthase | 7.84e-09 | 7.50e-18 | 6.24e-06 | 0.7385 |
| 1. PBF | A8F257 | Holo-[acyl-carrier-protein] synthase | 2.31e-13 | 1.37e-27 | 2.72e-04 | 0.883 |
| 1. PBF | B4SFE8 | Holo-[acyl-carrier-protein] synthase | 9.76e-11 | 5.69e-32 | 4.58e-04 | 0.7912 |
| 1. PBF | B0BYC4 | Holo-[acyl-carrier-protein] synthase | 2.57e-13 | 1.56e-29 | 3.45e-04 | 0.8893 |
| 1. PBF | B1I1U5 | Holo-[acyl-carrier-protein] synthase | 7.20e-11 | 5.45e-29 | 2.29e-07 | 0.8415 |
| 1. PBF | A3CLD6 | Holo-[acyl-carrier-protein] synthase | 1.04e-14 | 8.38e-37 | 3.04e-09 | 0.8847 |
| 1. PBF | B8ZMG2 | Holo-[acyl-carrier-protein] synthase | 4.88e-15 | 2.05e-39 | 2.33e-08 | 0.9105 |
| 1. PBF | Q98R97 | Holo-[acyl-carrier-protein] synthase | 1.20e-13 | 5.49e-45 | 6.97e-08 | 0.8336 |
| 1. PBF | Q73ET8 | Holo-[acyl-carrier-protein] synthase | 6.66e-16 | 5.26e-39 | 1.04e-08 | 0.8952 |
| 1. PBF | Q97LR5 | Holo-[acyl-carrier-protein] synthase | 3.76e-13 | 8.08e-31 | 1.78e-06 | 0.8301 |
| 1. PBF | Q5E318 | Holo-[acyl-carrier-protein] synthase | 4.06e-13 | 8.83e-33 | 1.27e-05 | 0.8614 |
| 1. PBF | Q820V0 | Holo-[acyl-carrier-protein] synthase | 1.55e-15 | 1.76e-41 | 2.08e-12 | 0.8844 |
| 1. PBF | Q8DSF3 | Holo-[acyl-carrier-protein] synthase | 2.00e-15 | 5.39e-42 | 1.06e-09 | 0.904 |
| 1. PBF | Q6YQD4 | Holo-[acyl-carrier-protein] synthase | 3.36e-13 | 1.50e-27 | 2.25e-07 | 0.8688 |
| 1. PBF | A8YXI2 | Holo-[acyl-carrier-protein] synthase | 7.58e-14 | 3.74e-32 | 8.00e-06 | 0.8665 |
| 1. PBF | A6M302 | Holo-[acyl-carrier-protein] synthase | 1.02e-11 | 4.98e-35 | 2.06e-04 | 0.8415 |
| 1. PBF | Q99Y97 | Holo-[acyl-carrier-protein] synthase | 1.13e-14 | 1.14e-39 | 2.51e-07 | 0.9003 |
| 1. PBF | A4W3N6 | Holo-[acyl-carrier-protein] synthase | 1.51e-14 | 1.65e-41 | 1.15e-09 | 0.9032 |
| 1. PBF | C3LR00 | Holo-[acyl-carrier-protein] synthase | 1.88e-12 | 1.69e-31 | 1.90e-07 | 0.8631 |
| 1. PBF | Q47EF3 | Holo-[acyl-carrier-protein] synthase | 1.37e-13 | 1.85e-31 | 1.25e-04 | 0.8268 |
| 1. PBF | A4IJT3 | Holo-[acyl-carrier-protein] synthase | 2.81e-14 | 1.03e-28 | 6.94e-13 | 0.8705 |
| 1. PBF | A6U3F7 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8289 |
| 1. PBF | A5N379 | Holo-[acyl-carrier-protein] synthase | 5.41e-11 | 1.82e-24 | 7.68e-10 | 0.8133 |
| 1. PBF | B7H4P0 | Holo-[acyl-carrier-protein] synthase | 9.99e-16 | 1.42e-36 | 5.02e-05 | 0.8951 |
| 1. PBF | Q5L623 | Holo-[acyl-carrier-protein] synthase | 2.98e-12 | 7.17e-34 | 6.65e-04 | 0.8251 |
| 1. PBF | B1I756 | Holo-[acyl-carrier-protein] synthase | 4.00e-15 | 2.05e-39 | 2.33e-08 | 0.9048 |
| 1. PBF | B9J0N5 | Holo-[acyl-carrier-protein] synthase | 7.77e-16 | 5.26e-39 | 1.04e-08 | 0.8926 |
| 1. PBF | Q04C46 | Holo-[acyl-carrier-protein] synthase | 5.74e-14 | 3.47e-16 | 3.06e-07 | 0.8746 |
| 1. PBF | Q87LP3 | Holo-[acyl-carrier-protein] synthase | 3.70e-13 | 1.19e-33 | 6.62e-05 | 0.8623 |
| 1. PBF | B8G840 | Holo-[acyl-carrier-protein] synthase | 2.48e-08 | 6.02e-21 | 5.16e-04 | 0.7785 |
| 1. PBF | Q8RDZ7 | Holo-[acyl-carrier-protein] synthase | 7.26e-12 | 6.70e-31 | 1.91e-04 | 0.8178 |
| 1. PBF | A8GSU8 | Holo-[acyl-carrier-protein] synthase | 2.45e-13 | 5.65e-29 | 3.91e-04 | 0.8888 |
| 1. PBF | A0AH03 | Holo-[acyl-carrier-protein] synthase | 9.44e-15 | 8.86e-39 | 2.47e-08 | 0.8513 |
| 1. PBF | Q8DC72 | Holo-[acyl-carrier-protein] synthase | 3.99e-13 | 5.87e-31 | 1.66e-05 | 0.8627 |
| 1. PBF | A5VI50 | Holo-[acyl-carrier-protein] synthase | 3.31e-14 | 4.02e-37 | 3.36e-10 | 0.8815 |
| 1. PBF | A6QIR6 | Holo-[acyl-carrier-protein] synthase | 1.22e-15 | 8.72e-43 | 2.73e-11 | 0.8723 |
| 1. PBF | A1VCV8 | Holo-[acyl-carrier-protein] synthase | 4.77e-12 | 2.31e-30 | 1.12e-04 | 0.7955 |
| 1. PBF | C4L132 | Holo-[acyl-carrier-protein] synthase | 2.66e-15 | 9.09e-37 | 1.05e-07 | 0.8918 |
| 1. PBF | Q1LTI6 | Holo-[acyl-carrier-protein] synthase | 1.62e-10 | 8.06e-15 | 0.012 | 0.8394 |
| 1. PBF | P63469 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8909 |
| 1. PBF | P0A2W6 | Holo-[acyl-carrier-protein] synthase | 4.00e-15 | 2.05e-39 | 2.33e-08 | 0.9051 |
| 1. PBF | Q9KPB6 | Holo-[acyl-carrier-protein] synthase | 4.60e-13 | 1.69e-31 | 1.90e-07 | 0.8642 |
| 1. PBF | B0KD52 | Holo-[acyl-carrier-protein] synthase | 1.38e-09 | 1.69e-16 | 2.15e-07 | 0.7947 |
| 1. PBF | Q1R8H0 | Holo-[acyl-carrier-protein] synthase | 1.85e-13 | 1.92e-31 | 0.011 | 0.8334 |
| 1. PBF | Q5WJW1 | Holo-[acyl-carrier-protein] synthase | 1.44e-15 | 2.60e-44 | 0.001 | 0.8691 |
| 1. PBF | B3EGP9 | Holo-[acyl-carrier-protein] synthase | 2.60e-10 | 5.99e-28 | 4.52e-06 | 0.7894 |
| 1. PBF | Q2YUI2 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8817 |
| 1. PBF | A5IUL7 | Holo-[acyl-carrier-protein] synthase | 9.99e-16 | 4.43e-41 | 5.74e-12 | 0.8295 |
| 1. PBF | Q63GX2 | Holo-[acyl-carrier-protein] synthase | 5.55e-16 | 5.49e-38 | 2.21e-09 | 0.9175 |
| 1. PBF | Q8FMW0 | Holo-[acyl-carrier-protein] synthase | 6.89e-09 | 1.65e-21 | 4.20e-06 | 0.7927 |
| 1. PBF | B7IU30 | Holo-[acyl-carrier-protein] synthase | 9.99e-16 | 6.56e-37 | 8.75e-05 | 0.895 |
| 1. PBF | B7VK75 | Holo-[acyl-carrier-protein] synthase | 1.27e-12 | 3.62e-33 | 1.03e-05 | 0.8638 |
| 1. PBF | A7GKE4 | Holo-[acyl-carrier-protein] synthase | 1.44e-15 | 4.24e-43 | 5.48e-08 | 0.9081 |
| 1. PBF | Q9CH95 | Holo-[acyl-carrier-protein] synthase | 2.22e-15 | 9.58e-45 | 1.83e-08 | 0.8848 |
| 1. PBF | Q73GW5 | Holo-[acyl-carrier-protein] synthase | 3.11e-14 | 3.12e-39 | 0.002 | 0.8892 |
| 1. PBF | B7LV01 | Holo-[acyl-carrier-protein] synthase | 1.91e-13 | 3.20e-32 | 0.011 | 0.8489 |
| 1. PBF | A0R8U9 | Holo-[acyl-carrier-protein] synthase | 6.66e-16 | 2.27e-37 | 4.29e-09 | 0.918 |
| 1. PBF | Q15PH8 | Holo-[acyl-carrier-protein] synthase | 5.31e-13 | 2.91e-35 | 0.004 | 0.8567 |
| 1. PBF | Q8Y8L2 | Holo-[acyl-carrier-protein] synthase | 8.55e-15 | 3.76e-39 | 7.40e-09 | 0.8507 |
| 1. PBF | C3PAT6 | Holo-[acyl-carrier-protein] synthase | 6.66e-16 | 2.27e-37 | 4.29e-09 | 0.9181 |
| 1. PBF | Q1RHU1 | Holo-[acyl-carrier-protein] synthase | 1.78e-13 | 3.59e-31 | 9.78e-06 | 0.8427 |
| 1. PBF | Q9PKT6 | Holo-[acyl-carrier-protein] synthase | 7.67e-11 | 5.54e-30 | 3.27e-05 | 0.8025 |
| 1. PBF | Q8K9R3 | Holo-[acyl-carrier-protein] synthase | 6.06e-13 | 2.53e-34 | 3.96e-05 | 0.8616 |
| 1. PBF | B4U7U7 | Holo-[acyl-carrier-protein] synthase | 1.20e-09 | 1.30e-24 | 0.002 | 0.7658 |
| 1. PBF | A8MJ27 | Holo-[acyl-carrier-protein] synthase | 1.42e-10 | 9.35e-33 | 0.007 | 0.7871 |
| 1. PBF | Q6G7N8 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 4.43e-41 | 5.74e-12 | 0.8849 |
| 1. PBF | Q1WV15 | Holo-[acyl-carrier-protein] synthase | 4.39e-14 | 1.66e-22 | 3.97e-07 | 0.8563 |
| 1. PBF | Q3JZK4 | Holo-[acyl-carrier-protein] synthase | 9.77e-15 | 4.11e-38 | 8.39e-07 | 0.9021 |
| 1. PBF | B6EKM5 | Holo-[acyl-carrier-protein] synthase | 3.95e-13 | 1.72e-31 | 1.26e-06 | 0.8598 |
| 1. PBF | Q1JK99 | Holo-[acyl-carrier-protein] synthase | 8.99e-15 | 3.78e-37 | 4.30e-08 | 0.907 |
| 1. PBF | Q721T0 | Holo-[acyl-carrier-protein] synthase | 8.33e-15 | 3.76e-39 | 7.40e-09 | 0.8513 |
| 2. PF | B8CQJ1 | Holo-[acyl-carrier-protein] synthase | 3.44e-12 | 1.95e-30 | NA | 0.8449 |
| 2. PF | P63467 | Holo-[acyl-carrier-protein] synthase | 1.78e-13 | 1.16e-32 | NA | 0.8305 |
| 2. PF | A3NXL2 | Holo-[acyl-carrier-protein] synthase | 1.99e-12 | 6.71e-23 | NA | 0.8522 |
| 2. PF | B5QTU4 | Holo-[acyl-carrier-protein] synthase | 1.97e-13 | 1.16e-32 | NA | 0.836 |
| 2. PF | Q7NWB8 | Holo-[acyl-carrier-protein] synthase | 1.62e-13 | 2.63e-25 | NA | 0.8208 |
| 2. PF | P57344 | Holo-[acyl-carrier-protein] synthase | 3.45e-12 | 1.39e-37 | NA | 0.8526 |
| 2. PF | Q1IHY2 | Holo-[acyl-carrier-protein] synthase | 3.30e-11 | 4.77e-30 | NA | 0.7879 |
| 2. PF | C6BV78 | Holo-[acyl-carrier-protein] synthase | 3.33e-12 | 6.63e-32 | NA | 0.8381 |
| 2. PF | Q0BTG4 | Holo-[acyl-carrier-protein] synthase | 7.46e-12 | 6.21e-14 | NA | 0.8275 |
| 2. PF | Q6FJZ5 | Mitochondrial holo-[acyl-carrier-protein] synthase | 2.94e-10 | 5.71e-26 | NA | 0.73 |
| 2. PF | Q5Z0D8 | Holo-[acyl-carrier-protein] synthase | 2.54e-10 | 1.25e-14 | NA | 0.8111 |
| 2. PF | Q8ZCP5 | Holo-[acyl-carrier-protein] synthase | 6.73e-13 | 5.34e-34 | NA | 0.8277 |
| 2. PF | B2II98 | Holo-[acyl-carrier-protein] synthase | 5.97e-11 | 8.76e-15 | NA | 0.8111 |
| 2. PF | Q7UQA5 | Holo-[acyl-carrier-protein] synthase | 3.42e-10 | 4.40e-33 | NA | 0.8122 |
| 2. PF | O51043 | Holo-[acyl-carrier-protein] synthase | 1.97e-11 | 2.43e-29 | NA | 0.7552 |
| 2. PF | B6I5D7 | Holo-[acyl-carrier-protein] synthase | 1.64e-13 | 8.66e-32 | NA | 0.8489 |
| 2. PF | Q01RT7 | Holo-[acyl-carrier-protein] synthase | 3.65e-11 | 1.41e-25 | NA | 0.8354 |
| 2. PF | A9MGY0 | Holo-[acyl-carrier-protein] synthase | 1.08e-12 | 2.47e-28 | NA | 0.8097 |
| 2. PF | A9W511 | Holo-[acyl-carrier-protein] synthase | 9.86e-12 | 9.13e-15 | NA | 0.8259 |
| 2. PF | Q8D303 | Holo-[acyl-carrier-protein] synthase | 1.69e-12 | 1.62e-29 | NA | 0.8612 |
| 2. PF | A4G6R4 | Holo-[acyl-carrier-protein] synthase | 1.96e-13 | 1.63e-28 | NA | 0.8387 |
| 2. PF | Q8XAN7 | Probable holo-[acyl-carrier-protein] synthase 2 | 2.13e-09 | 9.17e-33 | NA | 0.7265 |
| 2. PF | B2JFK6 | Holo-[acyl-carrier-protein] synthase | 6.75e-13 | 1.80e-25 | NA | 0.8484 |
| 2. PF | Q2IHZ3 | Holo-[acyl-carrier-protein] synthase | 4.41e-10 | 4.59e-31 | NA | 0.8252 |
| 2. PF | Q0HGA2 | Holo-[acyl-carrier-protein] synthase | 1.63e-12 | 9.72e-33 | NA | 0.8566 |
| 2. PF | A1VRS8 | Holo-[acyl-carrier-protein] synthase | 4.49e-14 | 2.44e-30 | NA | 0.8447 |
| 2. PF | A1RMC3 | Holo-[acyl-carrier-protein] synthase | 1.63e-12 | 2.06e-30 | NA | 0.8545 |
| 2. PF | B7NRL6 | Holo-[acyl-carrier-protein] synthase | 1.63e-13 | 8.66e-32 | NA | 0.8493 |
| 2. PF | C4ZYI6 | Holo-[acyl-carrier-protein] synthase | 3.28e-13 | 9.39e-31 | NA | 0.8658 |
| 2. PF | Q2IWU7 | Holo-[acyl-carrier-protein] synthase | 1.33e-11 | 8.92e-17 | NA | 0.8267 |
| 2. PF | Q9RXR0 | Holo-[acyl-carrier-protein] synthase | 2.02e-11 | 2.98e-20 | NA | 0.7493 |
| 2. PF | Q72IV9 | Holo-[acyl-carrier-protein] synthase | 5.99e-13 | 2.92e-25 | NA | 0.844 |
| 2. PF | B9JC71 | Holo-[acyl-carrier-protein] synthase | 1.95e-11 | 1.53e-17 | NA | 0.8085 |
| 2. PF | A1QYG3 | Holo-[acyl-carrier-protein] synthase | 2.62e-11 | 5.37e-32 | NA | 0.8342 |
| 2. PF | Q3JCY7 | Holo-[acyl-carrier-protein] synthase | 1.84e-11 | 2.08e-05 | NA | 0.8758 |
| 2. PF | A3MM38 | Holo-[acyl-carrier-protein] synthase | 2.13e-12 | 6.13e-22 | NA | 0.8519 |
| 2. PF | B9KEZ8 | Holo-[acyl-carrier-protein] synthase | 1.20e-09 | 3.92e-27 | NA | 0.6969 |
| 2. PF | B1LP76 | Holo-[acyl-carrier-protein] synthase | 1.76e-13 | 2.27e-32 | NA | 0.8487 |
| 2. PF | B1JYB7 | Holo-[acyl-carrier-protein] synthase | 3.28e-12 | 2.13e-16 | NA | 0.8578 |
| 2. PF | Q5FHL6 | Holo-[acyl-carrier-protein] synthase | 4.03e-13 | 1.77e-40 | NA | 0.8397 |
| 2. PF | Q1CKE0 | Holo-[acyl-carrier-protein] synthase | 6.61e-13 | 5.34e-34 | NA | 0.8323 |
| 2. PF | Q30ZQ5 | Holo-[acyl-carrier-protein] synthase | 7.17e-12 | 1.00e-24 | NA | 0.8305 |
| 2. PF | B0RD39 | Holo-[acyl-carrier-protein] synthase | 2.68e-09 | 2.03e-25 | NA | 0.7855 |
| 2. PF | Q5SII1 | Holo-[acyl-carrier-protein] synthase | 5.73e-13 | 2.92e-25 | NA | 0.8441 |
| 2. PF | P63466 | Holo-[acyl-carrier-protein] synthase | 1.82e-13 | 1.16e-32 | NA | 0.8364 |
| 2. PF | B9MDP1 | Holo-[acyl-carrier-protein] synthase | 5.25e-14 | 3.85e-29 | NA | 0.8766 |
| 2. PF | A1AR95 | Holo-[acyl-carrier-protein] synthase | 2.11e-11 | 1.04e-26 | NA | 0.8414 |
| 2. PF | B9M2U0 | Holo-[acyl-carrier-protein] synthase | 4.76e-12 | 2.22e-29 | NA | 0.8064 |
| 2. PF | B1XZM3 | Holo-[acyl-carrier-protein] synthase | 5.68e-14 | 3.82e-28 | NA | 0.8218 |
| 2. PF | B7M8H6 | Holo-[acyl-carrier-protein] synthase | 1.82e-13 | 8.66e-32 | NA | 0.849 |
| 2. PF | A3D1W0 | Holo-[acyl-carrier-protein] synthase | 1.44e-12 | 5.44e-31 | NA | 0.861 |
| 2. PF | Q0A8Y7 | Holo-[acyl-carrier-protein] synthase | 2.87e-12 | 5.34e-33 | NA | 0.8437 |
| 2. PF | A7HCT8 | Holo-[acyl-carrier-protein] synthase | 1.02e-10 | 1.06e-29 | NA | 0.8382 |
| 2. PF | A6SXR7 | Holo-[acyl-carrier-protein] synthase | 2.12e-13 | 5.88e-28 | NA | 0.8386 |
| 2. PF | B8I3U1 | Holo-[acyl-carrier-protein] synthase | 1.34e-10 | 4.77e-27 | NA | 0.8 |
| 2. PF | Q1C5D9 | Holo-[acyl-carrier-protein] synthase | 6.24e-13 | 5.34e-34 | NA | 0.842 |
| 2. PF | B1IVR4 | Holo-[acyl-carrier-protein] synthase | 1.79e-13 | 2.76e-31 | NA | 0.849 |
| 2. PF | A6TCH7 | Holo-[acyl-carrier-protein] synthase | 3.46e-13 | 5.37e-32 | NA | 0.8628 |
| 2. PF | B7N6F1 | Holo-[acyl-carrier-protein] synthase | 1.94e-13 | 2.27e-32 | NA | 0.8491 |
| 2. PF | A2S9Z9 | Holo-[acyl-carrier-protein] synthase | 2.06e-12 | 6.13e-22 | NA | 0.8592 |
| 2. PF | C5BZZ8 | Holo-[acyl-carrier-protein] synthase | 4.78e-09 | 3.06e-27 | NA | 0.6163 |
| 2. PF | Q0T1U2 | Holo-[acyl-carrier-protein] synthase | 1.74e-13 | 8.66e-32 | NA | 0.8483 |
| 2. PF | B7J9K5 | Holo-[acyl-carrier-protein] synthase | 2.27e-12 | 1.71e-29 | NA | 0.8303 |
| 2. PF | A9WMF1 | Holo-[acyl-carrier-protein] synthase | 9.92e-09 | 1.32e-30 | NA | 0.7583 |
| 2. PF | Q2Y864 | Holo-[acyl-carrier-protein] synthase | 7.03e-13 | 2.20e-34 | NA | 0.8633 |
| 2. PF | Q1GDH3 | Holo-[acyl-carrier-protein] synthase | 3.42e-10 | 2.00e-13 | NA | 0.7851 |
| 2. PF | A1R8P6 | Holo-[acyl-carrier-protein] synthase | 1.21e-08 | 2.90e-27 | NA | 0.7621 |
| 2. PF | A3Q2R0 | Holo-[acyl-carrier-protein] synthase | 2.45e-09 | 4.94e-27 | NA | 0.7401 |
| 2. PF | Q0HSJ5 | Holo-[acyl-carrier-protein] synthase | 1.67e-12 | 6.86e-33 | NA | 0.8567 |
| 2. PF | Q63S99 | Holo-[acyl-carrier-protein] synthase | 2.07e-12 | 6.13e-22 | NA | 0.8594 |
| 2. PF | B4TS10 | Holo-[acyl-carrier-protein] synthase | 2.08e-13 | 1.16e-32 | NA | 0.8311 |
| 2. PF | A8GI21 | Holo-[acyl-carrier-protein] synthase | 1.60e-13 | 3.78e-29 | NA | 0.852 |
| 2. PF | A1SF35 | Holo-[acyl-carrier-protein] synthase | 4.97e-09 | 1.65e-24 | NA | 0.7675 |
| 2. PF | Q03V72 | Holo-[acyl-carrier-protein] synthase | 3.81e-14 | 5.51e-17 | NA | 0.8605 |
| 2. PF | B6JGF9 | Holo-[acyl-carrier-protein] synthase | 1.20e-11 | 4.74e-23 | NA | 0.7753 |
| 2. PF | C1D7L8 | Holo-[acyl-carrier-protein] synthase | 2.20e-13 | 1.26e-28 | NA | 0.8573 |
| 2. PF | A4JCR5 | Holo-[acyl-carrier-protein] synthase | 3.58e-12 | 5.68e-17 | NA | 0.85 |
| 2. PF | B2KA43 | Holo-[acyl-carrier-protein] synthase | 7.47e-13 | 8.86e-35 | NA | 0.8271 |
| 2. PF | Q62LS6 | Holo-[acyl-carrier-protein] synthase | 2.14e-12 | 6.13e-22 | NA | 0.8604 |
| 2. PF | Q6D222 | Holo-[acyl-carrier-protein] synthase | 3.32e-13 | 5.23e-33 | NA | 0.8299 |
| 2. PF | Q5PIJ4 | Holo-[acyl-carrier-protein] synthase | 2.10e-13 | 1.16e-32 | NA | 0.8359 |
| 2. PF | B0TIW1 | Holo-[acyl-carrier-protein] synthase | 3.59e-12 | 8.65e-30 | NA | 0.8226 |
| 2. PF | A2SDH7 | Holo-[acyl-carrier-protein] synthase | 2.10e-13 | 1.57e-28 | NA | 0.8504 |
| 2. PF | B4RCU9 | Holo-[acyl-carrier-protein] synthase | 4.42e-11 | 5.73e-16 | NA | 0.8075 |
| 2. PF | B2S466 | Holo-[acyl-carrier-protein] synthase | 4.82e-11 | 8.82e-26 | NA | 0.8666 |
| 2. PF | B4TE11 | Holo-[acyl-carrier-protein] synthase | 1.92e-13 | 1.16e-32 | NA | 0.8308 |
| 2. PF | B2HPL7 | Holo-[acyl-carrier-protein] synthase | 1.54e-09 | 3.11e-30 | NA | 0.7593 |
| 2. PF | Q7WH64 | Holo-[acyl-carrier-protein] synthase | 5.51e-12 | 5.35e-17 | NA | 0.8389 |
| 2. PF | A8FSE0 | Holo-[acyl-carrier-protein] synthase | 4.26e-12 | 2.37e-31 | NA | 0.8487 |
| 2. PF | Q0RRN3 | Holo-[acyl-carrier-protein] synthase | 8.84e-10 | 2.32e-23 | NA | 0.777 |
| 2. PF | A4Y4K8 | Holo-[acyl-carrier-protein] synthase | 1.77e-12 | 3.55e-33 | NA | 0.8548 |
| 2. PF | C4K8H4 | Holo-[acyl-carrier-protein] synthase | 1.36e-12 | 1.05e-32 | NA | 0.8519 |
| 2. PF | Q2LTJ7 | Holo-[acyl-carrier-protein] synthase | 4.63e-10 | 9.84e-30 | NA | 0.8346 |
| 2. PF | Q12KI5 | Holo-[acyl-carrier-protein] synthase | 1.58e-12 | 1.70e-35 | NA | 0.8518 |
| 2. PF | B8D7F3 | Holo-[acyl-carrier-protein] synthase | 2.72e-12 | 1.39e-37 | NA | 0.8591 |
| 2. PF | C3M8S2 | Holo-[acyl-carrier-protein] synthase | 3.22e-11 | 2.22e-10 | NA | 0.8069 |
| 2. PF | A3NBS5 | Holo-[acyl-carrier-protein] synthase | 2.14e-12 | 2.85e-22 | NA | 0.8519 |
| 2. PF | B4RXM9 | Holo-[acyl-carrier-protein] synthase | 1.26e-12 | 7.64e-31 | NA | 0.8278 |
| 2. PF | Q2GG91 | Holo-[acyl-carrier-protein] synthase | 1.66e-13 | 5.08e-36 | NA | 0.865 |
| 2. PF | P0A0Q6 | Holo-[acyl-carrier-protein] synthase | 2.60e-13 | 4.18e-28 | NA | 0.8609 |
| 2. PF | A9N1T5 | Holo-[acyl-carrier-protein] synthase | 1.96e-13 | 3.22e-33 | NA | 0.8311 |
| 2. PF | Q5PAZ6 | Holo-[acyl-carrier-protein] synthase | 6.51e-14 | 1.15e-24 | NA | 0.8417 |
| 2. PF | Q46Z22 | Holo-[acyl-carrier-protein] synthase | 2.25e-13 | 5.71e-26 | NA | 0.8413 |
| 2. PF | B8HCG9 | Holo-[acyl-carrier-protein] synthase | 1.20e-08 | 6.67e-28 | NA | 0.7615 |
| 2. PF | Q9RQW2 | Holo-[acyl-carrier-protein] synthase | 8.44e-13 | 7.78e-31 | NA | 0.8514 |
| 2. PF | Q8EH77 | Holo-[acyl-carrier-protein] synthase | 1.79e-12 | 1.06e-34 | NA | 0.8457 |
| 2. PF | Q2JFD8 | Holo-[acyl-carrier-protein] synthase | 3.51e-09 | 5.50e-27 | NA | 0.7524 |
| 2. PF | B8IMY6 | Holo-[acyl-carrier-protein] synthase | 1.17e-11 | 4.27e-20 | NA | 0.8259 |
| 2. PF | Q3AEB5 | Holo-[acyl-carrier-protein] synthase | 1.33e-09 | 8.19e-35 | NA | 0.8254 |
| 2. PF | Q5LNK3 | Holo-[acyl-carrier-protein] synthase | 5.09e-10 | 3.77e-11 | NA | 0.7863 |
| 2. PF | A4WDD4 | Holo-[acyl-carrier-protein] synthase | 1.89e-13 | 3.46e-32 | NA | 0.8397 |
| 2. PF | Q57LD4 | Holo-[acyl-carrier-protein] synthase | 2.11e-13 | 1.18e-32 | NA | 0.8311 |
| 2. PF | A6W5X5 | Holo-[acyl-carrier-protein] synthase | 2.31e-09 | 4.33e-28 | NA | 0.7594 |
| 2. PF | B5F1F7 | Holo-[acyl-carrier-protein] synthase | 1.74e-13 | 1.16e-32 | NA | 0.8305 |
| 2. PF | A1WT13 | Holo-[acyl-carrier-protein] synthase | 2.01e-11 | 5.57e-28 | NA | 0.8532 |
| 2. PF | A5CWJ8 | Holo-[acyl-carrier-protein] synthase | 4.85e-12 | 2.18e-29 | NA | 0.855 |
| 2. PF | B2S1J9 | Holo-[acyl-carrier-protein] synthase | 6.97e-12 | 7.31e-34 | NA | 0.8343 |
| 2. PF | C1D023 | Holo-[acyl-carrier-protein] synthase | 1.39e-11 | 3.96e-26 | NA | 0.7716 |
| 2. PF | B5BAT4 | Holo-[acyl-carrier-protein] synthase | 2.05e-13 | 1.16e-32 | NA | 0.8367 |
| 2. PF | B7LDF6 | Holo-[acyl-carrier-protein] synthase | 1.65e-13 | 8.66e-32 | NA | 0.8483 |
| 2. PF | B5RD45 | Holo-[acyl-carrier-protein] synthase | 2.05e-13 | 1.16e-32 | NA | 0.8309 |
| 2. PF | Q820I1 | Holo-[acyl-carrier-protein] synthase | 2.21e-13 | 9.81e-23 | NA | 0.8607 |
| 2. PF | Q67K77 | Holo-[acyl-carrier-protein] synthase | 1.71e-11 | 3.10e-33 | NA | 0.8461 |
| 2. PF | Q28V25 | Holo-[acyl-carrier-protein] synthase | 3.34e-10 | 9.35e-09 | NA | 0.8004 |
| 2. PF | A7ZQ07 | Holo-[acyl-carrier-protein] synthase | 1.80e-13 | 8.66e-32 | NA | 0.8488 |
| 2. PF | A4FPF7 | Holo-[acyl-carrier-protein] synthase | 1.08e-08 | 2.77e-29 | NA | 0.7683 |
| 2. PF | A9ADD4 | Holo-[acyl-carrier-protein] synthase | 2.21e-12 | 2.89e-17 | NA | 0.8293 |
| 2. PF | Q6A6U0 | Holo-[acyl-carrier-protein] synthase | 2.25e-09 | 1.59e-29 | NA | 0.7387 |
| 2. PF | A0JZ20 | Holo-[acyl-carrier-protein] synthase | 9.38e-09 | 1.42e-27 | NA | 0.7689 |
| 2. PF | B3E694 | Holo-[acyl-carrier-protein] synthase | 8.91e-12 | 2.82e-29 | NA | 0.8372 |
| 2. PF | A9R406 | Holo-[acyl-carrier-protein] synthase | 7.95e-13 | 5.34e-34 | NA | 0.8575 |
| 2. PF | Q126K7 | Holo-[acyl-carrier-protein] synthase | 3.81e-14 | 6.95e-31 | NA | 0.8597 |
| 2. PF | A9M273 | Holo-[acyl-carrier-protein] synthase | 2.68e-13 | 4.18e-28 | NA | 0.8607 |
| 2. PF | B5EQL7 | Holo-[acyl-carrier-protein] synthase | 2.40e-12 | 1.71e-29 | NA | 0.8162 |
| 2. PF | B2SZV1 | Holo-[acyl-carrier-protein] synthase | 1.44e-12 | 1.73e-26 | NA | 0.8157 |
| 2. PF | B1MX05 | Holo-[acyl-carrier-protein] synthase | 5.43e-14 | 7.50e-18 | NA | 0.8568 |
| 2. PF | O83800 | Holo-[acyl-carrier-protein] synthase | 5.35e-11 | 8.82e-26 | NA | 0.8664 |
| 2. PF | Q7VWV9 | Holo-[acyl-carrier-protein] synthase | 5.67e-12 | 1.70e-17 | NA | 0.8394 |
| 2. PF | B4RQ92 | Holo-[acyl-carrier-protein] synthase | 8.75e-13 | 1.36e-28 | NA | 0.8505 |
| 2. PF | Q0AF73 | Holo-[acyl-carrier-protein] synthase | 2.02e-13 | 7.85e-28 | NA | 0.8275 |
| 2. PF | Q04DI0 | Holo-[acyl-carrier-protein] synthase | 3.62e-11 | 2.14e-25 | NA | 0.7784 |
| 2. PF | A1KVH5 | Holo-[acyl-carrier-protein] synthase | 2.45e-13 | 4.18e-28 | NA | 0.8619 |
| 2. PF | Q1GT99 | Holo-[acyl-carrier-protein] synthase | 2.01e-12 | 5.58e-19 | NA | 0.8391 |
| 2. PF | Q11T75 | Holo-[acyl-carrier-protein] synthase | 8.70e-11 | 1.25e-21 | NA | 0.8117 |
| 2. PF | Q057R6 | Holo-[acyl-carrier-protein] synthase | 2.94e-12 | 9.09e-29 | NA | 0.8526 |
| 2. PF | C5CSF9 | Holo-[acyl-carrier-protein] synthase | 1.56e-13 | 7.67e-24 | NA | 0.8391 |
| 2. PF | B1KI61 | Holo-[acyl-carrier-protein] synthase | 6.22e-12 | 8.50e-32 | NA | 0.8129 |
| 2. PF | Q5FPZ9 | Holo-[acyl-carrier-protein] synthase | 2.00e-11 | 2.77e-05 | NA | 0.8439 |
| 2. PF | Q5R110 | Holo-[acyl-carrier-protein] synthase | 3.01e-13 | 3.40e-27 | NA | 0.8678 |
| 2. PF | O69159 | Holo-[acyl-carrier-protein] synthase | 1.18e-11 | 2.54e-21 | NA | 0.8264 |
| 2. PF | Q6AD33 | Holo-[acyl-carrier-protein] synthase | 7.43e-10 | 4.79e-24 | NA | 0.664 |
| 2. PF | A7FFU3 | Holo-[acyl-carrier-protein] synthase | 6.44e-13 | 8.86e-35 | NA | 0.8278 |
| 2. PF | A7HX46 | Holo-[acyl-carrier-protein] synthase | 2.64e-11 | 6.30e-19 | NA | 0.8113 |
| 2. PF | A3QBT1 | Holo-[acyl-carrier-protein] synthase | 4.18e-12 | 1.68e-29 | NA | 0.8246 |
| 2. PF | Q1LKN5 | Holo-[acyl-carrier-protein] synthase | 2.59e-13 | 1.16e-19 | NA | 0.8552 |
| 2. PF | B6IN03 | Holo-[acyl-carrier-protein] synthase | 2.54e-11 | 6.02e-20 | NA | 0.8202 |
| 2. PF | A9L5P0 | Holo-[acyl-carrier-protein] synthase | 1.38e-12 | 1.56e-31 | NA | 0.8607 |
| 2. PF | A9BNJ1 | Holo-[acyl-carrier-protein] synthase | 4.93e-14 | 1.12e-27 | NA | 0.8477 |
| 2. PF | Q3SKU1 | Holo-[acyl-carrier-protein] synthase | 8.26e-13 | 5.23e-20 | NA | 0.8335 |
| 2. PF | Q11JT0 | Holo-[acyl-carrier-protein] synthase | 1.54e-11 | 4.27e-20 | NA | 0.8202 |
| 2. PF | B3QJH2 | Holo-[acyl-carrier-protein] synthase | 2.04e-11 | 4.82e-16 | NA | 0.8248 |
| 2. PF | B1JRD1 | Holo-[acyl-carrier-protein] synthase | 7.60e-13 | 8.86e-35 | NA | 0.8273 |
| 2. PF | B4T1F4 | Holo-[acyl-carrier-protein] synthase | 1.96e-13 | 6.23e-33 | NA | 0.8306 |
| 2. PF | Q82DL2 | Holo-[acyl-carrier-protein] synthase | 3.21e-08 | 7.30e-29 | NA | 0.76 |
| 2. PF | Q2W515 | Holo-[acyl-carrier-protein] synthase | 5.06e-13 | 4.63e-24 | NA | 0.844 |
| 2. PF | B2TXX6 | Holo-[acyl-carrier-protein] synthase | 1.69e-13 | 8.66e-32 | NA | 0.8487 |
| 2. PF | A4TKX4 | Holo-[acyl-carrier-protein] synthase | 6.50e-13 | 5.34e-34 | NA | 0.8268 |
| 2. PF | Q07Z00 | Holo-[acyl-carrier-protein] synthase | 2.35e-12 | 5.05e-31 | NA | 0.8505 |
| 2. PF | Q2SXT0 | Holo-[acyl-carrier-protein] synthase | 1.74e-12 | 3.15e-22 | NA | 0.8661 |
| 2. PF | Q5F6P2 | Holo-[acyl-carrier-protein] synthase | 9.92e-13 | 1.36e-28 | NA | 0.8503 |
| 2. PF | A0KZM8 | Holo-[acyl-carrier-protein] synthase | 1.70e-12 | 2.65e-32 | NA | 0.8455 |
| 2. PF | B1W3W2 | Holo-[acyl-carrier-protein] synthase | 1.44e-08 | 1.22e-30 | NA | 0.725 |
| 2. PF | B2VEA7 | Holo-[acyl-carrier-protein] synthase | 2.95e-13 | 4.42e-31 | NA | 0.8459 |
| 2. PF | B9KIC8 | Holo-[acyl-carrier-protein] synthase | 5.18e-14 | 2.52e-24 | NA | 0.8273 |
| 2. PF | A1AWQ3 | Holo-[acyl-carrier-protein] synthase | 1.34e-12 | 1.72e-31 | NA | 0.8614 |
| 2. PF | A4SVW6 | Holo-[acyl-carrier-protein] synthase | 2.20e-13 | 2.08e-31 | NA | 0.8344 |
| 2. PF | A8H1D1 | Holo-[acyl-carrier-protein] synthase | 3.41e-12 | 1.39e-31 | NA | 0.8184 |
| 2. PF | B9LIY4 | Holo-[acyl-carrier-protein] synthase | 2.59e-08 | 2.98e-24 | NA | 0.7902 |
| 2. PF | C4XGU1 | Holo-[acyl-carrier-protein] synthase | 4.01e-12 | 1.15e-30 | NA | 0.7863 |
| 2. PF | Q7W9J6 | Holo-[acyl-carrier-protein] synthase | 5.23e-12 | 1.09e-16 | NA | 0.8293 |
| 2. PF | Q2GK71 | Holo-[acyl-carrier-protein] synthase | 4.14e-13 | 3.45e-29 | NA | 0.8525 |
| 2. PF | A5FVX4 | Holo-[acyl-carrier-protein] synthase | 9.65e-12 | 2.11e-20 | NA | 0.819 |
| 2. PF | Q31XS4 | Holo-[acyl-carrier-protein] synthase | 1.76e-13 | 8.66e-32 | NA | 0.8485 |
| 2. PF | A0K5W3 | Holo-[acyl-carrier-protein] synthase | 3.69e-12 | 7.09e-16 | NA | 0.8568 |
| 2. PF | A9WE63 | Holo-[acyl-carrier-protein] synthase | 9.86e-09 | 2.98e-24 | NA | 0.8096 |
| 2. PF | P63465 | Holo-[acyl-carrier-protein] synthase | 1.75e-11 | 2.25e-17 | NA | 0.7962 |
| 2. PF | A0R1H6 | Holo-[acyl-carrier-protein] synthase | 2.63e-09 | 8.13e-28 | NA | 0.742 |
| 2. PF | Q5NLS7 | Holo-[acyl-carrier-protein] synthase | 2.45e-11 | 2.43e-24 | NA | 0.7914 |
| 2. PF | Q21XM1 | Holo-[acyl-carrier-protein] synthase | 5.65e-14 | 2.18e-30 | NA | 0.8179 |
| 2. PF | P0A0Q5 | Holo-[acyl-carrier-protein] synthase | 2.71e-13 | 4.18e-28 | NA | 0.8605 |
| 2. PF | A6WKR1 | Holo-[acyl-carrier-protein] synthase | 1.41e-12 | 1.07e-30 | NA | 0.8619 |
| 2. PF | B5FRC1 | Holo-[acyl-carrier-protein] synthase | 2.20e-13 | 1.16e-32 | NA | 0.8311 |
| 2. PF | Q7N1X9 | Holo-[acyl-carrier-protein] synthase | 5.76e-13 | 1.22e-33 | NA | 0.8575 |
| 2. PF | A6TVL0 | Holo-[acyl-carrier-protein] synthase | 3.51e-11 | 1.03e-32 | NA | 0.817 |
| 2. PF | Q3YYV3 | Holo-[acyl-carrier-protein] synthase | 1.63e-13 | 8.66e-32 | NA | 0.8487 |
| 2. PF | A1JKK7 | Holo-[acyl-carrier-protein] synthase | 6.29e-13 | 1.40e-32 | NA | 0.8475 |
| 2. PF | B8EBP8 | Holo-[acyl-carrier-protein] synthase | 1.38e-12 | 1.05e-30 | NA | 0.8514 |
| 2. PF | C6DBM7 | Holo-[acyl-carrier-protein] synthase | 3.10e-13 | 5.48e-32 | NA | 0.8467 |
| 2. PF | Q2KAE5 | Holo-[acyl-carrier-protein] synthase | 4.30e-11 | 3.77e-18 | NA | 0.8098 |
| 2. PF | A5CU72 | Holo-[acyl-carrier-protein] synthase | 2.17e-09 | 1.04e-23 | NA | 0.7858 |
| 2. PF | B1XTL7 | Holo-[acyl-carrier-protein] synthase | 2.56e-13 | 4.10e-28 | NA | 0.854 |
| 2. PF | Q2NS17 | Holo-[acyl-carrier-protein] synthase | 7.60e-13 | 3.20e-29 | NA | 0.8567 |
| 2. PF | Q73XH8 | Holo-[acyl-carrier-protein] synthase | 1.23e-09 | 3.03e-31 | NA | 0.7814 |
| 2. PF | Q2NCF7 | Holo-[acyl-carrier-protein] synthase | 2.04e-12 | 4.11e-21 | NA | 0.8189 |
| 2. PF | Q1B5T0 | Holo-[acyl-carrier-protein] synthase | 2.46e-09 | 4.94e-27 | NA | 0.741 |
| 2. PF | C0PYH1 | Holo-[acyl-carrier-protein] synthase | 2.03e-13 | 1.18e-32 | NA | 0.8466 |
| 2. PF | A9KLF9 | Holo-[acyl-carrier-protein] synthase | 7.21e-11 | 4.04e-21 | NA | 0.8226 |
| 2. PF | B1YVM8 | Holo-[acyl-carrier-protein] synthase | 3.29e-12 | 1.32e-16 | NA | 0.8556 |
| 2. PF | Q1BXT7 | Holo-[acyl-carrier-protein] synthase | 3.02e-12 | 7.09e-16 | NA | 0.8582 |
| 2. PF | A1V6B3 | Holo-[acyl-carrier-protein] synthase | 2.17e-12 | 6.13e-22 | NA | 0.8593 |
| 2. PF | Q39I69 | Holo-[acyl-carrier-protein] synthase | 2.70e-12 | 7.70e-22 | NA | 0.8569 |
| 2. PF | Q667V4 | Holo-[acyl-carrier-protein] synthase | 6.35e-13 | 8.86e-35 | NA | 0.8277 |
| 2. PF | C5B8X8 | Holo-[acyl-carrier-protein] synthase | 3.14e-13 | 2.16e-31 | NA | 0.8523 |
| 2. PF | B5XNH4 | Holo-[acyl-carrier-protein] synthase | 2.94e-13 | 1.53e-31 | NA | 0.8602 |
| 2. PF | Q0BH00 | Holo-[acyl-carrier-protein] synthase | 3.20e-12 | 3.37e-16 | NA | 0.8568 |
| 2. PF | Q5P082 | Holo-[acyl-carrier-protein] synthase | 3.04e-13 | 7.22e-31 | NA | 0.842 |
| 2. PF | B3CL63 | Holo-[acyl-carrier-protein] synthase | 5.67e-13 | 7.65e-39 | NA | 0.8267 |
| 2. PF | Q73LF7 | Holo-[acyl-carrier-protein] synthase | 3.33e-12 | 3.33e-32 | NA | 0.8507 |
| 2. PF | Q5HBI7 | Holo-[acyl-carrier-protein] synthase | 3.83e-13 | 2.42e-39 | NA | 0.8395 |
| 2. PF | Q9Z8M5 | Holo-[acyl-carrier-protein] synthase | 6.36e-12 | 3.68e-36 | NA | 0.8501 |
| 2. PF | A8AD21 | Holo-[acyl-carrier-protein] synthase | 1.89e-13 | 6.50e-32 | NA | 0.8301 |
| 2. PF | A7MH03 | Holo-[acyl-carrier-protein] synthase | 1.40e-13 | 3.20e-32 | NA | 0.8587 |
| 2. PF | B8JBG5 | Holo-[acyl-carrier-protein] synthase | 4.76e-10 | 4.04e-30 | NA | 0.8235 |
| 2. PF | B8DPF0 | Holo-[acyl-carrier-protein] synthase | 6.59e-12 | 1.12e-26 | NA | 0.7993 |
| 2. PF | B8D949 | Holo-[acyl-carrier-protein] synthase | 3.69e-12 | 1.39e-37 | NA | 0.8518 |
| 2. PF | Q83K24 | Holo-[acyl-carrier-protein] synthase | 1.76e-13 | 8.66e-32 | NA | 0.8442 |
| 2. PF | Q985A8 | Holo-[acyl-carrier-protein] synthase | 2.97e-11 | 2.13e-16 | NA | 0.8035 |
| 2. PF | A1S3Y5 | Holo-[acyl-carrier-protein] synthase | 1.11e-12 | 1.71e-36 | NA | 0.8326 |
| 3. BF | Q2TXF0 | Fatty acid synthase subunit alpha | 1.62e-01 | NA | 4.75e-04 | 0.7561 |
| 3. BF | M2YJJ3 | Fatty acid synthase alpha subunit hexA | 1.66e-01 | NA | 0.004 | 0.8147 |
| 3. BF | A7TUG9 | Fatty acid synthase alpha subunit hexA (Fragment) | 1.40e-06 | NA | 8.88e-04 | 0.853 |
| 4. PB | Q9ZAH6 | Holo-[acyl-carrier-protein] synthase | 1.11e-15 | 8.72e-43 | 2.73e-11 | NA |
| 4. PB | Q0SPF4 | Holo-[acyl-carrier-protein] synthase | 2.37e-11 | 3.89e-28 | 0.045 | NA |
| 4. PB | A0RPF9 | Holo-[acyl-carrier-protein] synthase | 6.88e-10 | 3.59e-27 | 7.08e-05 | NA |
| 4. PB | A1WKY6 | Holo-[acyl-carrier-protein] synthase | 2.24e-11 | 4.55e-26 | 3.89e-05 | NA |
| 4. PB | Q663A2 | Holo-[acyl-carrier-protein] synthase | 2.08e-11 | 7.86e-29 | 0.022 | NA |
| 4. PB | B6JM38 | Holo-[acyl-carrier-protein] synthase | 1.29e-09 | 5.05e-31 | 1.68e-04 | NA |
| 4. PB | Q9ZL36 | Holo-[acyl-carrier-protein] synthase | 1.10e-09 | 3.42e-30 | 1.24e-04 | NA |
| 4. PB | Q1CT62 | Holo-[acyl-carrier-protein] synthase | 2.15e-09 | 2.36e-32 | 4.20e-05 | NA |
| 4. PB | A7I379 | Holo-[acyl-carrier-protein] synthase | 1.79e-11 | 1.77e-32 | 6.19e-06 | NA |
| 4. PB | Q7NE72 | Holo-[acyl-carrier-protein] synthase | 3.01e-10 | 1.11e-30 | 4.03e-07 | NA |
| 4. PB | A7GY16 | Holo-[acyl-carrier-protein] synthase | 1.30e-09 | 1.32e-32 | 5.38e-04 | NA |
| 4. PB | B5Z7H0 | Holo-[acyl-carrier-protein] synthase | 8.36e-10 | 4.42e-31 | 3.63e-05 | NA |
| 4. PB | Q3B672 | Holo-[acyl-carrier-protein] synthase | 2.57e-11 | 2.22e-28 | 8.26e-04 | NA |
| 4. PB | Q7M803 | Holo-[acyl-carrier-protein] synthase | 1.30e-09 | 7.82e-22 | 0.003 | NA |
| 4. PB | G2TRL9 | Putative holo-[acyl-carrier-protein] synthase | 2.65e-11 | 7.43e-28 | 4.67e-07 | NA |
| 4. PB | A4J8G9 | Holo-[acyl-carrier-protein] synthase | 2.67e-10 | 5.81e-26 | 3.68e-06 | NA |
| 4. PB | Q17XL2 | Holo-[acyl-carrier-protein] synthase | 5.89e-10 | 3.74e-32 | 0.001 | NA |
| 5. P | Q07M73 | Holo-[acyl-carrier-protein] synthase | 2.28e-11 | 7.41e-21 | NA | NA |
| 5. P | Q1MJ56 | Holo-[acyl-carrier-protein] synthase | 1.89e-11 | 1.18e-18 | NA | NA |
| 5. P | B1Z872 | Holo-[acyl-carrier-protein] synthase | 1.33e-11 | 1.48e-12 | NA | NA |
| 5. P | B8EK15 | Holo-[acyl-carrier-protein] synthase | 3.50e-11 | 3.37e-14 | NA | NA |
| 5. P | B7J0U9 | Holo-[acyl-carrier-protein] synthase | 2.62e-11 | 2.43e-29 | NA | NA |
| 5. P | B1LTR5 | Holo-[acyl-carrier-protein] synthase | 4.38e-12 | 1.86e-18 | NA | NA |
| 5. P | A8LLD7 | Holo-[acyl-carrier-protein] synthase | 1.85e-10 | 6.47e-17 | NA | NA |
| 5. P | B7L2A4 | Holo-[acyl-carrier-protein] synthase | 1.14e-11 | 7.02e-15 | NA | NA |
| 5. P | C5CC21 | Holo-[acyl-carrier-protein] synthase | 1.52e-08 | 7.83e-17 | NA | NA |
| 5. P | A0PU93 | Holo-[acyl-carrier-protein] synthase | 1.15e-09 | 3.11e-30 | NA | NA |
| 5. P | B3PUN6 | Holo-[acyl-carrier-protein] synthase | 1.61e-11 | 2.39e-17 | NA | NA |
| 5. P | B9L9S0 | Holo-[acyl-carrier-protein] synthase | 7.82e-11 | 2.16e-31 | NA | NA |
| 5. P | B5ZW71 | Holo-[acyl-carrier-protein] synthase | 2.59e-11 | 1.19e-17 | NA | NA |
| 5. P | Q1QL52 | Holo-[acyl-carrier-protein] synthase | 2.64e-11 | 1.04e-17 | NA | NA |
| 5. P | B9KSA5 | Holo-[acyl-carrier-protein] synthase | 1.08e-10 | 1.57e-18 | NA | NA |
| 5. P | A5EKL9 | Holo-[acyl-carrier-protein] synthase | 1.45e-11 | 7.15e-20 | NA | NA |
| 5. P | Q6G084 | Holo-[acyl-carrier-protein] synthase | 7.49e-12 | 7.50e-20 | NA | NA |
| 5. P | Q16AI8 | Holo-[acyl-carrier-protein] synthase | 1.33e-10 | 3.59e-20 | NA | NA |
| 5. P | A1UJA6 | Holo-[acyl-carrier-protein] synthase | 8.85e-10 | 4.94e-27 | NA | NA |
| 5. P | A7H5D0 | Holo-[acyl-carrier-protein] synthase | 1.58e-09 | 2.33e-31 | NA | NA |
| 5. P | C0RI01 | Holo-[acyl-carrier-protein] synthase | 1.55e-11 | 2.25e-17 | NA | NA |
| 5. P | A1WAW0 | Holo-[acyl-carrier-protein] synthase | 5.20e-14 | 3.85e-29 | NA | NA |
| 5. P | A6U7A6 | Holo-[acyl-carrier-protein] synthase | 1.62e-11 | 4.74e-12 | NA | NA |
| 5. P | A8M4B5 | Holo-[acyl-carrier-protein] synthase | 1.53e-08 | 5.88e-33 | NA | NA |
| 5. P | Q9X7E3 | Holo-[acyl-carrier-protein] synthase | 1.48e-09 | 1.18e-26 | NA | NA |
| 5. P | Q3J5W3 | Holo-[acyl-carrier-protein] synthase | 1.75e-10 | 1.23e-18 | NA | NA |
| 5. P | B0UE20 | Holo-[acyl-carrier-protein] synthase | 7.80e-12 | 7.61e-18 | NA | NA |
| 5. P | B2SAD7 | Holo-[acyl-carrier-protein] synthase | 2.32e-11 | 2.25e-17 | NA | NA |
| 5. P | B0T3H7 | Holo-[acyl-carrier-protein] synthase | 2.54e-11 | 1.57e-16 | NA | NA |
| 5. P | Q9PMP8 | Holo-[acyl-carrier-protein] synthase | 1.44e-09 | 1.56e-31 | NA | NA |
| 5. P | A7IM60 | Holo-[acyl-carrier-protein] synthase | 2.50e-11 | 2.55e-18 | NA | NA |
| 5. P | Q1D4A0 | Holo-[acyl-carrier-protein] synthase | 2.30e-11 | 7.57e-37 | NA | NA |
| 5. P | A4WVP7 | Holo-[acyl-carrier-protein] synthase | 2.42e-10 | 3.69e-19 | NA | NA |
| 5. P | P0A4W9 | Holo-[acyl-carrier-protein] synthase | 7.75e-10 | 5.48e-32 | NA | NA |
| 5. P | Q30SB4 | Holo-[acyl-carrier-protein] synthase | 6.33e-10 | 8.62e-22 | NA | NA |
| 5. P | A5VPJ6 | Holo-[acyl-carrier-protein] synthase | 2.46e-11 | 2.25e-17 | NA | NA |
| 5. P | Q9A807 | Holo-[acyl-carrier-protein] synthase | 4.85e-11 | 9.23e-19 | NA | NA |
| 5. P | A9MA33 | Holo-[acyl-carrier-protein] synthase | 1.63e-11 | 2.25e-17 | NA | NA |
| 5. P | P63464 | Holo-[acyl-carrier-protein] synthase | 2.20e-11 | 2.25e-17 | NA | NA |
| 5. P | Q12036 | Mitochondrial holo-[acyl-carrier-protein] synthase | 8.44e-09 | 5.75e-11 | NA | NA |
| 5. P | A7ZDS5 | Holo-[acyl-carrier-protein] synthase | 7.06e-10 | 3.49e-28 | NA | NA |
| 5. P | Q136W1 | Holo-[acyl-carrier-protein] synthase | 1.18e-11 | 7.38e-20 | NA | NA |
| 5. P | B2GJ30 | Holo-[acyl-carrier-protein] synthase | 1.70e-09 | 1.29e-20 | NA | NA |
| 5. P | B0S2M4 | Holo-[acyl-carrier-protein] synthase | 5.09e-09 | 1.08e-41 | NA | NA |
| 5. P | A8I3B0 | Holo-[acyl-carrier-protein] synthase | 5.99e-11 | 1.29e-18 | NA | NA |
| 5. P | B8H624 | Holo-[acyl-carrier-protein] synthase | 4.81e-11 | 9.23e-19 | NA | NA |
| 5. P | Q57E83 | Holo-[acyl-carrier-protein] synthase | 2.13e-11 | 2.25e-17 | NA | NA |
| 5. P | C6E2U2 | Holo-[acyl-carrier-protein] synthase | 8.26e-12 | 5.00e-28 | NA | NA |
| 5. P | Q5HT08 | Holo-[acyl-carrier-protein] synthase | 1.56e-09 | 3.03e-31 | NA | NA |
| 5. P | A1KLL9 | Holo-[acyl-carrier-protein] synthase | 1.07e-09 | 5.48e-32 | NA | NA |
| 5. P | Q2YN04 | Holo-[acyl-carrier-protein] synthase | 2.58e-11 | 2.25e-17 | NA | NA |
| 5. P | B8ZR72 | Holo-[acyl-carrier-protein] synthase | 1.41e-09 | 1.18e-26 | NA | NA |
| 5. P | Q0APC3 | Holo-[acyl-carrier-protein] synthase | 4.04e-10 | 2.42e-17 | NA | NA |
| 5. P | B8DVV4 | Holo-[acyl-carrier-protein] synthase | 9.97e-08 | 1.32e-15 | NA | NA |
| 5. P | Q3A5V3 | Holo-[acyl-carrier-protein] synthase | 1.45e-11 | 2.41e-33 | NA | NA |
| 5. P | Q6G461 | Holo-[acyl-carrier-protein] synthase | 1.43e-11 | 2.67e-18 | NA | NA |
| 5. P | A3PGF6 | Holo-[acyl-carrier-protein] synthase | 1.61e-10 | 1.57e-18 | NA | NA |
| 5. P | Q74C71 | Holo-[acyl-carrier-protein] synthase | 6.36e-12 | 1.09e-28 | NA | NA |
| 5. P | A8ERC0 | Holo-[acyl-carrier-protein] synthase | 9.51e-10 | 5.84e-19 | NA | NA |
| 5. P | Q0C3U0 | Holo-[acyl-carrier-protein] synthase | 1.41e-11 | 2.77e-17 | NA | NA |
| 5. P | O86785 | Holo-[acyl-carrier-protein] synthase | 1.66e-08 | 3.68e-30 | NA | NA |
| 5. P | B4UEM2 | Holo-[acyl-carrier-protein] synthase | 4.13e-10 | 4.11e-30 | NA | NA |
| 5. P | A1W123 | Holo-[acyl-carrier-protein] synthase | 1.53e-09 | 4.26e-31 | NA | NA |
| 5. P | P24224 | Holo-[acyl-carrier-protein] synthase | 3.60e-13 | 9.39e-31 | NA | NA |
| 5. P | A5VD51 | Holo-[acyl-carrier-protein] synthase | 4.24e-12 | 3.31e-19 | NA | NA |
| 5. P | A9IRM3 | Holo-[acyl-carrier-protein] synthase | 6.47e-12 | 3.31e-19 | NA | NA |
| 5. P | P9WQD2 | Holo-[acyl-carrier-protein] synthase | 2.61e-09 | 2.22e-29 | NA | NA |
| 5. P | Q6N6C3 | Holo-[acyl-carrier-protein] synthase | 3.60e-11 | 8.06e-16 | NA | NA |
| 5. P | Q4W9R0 | 4'-phosphopantetheinyl transferase B, mitochondrial | 1.65e-09 | 5.11e-16 | NA | NA |
| 5. P | A8FN84 | Holo-[acyl-carrier-protein] synthase | 1.50e-09 | 1.72e-31 | NA | NA |
| 5. P | Q8UGK4 | Holo-[acyl-carrier-protein] synthase | 1.85e-11 | 3.45e-15 | NA | NA |
| 5. P | B0CKY5 | Holo-[acyl-carrier-protein] synthase | 1.88e-11 | 2.25e-17 | NA | NA |
| 5. P | Q214J8 | Holo-[acyl-carrier-protein] synthase | 1.60e-11 | 1.08e-20 | NA | NA |
| 5. P | Q3SRB1 | Holo-[acyl-carrier-protein] synthase | 5.15e-11 | 8.10e-20 | NA | NA |
| 5. P | Q75BZ1 | Mitochondrial holo-[acyl-carrier-protein] synthase | 5.34e-09 | 1.27e-13 | NA | NA |
| 5. P | A9B2B6 | Holo-[acyl-carrier-protein] synthase | 7.10e-09 | 2.72e-25 | NA | NA |
| 5. P | B5EI15 | Holo-[acyl-carrier-protein] synthase | 7.68e-12 | 3.61e-30 | NA | NA |
| 5. P | A1AZ41 | Holo-[acyl-carrier-protein] synthase | 1.06e-10 | 2.14e-15 | NA | NA |
| 5. P | A1US34 | Holo-[acyl-carrier-protein] synthase | 1.09e-11 | 1.93e-21 | NA | NA |
| 5. P | Q39UG1 | Holo-[acyl-carrier-protein] synthase | 6.80e-12 | 4.27e-30 | NA | NA |
| 5. P | A6Q3W1 | Holo-[acyl-carrier-protein] synthase | 3.57e-10 | 5.47e-28 | NA | NA |
| 5. P | P9WQD3 | Holo-[acyl-carrier-protein] synthase | 1.18e-09 | 5.48e-32 | NA | NA |
| 5. P | A4XBI2 | Holo-[acyl-carrier-protein] synthase | 1.37e-08 | 1.23e-32 | NA | NA |
| 5. P | A1A005 | Holo-[acyl-carrier-protein] synthase | 7.39e-08 | 1.06e-12 | NA | NA |
| 5. P | C1AEZ0 | Holo-[acyl-carrier-protein] synthase | 1.06e-09 | 5.48e-32 | NA | NA |
| 5. P | Q92R49 | Holo-[acyl-carrier-protein] synthase | 1.78e-11 | 4.66e-11 | NA | NA |
| 5. P | A5U5M1 | Holo-[acyl-carrier-protein] synthase | 8.89e-10 | 5.48e-32 | NA | NA |
| 6. F | P43098 | Fatty acid synthase subunit alpha | 1.44e-01 | NA | NA | 0.7878 |
| 6. F | P55810 | 4'-phosphopantetheinyl transferase psf-1 | 5.54e-07 | NA | NA | 0.7773 |
| 6. F | P39144 | 4'-phosphopantetheinyl transferase | 2.49e-07 | NA | NA | 0.7438 |
| 6. F | P39135 | 4'-phosphopantetheinyl transferase Sfp | 3.46e-07 | NA | NA | 0.7764 |
| 6. F | P40683 | 4'-phosphopantetheinyl transferase gsp | 1.10e-06 | NA | NA | 0.7526 |
| 6. F | Q8TGA2 | Fatty acid synthase alpha subunit aflA | 1.51e-01 | NA | NA | 0.8163 |
| 6. F | Q00681 | Sterigmatocystin biosynthesis fatty acid synthase subunit alpha | 2.12e-01 | NA | NA | 0.7816 |
| 6. F | Q9F4F7 | 4'-phosphopantetheinyl transferase ffp | 1.59e-07 | NA | NA | 0.7738 |
| 7. B | P78615 | Fatty acid synthase subunit alpha | 2.61e-01 | NA | 1.48e-04 | NA |
| 7. B | Q9WZF6 | Holo-[acyl-carrier-protein] synthase | 3.23e-11 | NA | 2.28e-10 | NA |
| 7. B | P15368 | Fatty acid synthase subunit alpha | 1.63e-01 | NA | 0.009 | NA |