Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54831.1
JCVISYN3A_0515
Cytidine deaminase.
M. mycoides homolog: Q6MT32.
TIGRfam Classification: 4=Probable.
Category: Quasiessential.
Statistics
Total GO Annotation: 65
Unique PROST Go: 29
Unique BLAST Go: 1
Unique Foldseek Go: 6
Total Homologs: 150
Unique PROST Homologs: 32
Unique BLAST Homologs: 8
Unique Foldseek Homologs: 62
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q5RC69
(Deoxycytidylate deaminase) with a FATCAT P-Value: 0 and RMSD of 1.39 angstrom. The sequence alignment identity is 47.8%.
Structural alignment shown in left. Query protein AVX54831.1 colored as red in alignment, homolog Q5RC69 colored as blue.
Query protein AVX54831.1 is also shown in right top, homolog Q5RC69 showed in right bottom. They are colored based on secondary structures.
AVX54831.1 MS-----KRLDYLSWQHYFMLIAKASAMRSKDPNTQVGAIVVNELQQIVATGYNGFPRGVSDDEFPW---SKNNEDWLENKYAYVAHAELNAIVSSRS-D 91 Q5RC69 MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDQLPWRRTAKNK---LDTKYPYVCHAELNAIMNKNSTD 97 AVX54831.1 LSNCDLYVTLFPCNECAKIIIQAGIKRIYYANDPYHDKKEFIASKKMLDAVNIKYIK-LP-------DIE-I----SLKVKD 160 Q5RC69 VKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFDMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ- 178
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0070383 | DNA cytosine deamination |
| 1. PBF | GO:0004132 | dCMP deaminase activity |
| 1. PBF | GO:0002100 | tRNA wobble adenosine to inosine editing |
| 1. PBF | GO:0006220 | pyrimidine nucleotide metabolic process |
| 1. PBF | GO:0008270 | zinc ion binding |
| 1. PBF | GO:0047844 | deoxycytidine deaminase activity |
| 1. PBF | GO:0008835 | diaminohydroxyphosphoribosylaminopyrimidine deaminase activity |
| 1. PBF | GO:0052717 | tRNA-specific adenosine-34 deaminase activity |
| 1. PBF | GO:0004126 | cytidine deaminase activity |
| 1. PBF | GO:0009231 | riboflavin biosynthetic process |
| 1. PBF | GO:0009165 | nucleotide biosynthetic process |
| 2. PF | GO:0006152 | purine nucleoside catabolic process |
| 2. PF | GO:0006147 | guanine catabolic process |
| 2. PF | GO:0016554 | cytidine to uridine editing |
| 2. PF | GO:0047974 | guanosine deaminase activity |
| 2. PF | GO:0010529 | negative regulation of transposition |
| 2. PF | GO:0008251 | tRNA-specific adenosine deaminase activity |
| 2. PF | GO:0008892 | guanine deaminase activity |
| 3. BF | GO:0061676 | importin-alpha family protein binding |
| 3. BF | GO:0008703 | 5-amino-6-(5-phosphoribosylamino)uracil reductase activity |
| 3. BF | GO:0050661 | NADP binding |
| 4. PB | GO:0004131 | cytosine deaminase activity |
| 4. PB | GO:0019858 | cytosine metabolic process |
| 4. PB | GO:0006231 | dTMP biosynthetic process |
| 4. PB | GO:0102480 | 5-fluorocytosine deaminase activity |
| 4. PB | GO:0006226 | dUMP biosynthetic process |
| 4. PB | GO:0042802 | identical protein binding |
| 4. PB | GO:0009972 | cytidine deamination |
| 4. PB | GO:0044206 | UMP salvage |
| 5. P | GO:0034774 | secretory granule lumen |
| 5. P | GO:1904724 | tertiary granule lumen |
| 5. P | GO:0006382 | adenosine to inosine editing |
| 5. P | GO:0046087 | cytidine metabolic process |
| 5. P | GO:0046677 | response to antibiotic |
| 5. P | GO:0044355 | clearance of foreign intracellular DNA |
| 5. P | GO:0016556 | mRNA modification |
| 5. P | GO:0006249 | dCMP catabolic process |
| 5. P | GO:0006397 | mRNA processing |
| 5. P | GO:0006216 | cytidine catabolic process |
| 5. P | GO:0045087 | innate immune response |
| 5. P | GO:0047711 | blasticidin-S deaminase activity |
| 5. P | GO:1904813 | ficolin-1-rich granule lumen |
| 5. P | GO:0005634 | nucleus |
| 5. P | GO:0030308 | negative regulation of cell growth |
| 5. P | GO:0001882 | nucleoside binding |
| 5. P | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 5. P | GO:0019239 | deaminase activity |
| 5. P | GO:0051607 | defense response to virus |
| 5. P | GO:0043100 | pyrimidine nucleobase salvage |
| 5. P | GO:0006248 | CMP catabolic process |
| 5. P | GO:0000932 | P-body |
| 5. P | GO:0006217 | deoxycytidine catabolic process |
| 5. P | GO:0080111 | DNA demethylation |
| 5. P | GO:0071466 | cellular response to xenobiotic stimulus |
| 5. P | GO:0008655 | pyrimidine-containing compound salvage |
| 5. P | GO:0046109 | uridine biosynthetic process |
| 5. P | GO:0045980 | negative regulation of nucleotide metabolic process |
| 5. P | GO:0045071 | negative regulation of viral genome replication |
| 6. F | GO:0048525 | negative regulation of viral process |
| 6. F | GO:0016879 | ligase activity, forming carbon-nitrogen bonds |
| 6. F | GO:0006189 | 'de novo' IMP biosynthetic process |
| 6. F | GO:0016814 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines |
| 6. F | GO:0003937 | IMP cyclohydrolase activity |
| 6. F | GO:0004643 | phosphoribosylaminoimidazolecarboxamide formyltransferase activity |
| 7. B | GO:0042803 | protein homodimerization activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004132 | dCMP deaminase activity |
| GO:0006220 | pyrimidine nucleotide metabolic process |
| GO:0008270 | zinc ion binding |
| GO:0003824 | catalytic activity |
| GO:0046872 | metal ion binding |
| GO:0016787 | hydrolase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A9CK16 | tRNA-specific adenosine deaminase | 3.58e-06 | 2.80e-12 | 2.03e-04 | 0.5224 |
| 1. PBF | Q8K9R4 | tRNA-specific adenosine deaminase | 1.32e-09 | 3.30e-20 | 0.004 | 0.6396 |
| 1. PBF | Q4UJW9 | tRNA-specific adenosine deaminase | 4.63e-07 | 4.08e-12 | 5.30e-05 | 0.4265 |
| 1. PBF | P44931 | tRNA-specific adenosine deaminase | 4.97e-06 | 9.88e-08 | 0.001 | 0.5305 |
| 1. PBF | Q1RGK7 | tRNA-specific adenosine deaminase | 6.28e-07 | 1.21e-08 | 6.52e-06 | 0.4208 |
| 1. PBF | P57343 | tRNA-specific adenosine deaminase | 3.04e-08 | 3.69e-11 | 0.013 | 0.6313 |
| 1. PBF | Q92G39 | tRNA-specific adenosine deaminase | 7.75e-07 | 1.31e-03 | 1.24e-05 | 0.4046 |
| 1. PBF | Q68Y02 | tRNA-specific adenosine deaminase | 4.19e-07 | 7.06e-06 | 0.001 | 0.4192 |
| 1. PBF | Q7CQ08 | tRNA-specific adenosine deaminase | 2.31e-05 | 1.52e-06 | 0.008 | 0.6569 |
| 1. PBF | Q8FF24 | tRNA-specific adenosine deaminase | 1.37e-05 | 1.68e-08 | 0.028 | 0.4928 |
| 1. PBF | Q8XA44 | tRNA-specific adenosine deaminase | 1.36e-05 | 1.68e-08 | 0.028 | 0.5147 |
| 1. PBF | Q99W51 | tRNA-specific adenosine deaminase | 5.67e-06 | 1.60e-11 | 3.53e-04 | 0.5265 |
| 1. PBF | P33968 | Uncharacterized deaminase in luxG 3'region | 2.81e-14 | 1.40e-43 | 5.90e-25 | 0.839 |
| 1. PBF | Q8XGY4 | tRNA-specific adenosine deaminase | 2.87e-05 | 1.52e-06 | 0.008 | 0.5115 |
| 1. PBF | P32393 | ComE operon protein 2 | 2.81e-12 | 1.17e-07 | 1.51e-17 | 0.8011 |
| 1. PBF | Q5RC69 | Deoxycytidylate deaminase | 0.00e+00 | 1.91e-55 | 4.73e-54 | 0.9208 |
| 1. PBF | Q9ZCC6 | tRNA-specific adenosine deaminase | 5.59e-07 | 2.02e-05 | 3.78e-04 | 0.4155 |
| 1. PBF | O67050 | tRNA-specific adenosine deaminase | 1.83e-06 | 9.21e-11 | 0.004 | 0.6256 |
| 2. PF | Q0P4H0 | tRNA-specific adenosine deaminase 2 | 1.59e-07 | 9.08e-09 | NA | 0.4154 |
| 2. PF | Q4V7V8 | tRNA-specific adenosine deaminase 2 | 2.03e-05 | 1.87e-11 | NA | 0.4756 |
| 2. PF | P21335 | tRNA-specific adenosine deaminase | 4.08e-06 | 6.69e-06 | NA | 0.5077 |
| 2. PF | P0DA20 | tRNA-specific adenosine deaminase | 1.04e-05 | 3.39e-06 | NA | 0.508 |
| 2. PF | Q8P2R7 | tRNA-specific adenosine deaminase | 7.20e-06 | 2.23e-12 | NA | 0.469 |
| 2. PF | Q5E9J7 | tRNA-specific adenosine deaminase 2 | 4.13e-07 | 4.19e-17 | NA | 0.4387 |
| 2. PF | Q89AM8 | tRNA-specific adenosine deaminase | 4.26e-08 | 1.43e-06 | NA | 0.5912 |
| 2. PF | P68999 | tRNA-specific adenosine deaminase | 1.04e-05 | 1.77e-06 | NA | 0.4662 |
| 2. PF | O34598 | Guanine deaminase | 1.31e-05 | 4.11e-10 | NA | 0.4895 |
| 2. PF | P68397 | tRNA-specific adenosine deaminase | 1.43e-05 | 1.55e-08 | NA | 0.5148 |
| 2. PF | Q5XE14 | tRNA-specific adenosine deaminase | 1.06e-05 | 3.39e-06 | NA | 0.4616 |
| 2. PF | P0DA21 | tRNA-specific adenosine deaminase | 1.03e-05 | 3.39e-06 | NA | 0.5041 |
| 3. BF | C1D1Q9 | tRNA(Ile)-lysidine synthase | 4.28e-03 | NA | 0.012 | 0.4809 |
| 3. BF | Q9Z735 | Riboflavin biosynthesis protein RibD | 3.86e-06 | NA | 0.001 | 0.656 |
| 3. BF | Q4R683 | Cytidine and dCMP deaminase domain-containing protein 1 | 1.26e-07 | NA | 5.79e-11 | 0.7382 |
| 3. BF | P17618 | Riboflavin biosynthesis protein RibD | 3.67e-06 | NA | 9.41e-06 | 0.6553 |
| 3. BF | P50853 | Riboflavin biosynthesis protein RibD | 1.26e-05 | NA | 8.12e-05 | 0.632 |
| 3. BF | Q5RAX4 | Cytidine and dCMP deaminase domain-containing protein 1 | 3.72e-06 | NA | 5.26e-11 | 0.7597 |
| 4. PB | P00814 | Deoxycytidylate deaminase | NA | 7.80e-32 | 7.10e-08 | NA |
| 4. PB | P16006 | Deoxycytidylate deaminase | NA | 2.33e-33 | 6.31e-07 | NA |
| 4. PB | Q8K9A4 | Diaminohydroxyphosphoribosylamino-pyrimidine deaminase | 1.94e-09 | 2.93e-05 | 0.006 | NA |
| 4. PB | Q8K2D6 | Deoxycytidylate deaminase | 0.00e+00 | 3.90e-56 | 2.00e-52 | NA |
| 4. PB | P78594 | Cytosine deaminase | 1.80e-08 | 2.97e-18 | 5.60e-04 | NA |
| 4. PB | O59834 | Probable cytosine deaminase | 6.81e-06 | 1.06e-11 | 0.001 | NA |
| 4. PB | P32321 | Deoxycytidylate deaminase | 0.00e+00 | 5.73e-56 | 2.46e-53 | NA |
| 4. PB | O22000 | Deoxycytidylate deaminase | NA | 4.11e-10 | 1.08e-15 | NA |
| 4. PB | P57533 | Diaminohydroxyphosphoribosylamino-pyrimidine deaminase | 2.28e-09 | 1.83e-04 | 0.002 | NA |
| 4. PB | P30648 | Probable deoxycytidylate deaminase | 2.22e-16 | 2.36e-10 | 5.03e-43 | NA |
| 4. PB | Q5M9G0 | Deoxycytidylate deaminase | 0.00e+00 | 3.90e-56 | 2.00e-52 | NA |
| 4. PB | Q9VWA2 | Probable deoxycytidylate deaminase | 0.00e+00 | 6.70e-31 | 8.20e-52 | NA |
| 5. P | Q9KD53 | Cytidine deaminase | 8.47e-06 | 6.01e-05 | NA | NA |
| 5. P | P0C2P0 | Blasticidin-S deaminase | 2.58e-04 | 4.75e-07 | NA | NA |
| 5. P | P47718 | Cytidine deaminase | 3.81e-06 | 9.33e-11 | NA | NA |
| 5. P | Q9S3M0 | Cytidine deaminase | 1.12e-05 | 2.92e-06 | NA | NA |
| 5. P | P56389 | Cytidine deaminase | 6.32e-05 | 7.29e-10 | NA | NA |
| 5. P | P9WPH3 | Cytidine deaminase | 5.39e-06 | 3.74e-08 | NA | NA |
| 5. P | Q3SYR3 | Probable C->U-editing enzyme APOBEC-2 | 1.08e-03 | 2.89e-08 | NA | NA |
| 5. P | Q7Z6V5 | tRNA-specific adenosine deaminase 2 | 3.79e-07 | 3.99e-14 | NA | NA |
| 5. P | P68398 | tRNA-specific adenosine deaminase | 1.42e-05 | 1.55e-08 | NA | NA |
| 5. P | Q4VDN5 | DNA dC->dU-editing enzyme APOBEC-3Ca | 1.65e-04 | 1.46e-06 | NA | NA |
| 5. P | P32320 | Cytidine deaminase | 3.70e-06 | 8.87e-09 | NA | NA |
| 5. P | Q94BU8 | Guanosine deaminase | 1.61e-07 | 6.53e-22 | NA | NA |
| 5. P | Q6P6J0 | tRNA-specific adenosine deaminase 2 | 4.17e-07 | 2.90e-16 | NA | NA |
| 5. P | P9WPH2 | Cytidine deaminase | 5.45e-06 | 3.74e-08 | NA | NA |
| 5. P | Q54I82 | Probable cytidine deaminase | 1.10e-05 | 2.89e-08 | NA | NA |
| 5. P | P0CI02 | Blasticidin-S deaminase | 2.50e-04 | 8.26e-07 | NA | NA |
| 5. P | Q694B5 | DNA dC->dU-editing enzyme APOBEC-3C | 1.74e-04 | 1.03e-04 | NA | NA |
| 5. P | Q6IDB6 | tRNA-specific adenosine deaminase TAD2 | 1.82e-07 | 4.44e-07 | NA | NA |
| 5. P | Q06549 | Cytidine deaminase | 9.16e-06 | 1.65e-09 | NA | NA |
| 5. P | Q12178 | Cytosine deaminase | 4.55e-08 | 9.52e-31 | NA | NA |
| 5. P | Q09190 | Putative cytidine deaminase | 5.86e-07 | 5.18e-08 | NA | NA |
| 5. P | Q9WV35 | C->U-editing enzyme APOBEC-2 | 1.81e-03 | 5.19e-07 | NA | NA |
| 5. P | P75051 | Cytidine deaminase | 1.11e-05 | 1.69e-09 | NA | NA |
| 5. P | P0C2P1 | Blasticidin-S deaminase | 2.29e-04 | 5.02e-07 | NA | NA |
| 5. P | P31941 | DNA dC->dU-editing enzyme APOBEC-3A | 2.12e-03 | 2.86e-02 | NA | NA |
| 5. P | Q9Y235 | C->U-editing enzyme APOBEC-2 | 2.04e-03 | 1.04e-08 | NA | NA |
| 5. P | P19079 | Cytidine deaminase | 1.19e-05 | 2.59e-06 | NA | NA |
| 5. P | Q9NRW3 | DNA dC->dU-editing enzyme APOBEC-3C | 1.97e-04 | 1.61e-03 | NA | NA |
| 5. P | P47298 | Cytidine deaminase | 1.17e-05 | 1.40e-10 | NA | NA |
| 5. P | Q694B4 | Probable C->U-editing enzyme APOBEC-2 | 1.97e-03 | 5.86e-07 | NA | NA |
| 5. P | P33967 | Blasticidin-S deaminase | 2.07e-04 | 5.95e-08 | NA | NA |
| 5. P | P34401 | Uncharacterized protein F10E9.7 | 2.71e-10 | 5.63e-18 | NA | NA |
| 6. F | Q02Y66 | Bifunctional purine biosynthesis protein PurH | 5.62e-03 | NA | NA | 0.4617 |
| 6. F | Q5SI38 | tRNA(Ile)-lysidine synthase | 1.14e-02 | NA | NA | 0.5909 |
| 6. F | B1XS23 | Bifunctional purine biosynthesis protein PurH | 1.30e-03 | NA | NA | 0.4451 |
| 6. F | Q9CFG0 | Bifunctional purine biosynthesis protein PurH | 5.64e-03 | NA | NA | 0.4508 |
| 6. F | A7H375 | Bifunctional purine biosynthesis protein PurH | 9.44e-03 | NA | NA | 0.4923 |
| 6. F | Q049M1 | Bifunctional purine biosynthesis protein PurH | 8.47e-03 | NA | NA | 0.51 |
| 6. F | Q62HA6 | Bifunctional purine biosynthesis protein PurH | 9.00e-03 | NA | NA | 0.4825 |
| 6. F | Q13UC4 | Bifunctional purine biosynthesis protein PurH | 8.56e-03 | NA | NA | 0.4688 |
| 6. F | O84735 | Riboflavin biosynthesis protein RibD | 2.75e-06 | NA | NA | 0.6479 |
| 6. F | A9AH70 | Bifunctional purine biosynthesis protein PurH | 8.47e-03 | NA | NA | 0.4766 |
| 6. F | Q04EU6 | Bifunctional purine biosynthesis protein PurH | 2.52e-03 | NA | NA | 0.4854 |
| 6. F | Q1G9G2 | Bifunctional purine biosynthesis protein PurH | 8.84e-03 | NA | NA | 0.5111 |
| 6. F | O67775 | Bifunctional purine biosynthesis protein PurH | 8.19e-03 | NA | NA | 0.5 |
| 6. F | C1D6F1 | Bifunctional purine biosynthesis protein PurH | 1.68e-02 | NA | NA | 0.5024 |
| 6. F | A4XKZ2 | Bifunctional purine biosynthesis protein PurH | 6.74e-03 | NA | NA | 0.5147 |
| 6. F | Q8DRM1 | Bifunctional purine biosynthesis protein PurH | 1.01e-02 | NA | NA | 0.4669 |
| 6. F | A2BUP7 | Bifunctional purine biosynthesis protein PurH | 1.64e-02 | NA | NA | 0.5085 |
| 6. F | Q8TWU6 | tRNA(cytosine(8)) deaminase | 4.42e-05 | NA | NA | 0.515 |
| 6. F | Q7P0M1 | Bifunctional purine biosynthesis protein PurH | 1.18e-02 | NA | NA | 0.4932 |
| 6. F | B7J5P7 | Bifunctional purine biosynthesis protein PurH | 1.45e-02 | NA | NA | 0.491 |
| 6. F | A5VHU2 | Bifunctional purine biosynthesis protein PurH | 6.56e-03 | NA | NA | 0.5203 |
| 6. F | Q72IF6 | tRNA(Ile)-lysidine synthase | 8.02e-03 | NA | NA | 0.5899 |
| 6. F | A8FM07 | Bifunctional purine biosynthesis protein PurH | 9.30e-03 | NA | NA | 0.492 |
| 6. F | A4XQ60 | Bifunctional purine biosynthesis protein PurH | 1.82e-02 | NA | NA | 0.4916 |
| 6. F | Q5FIV5 | Bifunctional purine biosynthesis protein PurH | 7.81e-03 | NA | NA | 0.4705 |
| 6. F | Q9RV23 | tRNA(Ile)-lysidine synthase | 1.27e-02 | NA | NA | 0.4698 |
| 6. F | A6TLS7 | Bifunctional purine biosynthesis protein PurH | 8.20e-03 | NA | NA | 0.517 |
| 6. F | Q1WBT4 | DNA dC->dU-editing enzyme APOBEC-3H | 6.44e-04 | NA | NA | 0.4379 |
| 6. F | A3MP76 | Bifunctional purine biosynthesis protein PurH | 9.09e-03 | NA | NA | 0.4825 |
| 6. F | A2S597 | Bifunctional purine biosynthesis protein PurH | 9.09e-03 | NA | NA | 0.4823 |
| 6. F | B2A5W1 | Bifunctional purine biosynthesis protein PurH | 9.37e-03 | NA | NA | 0.5288 |
| 6. F | A1V068 | Bifunctional purine biosynthesis protein PurH | 8.55e-03 | NA | NA | 0.4829 |
| 6. F | Q03MZ6 | Bifunctional purine biosynthesis protein PurH | 9.41e-03 | NA | NA | 0.481 |
| 6. F | B1I7V8 | Bifunctional purine biosynthesis protein PurH | 1.01e-02 | NA | NA | 0.4667 |
| 6. F | Q1BZ33 | Bifunctional purine biosynthesis protein PurH | 8.23e-03 | NA | NA | 0.4638 |
| 6. F | A3NDF2 | Bifunctional purine biosynthesis protein PurH | 8.85e-03 | NA | NA | 0.4828 |
| 6. F | Q5HUK6 | Bifunctional purine biosynthesis protein PurH | 9.48e-03 | NA | NA | 0.4919 |
| 6. F | A2RJY0 | Bifunctional purine biosynthesis protein PurH | 5.63e-03 | NA | NA | 0.4655 |
| 6. F | B3ELV3 | Bifunctional purine biosynthesis protein PurH | 1.53e-02 | NA | NA | 0.4618 |
| 6. F | Q1LRB3 | Bifunctional purine biosynthesis protein PurH | 8.85e-03 | NA | NA | 0.4668 |
| 6. F | Q1H4G7 | Bifunctional purine biosynthesis protein PurH | 1.03e-02 | NA | NA | 0.4973 |
| 6. F | B5EL42 | Bifunctional purine biosynthesis protein PurH | 1.38e-02 | NA | NA | 0.5045 |
| 6. F | B4UJ61 | Bifunctional purine biosynthesis protein PurH | 7.65e-03 | NA | NA | 0.4732 |
| 6. F | Q2IKQ7 | Bifunctional purine biosynthesis protein PurH | 6.67e-03 | NA | NA | 0.4778 |
| 6. F | Q1WU55 | Bifunctional purine biosynthesis protein PurH | 6.31e-03 | NA | NA | 0.513 |
| 6. F | Q03Y85 | Bifunctional purine biosynthesis protein PurH | 7.76e-03 | NA | NA | 0.4833 |
| 6. F | B8JHC9 | Bifunctional purine biosynthesis protein PurH | 8.02e-03 | NA | NA | 0.4841 |
| 6. F | A1VZU4 | Bifunctional purine biosynthesis protein PurH | 9.78e-03 | NA | NA | 0.4949 |
| 6. F | B9MS89 | Bifunctional purine biosynthesis protein PurH | 6.56e-03 | NA | NA | 0.5153 |
| 6. F | Q9PLJ6 | Riboflavin biosynthesis protein RibD | 2.32e-06 | NA | NA | 0.653 |
| 6. F | Q89B23 | Bifunctional purine biosynthesis protein PurH | 1.21e-02 | NA | NA | 0.4998 |
| 6. F | A7GYY6 | Bifunctional purine biosynthesis protein PurH | 1.03e-02 | NA | NA | 0.5081 |
| 6. F | A0LDB0 | Bifunctional purine biosynthesis protein PurH | 1.25e-02 | NA | NA | 0.4396 |
| 6. F | A8MLI9 | Bifunctional purine biosynthesis protein PurH | 7.66e-03 | NA | NA | 0.5223 |
| 6. F | Q8Y232 | Bifunctional purine biosynthesis protein PurH | 1.63e-02 | NA | NA | 0.4764 |
| 6. F | B2AH76 | Bifunctional purine biosynthesis protein PurH | 8.91e-03 | NA | NA | 0.4674 |
| 6. F | A7HA60 | Bifunctional purine biosynthesis protein PurH | 6.73e-03 | NA | NA | 0.4843 |
| 6. F | Q0KEC0 | Bifunctional purine biosynthesis protein PurH | 8.56e-03 | NA | NA | 0.4744 |
| 6. F | B2G5C2 | Bifunctional purine biosynthesis protein PurH | 6.19e-03 | NA | NA | 0.4863 |
| 6. F | B4EES4 | Bifunctional purine biosynthesis protein PurH | 7.95e-03 | NA | NA | 0.4897 |
| 6. F | Q9PNY2 | Bifunctional purine biosynthesis protein PurH | 8.99e-03 | NA | NA | 0.4947 |
| 6. F | A7ZCZ7 | Bifunctional purine biosynthesis protein PurH | 9.93e-03 | NA | NA | 0.4919 |
| 7. B | O24750 | Riboflavin biosynthesis protein RibD | 2.76e-05 | NA | 4.58e-04 | NA |
| 7. B | O43012 | Deoxycytidylate deaminase | 3.91e-09 | NA | 7.68e-11 | NA |
| 7. B | P70814 | Riboflavin biosynthesis protein RibD | 3.51e-06 | NA | 2.23e-07 | NA |
| 7. B | P06773 | Deoxycytidylate deaminase | 7.37e-10 | NA | 1.11e-13 | NA |
| 7. B | Q5U3U4 | Cytidine and dCMP deaminase domain-containing protein 1 | 1.21e-08 | NA | 8.18e-14 | NA |
| 7. B | O66534 | Riboflavin biosynthesis protein RibD | 8.59e-06 | NA | 4.86e-05 | NA |
| 7. B | Q8BMD5 | Cytidine and dCMP deaminase domain-containing protein 1 | 2.29e-06 | NA | 9.72e-12 | NA |
| 7. B | Q9BWV3 | Cytidine and dCMP deaminase domain-containing protein 1 | 1.47e-06 | NA | 6.13e-11 | NA |