Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54837.1
JCVISYN3A_0521

Cell division protein.
M. mycoides homolog: Q6MT26.
TIGRfam Classification: NA.
Category: Nonessential.

Statistics

Total GO Annotation: 8
Unique PROST Go: 2
Unique BLAST Go: 0
Unique Foldseek Go: 1

Total Homologs: 239
Unique PROST Homologs: 3
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: NA
Zhang et al. [4]: GO:0000917|barrier septum assembly
Bianchi et al. [5]: Cell division protein sepF-like

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was A6LTT3 (Cell division protein SepF) with a FATCAT P-Value: 3.09e-08 and RMSD of 2.09 angstrom. The sequence alignment identity is 27.6%.
Structural alignment shown in left. Query protein AVX54837.1 colored as red in alignment, homolog A6LTT3 colored as blue. Query protein AVX54837.1 is also shown in right top, homolog A6LTT3 showed in right bottom. They are colored based on secondary structures. 

  AVX54837.1 M--FFKKKKNF--F----KQNEQDQDQIELELTDSDIFEQESPVLKDSYTQTSNQFNQN-HQTNTSNMNQTDMNKSPINTYVFSPMKFSEVQSIVDTLLD 91
      A6LTT3 MGNVISKVKSLLGFEDYEEYDEYEEEQYEEQVKDED--EIE-PVI----TNKKNSKVVNIHTSSTTKV--T-ITK-PID-Y-------EEATEICEALKN 81

  AVX54837.1 QKVVVVDFKNLDDNKAKRFKDFLSGVLY--------IKKGEYIRL--------NE--N-I-YKFIIN--- 138
      A6LTT3 RRIVLVNTTVLELKIAQRLLDFISGSCYALGGELQQIEKGVYI-LSPSNVEVTNELKNELSSKALFNWSK 150

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0043093 FtsZ-dependent cytokinesis
1. PBF GO:0000917 division septum assembly
1. PBF GO:0030428 cell septum
1. PBF GO:0005737 cytoplasm
4. PB GO:0005886 plasma membrane
5. P GO:0000419 RNA polymerase V complex
5. P GO:0005736 RNA polymerase I complex
6. F GO:0009842 cyanelle

Uniprot GO Annotations

GO Description
GO:0000917 division septum assembly
GO:0090529 cell septum assembly
GO:0005737 cytoplasm
GO:0051301 cell division
GO:0007049 cell cycle

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF B8ZM59 Cell division protein SepF 4.81e-07 1.75e-15 0.003 0.4961
1. PBF B1I726 Cell division protein SepF 1.50e-07 2.45e-16 0.003 0.5202
1. PBF Q3K2N8 Cell division protein SepF 1.87e-06 4.88e-17 0.004 0.5081
1. PBF Q73YR4 Cell division protein SepF 5.12e-05 2.15e-10 0.012 0.4874
1. PBF C3P669 Cell division protein SepF 6.01e-06 3.72e-16 6.80e-06 0.6734
1. PBF Q83G21 Cell division protein SepF 2.14e-05 1.60e-02 3.31e-04 0.8469
1. PBF A0R008 Cell division protein SepF 1.15e-04 5.87e-10 0.006 0.4776
1. PBF Q636C7 Cell division protein SepF 6.34e-06 1.85e-16 6.66e-06 0.6736
1. PBF A7FQ31 Cell division protein SepF 6.81e-07 9.32e-10 0.005 0.5983
1. PBF A4J2E9 Cell division protein SepF 1 2.37e-07 3.17e-07 1.80e-06 0.8381
1. PBF Q5HQ03 Cell division protein SepF 5.40e-05 1.31e-25 7.22e-07 0.503
1. PBF Q38XM4 Cell division protein SepF 9.65e-07 1.14e-06 2.59e-05 0.557
1. PBF A4VZU7 Cell division protein SepF 9.30e-07 2.52e-16 0.006 0.4882
1. PBF Q9K9U6 Cell division protein SepF 1.05e-06 3.11e-18 1.87e-06 0.5807
1. PBF Q5M0C9 Cell division protein SepF 2.04e-06 3.72e-16 2.78e-05 0.5138
1. PBF Q6HER5 Cell division protein SepF 8.96e-06 1.85e-16 6.66e-06 0.6731
1. PBF Q1JAU1 Cell division protein SepF 3.96e-05 2.98e-13 4.84e-04 0.508
1. PBF B7HM19 Cell division protein SepF 7.17e-06 5.95e-15 5.77e-06 0.6728
1. PBF B3WDY6 Cell division protein SepF 5.63e-06 3.82e-12 7.50e-06 0.5873
1. PBF B8DBQ3 Cell division protein SepF 2.42e-06 7.33e-16 1.49e-05 0.5556
1. PBF A1TAW2 Cell division protein SepF 3.87e-05 3.40e-10 0.014 0.5008
1. PBF A5GR64 Cell division protein SepF 6.57e-06 2.28e-02 6.22e-04 0.5268
1. PBF Q7A133 Cell division protein SepF 9.39e-06 1.00e-20 1.35e-07 0.5062
1. PBF B0K8R2 Cell division protein SepF 3.27e-06 8.33e-11 6.59e-07 0.6707
1. PBF A1UI48 Cell division protein SepF 1.58e-04 3.36e-09 0.003 0.4983
1. PBF Q8DVD7 Cell division protein SepF 4.52e-06 3.03e-17 0.001 0.4872
1. PBF Q2RK63 Cell division protein SepF 2.07e-07 4.13e-07 0.026 0.6296
1. PBF B1MP43 Cell division protein SepF 1.03e-04 1.57e-12 0.027 0.4798
1. PBF Q812W8 Cell division protein SepF 6.66e-06 4.99e-16 7.15e-06 0.6462
1. PBF Q74JY0 Cell division protein SepF 8.63e-08 2.04e-17 1.72e-08 0.5152
1. PBF Q9ZHA2 Cell division protein SepF 2.57e-05 1.00e-20 1.35e-07 0.5012
1. PBF A1SL74 Cell division protein SepF 2.90e-06 1.27e-16 0.005 0.5176
1. PBF C1KWY3 Cell division protein SepF 1.21e-05 7.33e-16 1.49e-05 0.5722
1. PBF Q8ER44 Cell division protein SepF 1.86e-06 5.87e-12 2.75e-08 0.6586
1. PBF Q0SRX1 Cell division protein SepF 1.80e-06 9.56e-10 0.023 0.5933
1. PBF Q8P066 Cell division protein SepF 3.02e-05 2.98e-13 4.84e-04 0.4999
1. PBF Q3M925 Cell division protein SepF 2.43e-06 3.32e-06 7.06e-05 0.4766
1. PBF A5I1U5 Cell division protein SepF 1.42e-06 9.32e-10 0.005 0.6096
1. PBF B8ZQQ6 Cell division protein SepF 1.58e-05 2.43e-08 0.008 0.4996
1. PBF C3L726 Cell division protein SepF 4.71e-07 3.72e-16 6.80e-06 0.6788
1. PBF P0CB77 Cell division protein SepF 9.73e-06 1.78e-15 0.003 0.5141
1. PBF A4IM21 Cell division protein SepF 4.65e-07 2.36e-09 4.71e-05 0.6332
1. PBF Q83I43 Cell division protein SepF 9.25e-03 1.60e-02 3.31e-04 0.8476
1. PBF B2G6K9 Cell division protein SepF 1.57e-06 6.68e-09 3.51e-07 0.5832
1. PBF A8MH65 Cell division protein SepF 2.78e-06 9.90e-11 1.32e-05 0.6215
1. PBF B0S115 Cell division protein SepF 4.54e-06 6.61e-20 5.85e-04 0.544
1. PBF Q1WTA4 Cell division protein SepF 4.56e-06 9.07e-21 1.09e-08 0.5613
1. PBF Q5HGP2 Cell division protein SepF 3.98e-05 1.00e-20 1.35e-07 0.4979
1. PBF Q1B6X7 Cell division protein SepF 1.01e-04 3.36e-09 0.003 0.4988
1. PBF B8HPI0 Cell division protein SepF 8.39e-06 1.62e-11 1.76e-05 0.4771
1. PBF C4L5V1 Cell division protein SepF 1.82e-06 1.06e-20 0.001 0.5971
1. PBF Q8E181 Cell division protein SepF 3.86e-06 4.03e-18 0.004 0.4857
1. PBF A0AKD0 Cell division protein SepF 2.70e-06 1.12e-15 1.84e-06 0.5709
1. PBF Q732H0 Cell division protein SepF 1.71e-04 5.95e-15 5.77e-06 0.649
1. PBF A9KKZ0 Cell division protein SepF 2.82e-05 1.23e-16 9.22e-05 0.5947
1. PBF A4VTL1 Cell division protein SepF 2.77e-06 2.52e-16 0.006 0.9038
1. PBF A8Z3M7 Cell division protein SepF 2.14e-06 1.00e-20 1.35e-07 0.5062
1. PBF Q88V85 Cell division protein SepF 1.01e-06 1.20e-12 1.60e-07 0.5351
1. PBF Q8R9K8 Cell division protein SepF 5.81e-08 1.90e-08 4.98e-07 0.8937
1. PBF B7IUQ9 Cell division protein SepF 3.31e-06 4.99e-16 7.15e-06 0.6885
1. PBF A5VJ37 Cell division protein SepF 3.42e-07 6.68e-09 3.51e-07 0.621
1. PBF Q8DJK7 Cell division protein SepF 4.74e-06 5.02e-10 1.30e-04 0.492
1. PBF A0LTN7 Cell division protein SepF 8.19e-06 1.63e-17 1.26e-04 0.5257
1. PBF A0QF59 Cell division protein SepF 1.82e-04 9.39e-11 0.013 0.4872
1. PBF Q2JD44 Cell division protein SepF 2.21e-05 5.22e-20 0.048 0.5395
1. PBF Q894C6 Cell division protein SepF 1.20e-05 5.86e-15 0.001 0.6083
1. PBF Q7A615 Cell division protein SepF 3.09e-05 1.00e-20 1.35e-07 0.4976
1. PBF A3Q1L2 Cell division protein SepF 2.58e-05 3.36e-09 0.003 0.484
1. PBF Q03W39 Cell division protein SepF 3.29e-06 6.23e-18 5.25e-08 0.5727
1. PBF B8I754 Cell division protein SepF 3.35e-06 1.74e-14 0.002 0.5544
1. PBF Q24TG6 Cell division protein SepF 3.26e-07 1.89e-10 1.61e-07 0.6292
1. PBF A3CLP1 Cell division protein SepF 1.16e-05 1.07e-16 3.70e-04 0.4907
1. PBF Q48SL4 Cell division protein SepF 4.50e-05 2.98e-13 4.84e-04 0.5089
1. PBF Q9CCE1 Cell division protein SepF 5.20e-05 2.43e-08 0.008 0.4972
1. PBF Q04B68 Cell division protein SepF 8.54e-08 7.67e-15 2.13e-10 0.613
1. PBF Q0TPA4 Cell division protein SepF 1.83e-06 9.56e-10 0.023 0.5513
1. PBF Q71XY3 Cell division protein SepF 2.30e-06 7.33e-16 1.49e-05 0.5307
1. PBF A2RDL5 Cell division protein SepF 1.12e-04 9.17e-13 4.65e-04 0.5085
1. PBF Q836V4 Cell division protein SepF 4.47e-06 2.94e-17 8.87e-08 0.5051
1. PBF C1CM03 Cell division protein SepF 1.47e-06 1.53e-15 0.003 0.5143
1. PBF Q04ET4 Cell division protein SepF 8.29e-06 6.41e-15 2.23e-06 0.52
1. PBF C1CSS9 Cell division protein SepF 1.54e-05 1.78e-15 0.003 0.514
1. PBF P73376 Cell division protein SepF 1.72e-06 1.24e-08 8.20e-06 0.5113
1. PBF B1XQL0 Cell division protein SepF 7.44e-06 1.25e-05 7.22e-07 0.5069
1. PBF Q10V94 Cell division protein SepF 4.44e-06 2.03e-09 9.81e-05 0.4831
1. PBF A6U109 Cell division protein SepF 9.96e-06 1.00e-20 1.35e-07 0.5081
1. PBF C5D8N8 Cell division protein SepF 7.34e-08 4.48e-09 9.95e-06 0.6264
1. PBF B7H6N5 Cell division protein SepF 5.87e-04 4.99e-16 7.15e-06 0.6846
1. PBF C0MD49 Cell division protein SepF 1.04e-05 1.57e-10 9.92e-05 0.4833
1. PBF A0RHS0 Cell division protein SepF 3.45e-07 1.85e-16 6.66e-06 0.6954
1. PBF C1FMF8 Cell division protein SepF 5.56e-07 1.79e-09 0.005 0.5493
1. PBF Q6GA23 Cell division protein SepF 3.69e-05 1.00e-20 1.35e-07 0.5084
1. PBF Q3AAH3 Cell division protein SepF 1.83e-06 5.84e-07 1.22e-07 0.9025
1. PBF A7Z4F9 Cell division protein SepF 1.04e-06 2.70e-20 3.99e-07 0.5559
1. PBF Q7TYZ5 Cell division protein SepF 3.29e-05 2.54e-07 0.012 0.4809
1. PBF Q8Y5M7 Cell division protein SepF 5.49e-06 7.33e-16 1.49e-05 0.5554
1. PBF A5U4H4 Cell division protein SepF 1.25e-04 2.54e-07 0.012 0.4814
1. PBF Q4L5P0 Cell division protein SepF 1.37e-05 2.22e-25 2.40e-07 0.5073
1. PBF Q1JKZ0 Cell division protein SepF 2.18e-05 2.98e-13 4.84e-04 0.4635
1. PBF A8FD04 Cell division protein SepF 1.66e-06 8.50e-20 5.85e-09 0.637
1. PBF A4J451 Cell division protein SepF 2 1.64e-06 1.42e-05 1.87e-05 0.6162
1. PBF Q5WFH9 Cell division protein SepF 1.80e-06 4.51e-18 1.16e-04 0.5144
1. PBF Q1J5T2 Cell division protein SepF 1.82e-05 1.65e-13 4.79e-04 0.5089
1. PBF B2HGR0 Cell division protein SepF 4.85e-05 3.49e-08 0.014 0.4722
1. PBF A0PTI1 Cell division protein SepF 8.79e-05 4.90e-08 0.014 0.4722
1. PBF C4ZA36 Cell division protein SepF 1.47e-05 1.25e-20 0.017 0.4978
1. PBF B9E0W7 Cell division protein SepF 4.28e-06 5.87e-10 0.001 0.6041
1. PBF B1YIT1 Cell division protein SepF 1.41e-05 8.22e-20 0.005 0.5134
1. PBF Q5L0W3 Cell division protein SepF 4.54e-07 5.22e-10 5.00e-05 0.6313
1. PBF A4TBE2 Cell division protein SepF 3.60e-05 2.48e-09 0.015 0.488
1. PBF A3DDJ7 Cell division protein SepF 4.57e-06 2.02e-14 0.015 0.5741
1. PBF Q7NMR2 Cell division protein SepF 1.15e-06 4.16e-11 6.64e-05 0.6201
1. PBF A8YUP3 Cell division protein SepF 1.20e-06 1.39e-13 8.84e-09 0.5905
1. PBF Q6A9P7 Cell division protein SepF 1.34e-05 4.82e-15 0.012 0.4784
1. PBF Q99US7 Cell division protein SepF 4.43e-06 1.00e-20 1.35e-07 0.4952
1. PBF A4XKQ8 Cell division protein SepF 6.28e-07 1.16e-09 0.011 0.6403
1. PBF B2J1K8 Cell division protein SepF 4.44e-06 1.12e-06 3.79e-05 0.5203
1. PBF Q929Y7 Cell division protein SepF 2.55e-06 4.54e-15 1.82e-06 0.5982
1. PBF Q48XR0 Cell division protein SepF 2.95e-05 9.17e-13 4.65e-04 0.5089
1. PBF A5D186 Cell division protein SepF 5.21e-06 5.45e-08 2.75e-06 0.6258
1. PBF A1KKJ0 Cell division protein SepF 5.17e-05 2.54e-07 0.012 0.4722
1. PBF A9VU61 Cell division protein SepF 4.84e-06 7.70e-17 9.90e-05 0.672
1. PBF B0K2W6 Cell division protein SepF 5.47e-06 8.33e-11 6.59e-07 0.6241
1. PBF A8AW20 Cell division protein SepF 4.30e-05 9.43e-19 2.71e-04 0.5317
1. PBF Q2YXF5 Cell division protein SepF 2.48e-06 1.00e-20 1.35e-07 0.5076
1. PBF B5E714 Cell division protein SepF 1.02e-05 1.78e-15 0.003 0.5145
1. PBF B7KEI7 Cell division protein SepF 3.19e-06 1.03e-06 9.60e-06 0.5265
1. PBF Q04JA5 Cell division protein SepF 8.72e-07 1.75e-15 0.003 0.5147
1. PBF A6TRY5 Cell division protein SepF 3.42e-06 1.03e-06 1.91e-06 0.6294
1. PBF Q5XB10 Cell division protein SepF 3.30e-05 9.17e-13 4.65e-04 0.508
1. PBF Q2FHP8 Cell division protein SepF 5.47e-06 1.00e-20 1.35e-07 0.4975
1. PBF Q8YZH3 Cell division protein SepF 1.45e-06 1.02e-05 7.34e-05 0.4819
1. PBF Q042Q3 Cell division protein SepF 1.87e-06 6.48e-16 2.14e-08 0.6095
1. PBF A5IS75 Cell division protein SepF 4.37e-06 1.00e-20 1.35e-07 0.506
1. PBF A0Q067 Cell division protein SepF 6.51e-07 1.91e-10 5.90e-04 0.6059
1. PBF Q65JW1 Cell division protein SepF 3.46e-07 9.28e-19 1.06e-06 0.5358
1. PBF Q5M4X6 Cell division protein SepF 2.87e-06 3.72e-16 2.78e-05 0.5134
1. PBF P0DF68 Cell division protein SepF 3.19e-05 2.98e-13 4.84e-04 0.5085
1. PBF A6QG89 Cell division protein SepF 1.15e-05 1.00e-20 1.35e-07 0.4998
1. PBF Q1JG16 Cell division protein SepF 5.03e-05 2.53e-11 4.56e-04 0.5082
1. PBF Q9S2X2 Cell division protein SepF 2 6.90e-06 1.19e-13 0.014 0.5651
1. PBF Q039R3 Cell division protein SepF 1.97e-06 3.82e-12 7.50e-06 0.5922
1. PBF B9EB57 Cell division protein SepF 3.36e-06 5.95e-19 2.57e-07 0.4906
1. PBF C1C8Q3 Cell division protein SepF 8.77e-06 1.75e-15 0.003 0.5677
1. PBF O31728 Cell division protein SepF 5.73e-07 6.53e-18 4.19e-07 0.5885
1. PBF Q8E6N5 Cell division protein SepF 5.00e-06 1.44e-15 0.003 0.4897
1. PBF C1EPR3 Cell division protein SepF 4.84e-06 1.85e-16 6.66e-06 0.674
1. PBF B2IRR9 Cell division protein SepF 3.46e-07 1.75e-15 0.003 0.5036
1. PBF P9WGJ4 Cell division protein SepF 2.23e-04 2.54e-07 0.012 0.4725
1. PBF Q03L92 Cell division protein SepF 3.19e-06 6.79e-17 3.15e-04 0.5113
1. PBF Q81WE0 Cell division protein SepF 6.03e-06 3.72e-16 6.80e-06 0.6741
1. PBF Q97H93 Cell division protein SepF 6.80e-07 4.58e-12 3.29e-06 0.5854
1. PBF B7JJY6 Cell division protein SepF 6.03e-06 1.85e-16 6.66e-06 0.6727
1. PBF C0ZG90 Cell division protein SepF 7.16e-07 2.37e-14 4.37e-06 0.5999
1. PBF C1CFN5 Cell division protein SepF 4.65e-06 5.27e-15 0.003 0.5346
1. PBF Q6GHP6 Cell division protein SepF 1.56e-06 4.48e-21 1.25e-07 0.4971
1. PBF A7X1D2 Cell division protein SepF 4.00e-05 1.00e-20 1.35e-07 0.4977
1. PBF P0DF69 Cell division protein SepF 2.20e-05 2.98e-13 4.84e-04 0.4998
1. PBF B9IVX6 Cell division protein SepF 4.34e-04 5.95e-15 5.77e-06 0.6727
1. PBF Q03QH9 Cell division protein SepF 4.50e-08 1.85e-14 2.65e-08 0.5307
1. PBF Q49WX1 Cell division protein SepF 7.14e-05 5.49e-20 1.18e-07 0.5072
1. PBF B7GFB6 Cell division protein SepF 9.62e-07 3.22e-11 1.73e-07 0.6329
1. PBF B2A2I4 Cell division protein SepF 6.10e-06 4.34e-15 0.004 0.5591
1. PBF Q1GAT1 Cell division protein SepF 1.29e-06 9.60e-17 1.95e-10 0.5644
1. PBF A7GDF4 Cell division protein SepF 2.66e-05 9.32e-10 0.005 0.6073
1. PBF Q82AD2 Cell division protein SepF 2 2.54e-06 1.69e-14 0.015 0.5526
1. PBF C3KVA2 Cell division protein SepF 2.56e-05 9.32e-10 0.005 0.6348
1. PBF A7GRM4 Cell division protein SepF 8.79e-07 8.74e-14 2.05e-05 0.6937
1. PBF Q3AI17 Cell division protein SepF 3.71e-06 1.16e-02 7.92e-04 0.526
1. PBF C0M6J7 Cell division protein SepF 3.18e-05 1.57e-10 9.92e-05 0.4835
1. PBF Q5FKU8 Cell division protein SepF 8.92e-06 8.74e-14 3.95e-08 0.6017
1. PBF B0TGN6 Cell division protein SepF 1.64e-05 2.90e-13 1.33e-06 0.5649
1. PBF Q8DNW1 Cell division protein SepF 6.52e-07 1.75e-15 0.003 0.5147
1. PBF Q8XJA8 Cell division protein SepF 2.12e-06 9.56e-10 0.023 0.5941
1. PBF B9DUV1 Cell division protein SepF 3.08e-05 3.14e-20 3.64e-04 0.5021
2. PF Q9CEH4 Cell division protein SepF 7.73e-05 2.25e-21 NA 0.4873
2. PF A1R5G4 Cell division protein SepF 1.97e-03 7.95e-20 NA 0.4962
2. PF C5CA24 Cell division protein SepF 1.21e-05 1.75e-11 NA 0.5132
2. PF Q02WY3 Cell division protein SepF 2.75e-05 1.37e-20 NA 0.4959
2. PF Q1AVY0 Cell division protein SepF 1.98e-04 1.18e-16 NA 0.5191
2. PF B2GB82 Cell division protein SepF 2.66e-05 1.79e-14 NA 0.5353
2. PF Q828W8 Cell division protein SepF 3 1.31e-05 1.53e-07 NA 0.5997
2. PF Q47QW3 Cell division protein SepF 5.34e-07 1.01e-15 NA 0.508
2. PF A6WCW8 Cell division protein SepF 1.15e-05 1.57e-18 NA 0.5028
2. PF Q5YYX3 Cell division protein SepF 2.46e-05 2.78e-03 NA 0.8964
2. PF C4Z0N9 Cell division protein SepF 8.79e-06 1.48e-12 NA 0.4796
2. PF Q182V6 Cell division protein SepF 1.13e-06 4.20e-13 NA 0.5894
2. PF A5CS46 Cell division protein SepF 2.74e-06 1.58e-17 NA 0.5276
2. PF A9WRD2 Cell division protein SepF 5.42e-07 3.44e-17 NA 0.5006
2. PF C1A0W9 Cell division protein SepF 5.79e-05 7.21e-16 NA 0.4812
2. PF B7GQ24 Cell division protein SepF 6.55e-06 3.26e-15 NA 0.5292
2. PF B9MRZ1 Cell division protein SepF 7.70e-08 2.51e-09 NA 0.6411
2. PF C1AU49 Cell division protein SepF 6.09e-05 5.89e-11 NA 0.6488
2. PF Q6AE69 Cell division protein SepF 4.81e-05 5.30e-18 NA 0.5036
2. PF Q9EWX7 Cell division protein SepF 1 2.70e-06 1.64e-08 NA 0.6375
2. PF B8DSX3 Cell division protein SepF 1.01e-05 2.03e-16 NA 0.5008
2. PF Q0RNN4 Cell division protein SepF 2.09e-06 1.54e-18 NA 0.5212
2. PF Q0SHS7 Cell division protein SepF 4.93e-05 1.28e-11 NA 0.4886
2. PF A1A2I3 Cell division protein SepF 9.50e-07 1.75e-15 NA 0.5249
2. PF A4FLU1 Cell division protein SepF 4.29e-05 1.04e-11 NA 0.4793
2. PF B0RIJ8 Cell division protein SepF 7.05e-04 7.31e-18 NA 0.5202
2. PF A8LX76 Cell division protein SepF 7.00e-06 4.51e-13 NA 0.4956
2. PF B3DQ84 Cell division protein SepF 7.30e-06 3.26e-15 NA 0.5293
2. PF Q93JG0 Cell division protein SepF 3 1.60e-05 1.04e-02 NA 0.931
2. PF A0JVA0 Cell division protein SepF 6.61e-06 4.72e-21 NA 0.4913
2. PF Q9ZAI9 Cell division protein SepF 2.37e-05 2.84e-20 NA 0.4937
2. PF A6LTT3 Cell division protein SepF 3.09e-08 3.69e-11 NA 0.5294
2. PF Q8G7W6 Cell division protein SepF 3.86e-05 3.26e-15 NA 0.5037
2. PF B8HGX6 Cell division protein SepF 5.44e-06 3.85e-20 NA 0.4915
2. PF B2GJP2 Cell division protein SepF 1.83e-05 1.33e-15 NA 0.4757
2. PF B5Y7T0 Cell division protein SepF 4.48e-06 8.22e-11 NA 0.5628
3. BF Q2JKS7 Cell division protein SepF 5.45e-06 NA 4.21e-05 0.5323
3. BF A2BV55 Cell division protein SepF 2.64e-06 NA 9.06e-05 0.52
3. BF A9BE13 Cell division protein SepF 2.05e-05 NA 5.01e-04 0.5262
3. BF A2BPM3 Cell division protein SepF 6.44e-06 NA 2.26e-04 0.5376
3. BF Q67Q30 Cell division protein SepF 4.49e-07 NA 3.76e-06 0.6184
3. BF Q2JW12 Cell division protein SepF 9.90e-05 NA 3.82e-05 0.482
3. BF Q7VDI4 Cell division protein SepF 3.49e-06 NA 0.001 0.5322
3. BF Q7V8W6 Cell division protein SepF 8.63e-07 NA 0.005 0.5059
3. BF A2C0K1 Cell division protein SepF 2.15e-06 NA 6.18e-04 0.5395
3. BF A5GJ83 Cell division protein SepF 1.81e-05 NA 2.87e-04 0.5271
3. BF Q31LI0 Cell division protein SepF 9.92e-06 NA 2.08e-04 0.5303
3. BF Q46H16 Cell division protein SepF 1.07e-06 NA 0.001 0.5403
3. BF A2CBM2 Cell division protein SepF 1.08e-04 NA 0.006 0.5242
3. BF Q7V2S2 Cell division protein SepF 1.46e-06 NA 3.06e-05 0.5407
3. BF Q0AYD5 Cell division protein SepF 4.37e-07 NA 2.87e-05 0.6069
3. BF Q7U8F8 Cell division protein SepF 9.30e-06 NA 0.005 0.5241
3. BF A3PBB3 Cell division protein SepF 4.90e-07 NA 2.52e-04 0.5287
3. BF A8G3A7 Cell division protein SepF 2.56e-06 NA 2.30e-04 0.7708
3. BF Q3AZ61 Cell division protein SepF 5.77e-06 NA 0.001 0.524
3. BF Q31CE3 Cell division protein SepF 2.87e-06 NA 2.23e-04 0.531
3. BF Q5N0E6 Cell division protein SepF 9.37e-06 NA 2.08e-04 0.5174
4. PB Q2FZ86 Cell division protein SepF 4.22e-06 1.00e-20 1.35e-07 NA
4. PB P9WGJ5 Cell division protein SepF 1.05e-04 2.54e-07 0.012 NA
5. P Q9ZDU9 Uncharacterized protein RP225 2.91e-01 1.81e-02 NA NA
5. P Q9SJ96 DNA-directed RNA polymerases II and V subunit 6B 9.03e-02 2.05e-02 NA NA
5. P Q58449 Uncharacterized protein MJ1049 7.54e-06 5.97e-20 NA NA
6. F P48326 Cell division protein sepF homolog 1.59e-07 NA NA 0.7737
6. F Q82KP4 Cell division protein SepF 1 5.13e-06 NA NA 0.8797