Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54838.1
JCVISYN3A_0522
Cell division protein.
M. mycoides homolog: Q6MT25.
TIGRfam Classification: NA.
Category: Nonessential.
Statistics
Total GO Annotation: 70
Unique PROST Go: 9
Unique BLAST Go: 9
Unique Foldseek Go: 31
Total Homologs: 266
Unique PROST Homologs: 67
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 87
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P45500
(Cell division protein FtsZ) with a FATCAT P-Value: 0 and RMSD of 2.17 angstrom. The sequence alignment identity is 46.4%.
Structural alignment shown in left. Query protein AVX54838.1 colored as red in alignment, homolog P45500 colored as blue.
Query protein AVX54838.1 is also shown in right top, homolog P45500 showed in right bottom. They are colored based on secondary structures.
AVX54838.1 MTNEFKQIARIKVLGVGGAGNNAIRRMFEENVQGVEFYIINTDAQILESSPVPNKIILGEKTTKGLGAGGNPEVGKAAAIESEEELRKVVEGADLIFIAA 100 P45500 MAAPQNYLAVIKVIGVGGGGVNAINRMIEVGLKGVEFIAINTDAQALLMSDADVKLDVGRELTRGLGAGANPAVGRKAAEDHREEIEEVLKGADMVFVTA 100 AVX54838.1 GMGGGTGTGAAPVIAKIAQESGALVIGIVTKPFIFEGRHR-NVNAKEGLEELRKHVDSVIVVSNDKLLEYIGS--IPIAESFKEADTILKQGVQTITDLI 197 P45500 GEGGGTGTGGAPVVANIARSLGALTIGVVTRPFTFEGRRRAN-QAEDGIAELREEVDTLIVIPNDRLL-SISDRQVSVLDAFKSADQVLLSGVQGITDLI 198 AVX54838.1 AVPATINLDFADVKSVMSKKGNALFGIGVASGKDKAVEAAKEAINSKLLEASIEGAKDIIVNITGGRTVSLNDAYDAVGVISQAVNNKELNIVFGMAIND 297 P45500 TTPGLINLDFADVKSVMSEAGSALMGIGSARGDDRAVAAAEMAISSPLLEASIDGARGVLLSISGGSDLGLFEINEAAQLVSEAA-HPEANIIFG-AVID 296 AVX54838.1 D-LTDDDEIIVTVIATGFENKNLQNQEPNII-----K----TPRVEPVVQQTQPS-------KPVQQEQEEEQEEVDE--FDDEMS---L----TTTDDT 371 P45500 DAL--GDEVRVTVIAAGFDGGQPPSKRDNVLGSSSAKREEPTP-ARP--SESRPSFGSLGSVKP---KEEPEPAPVPEPVADLPVSPPPVPPSRTYSDSA 388 AVX54838.1 EEDFNDDDFPTFLK 385 P45500 AEEL---DVPDFLK 399
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0000917 | division septum assembly |
| 1. PBF | GO:0090529 | cell septum assembly |
| 1. PBF | GO:0051258 | protein polymerization |
| 1. PBF | GO:0032153 | cell division site |
| 1. PBF | GO:0005874 | microtubule |
| 1. PBF | GO:0003924 | GTPase activity |
| 1. PBF | GO:0032506 | cytokinetic process |
| 1. PBF | GO:0043093 | FtsZ-dependent cytokinesis |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0051301 | cell division |
| 1. PBF | GO:0007017 | microtubule-based process |
| 1. PBF | GO:0008360 | regulation of cell shape |
| 1. PBF | GO:0005525 | GTP binding |
| 2. PF | GO:0030541 | plasmid partitioning |
| 2. PF | GO:0046872 | metal ion binding |
| 4. PB | GO:0043572 | plastid fission |
| 4. PB | GO:0010020 | chloroplast fission |
| 4. PB | GO:0048285 | organelle fission |
| 4. PB | GO:0005886 | plasma membrane |
| 4. PB | GO:0000935 | division septum |
| 4. PB | GO:0009902 | chloroplast relocation |
| 5. P | GO:0008615 | pyridoxine biosynthetic process |
| 5. P | GO:0006096 | glycolytic process |
| 5. P | GO:0051287 | NAD binding |
| 5. P | GO:0048001 | erythrose-4-phosphate dehydrogenase activity |
| 5. P | GO:0051649 | establishment of localization in cell |
| 5. P | GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity |
| 5. P | GO:0042823 | pyridoxal phosphate biosynthetic process |
| 5. P | GO:0050661 | NADP binding |
| 5. P | GO:0006006 | glucose metabolic process |
| 6. F | GO:0098863 | nuclear migration by microtubule mediated pushing forces |
| 6. F | GO:0005819 | spindle |
| 6. F | GO:1903087 | mitotic spindle pole body duplication |
| 6. F | GO:0005824 | outer plaque of spindle pole body |
| 6. F | GO:0044297 | cell body |
| 6. F | GO:0033269 | internode region of axon |
| 6. F | GO:0051225 | spindle assembly |
| 6. F | GO:0000280 | nuclear division |
| 6. F | GO:0005200 | structural constituent of cytoskeleton |
| 6. F | GO:0042288 | MHC class I protein binding |
| 6. F | GO:0045880 | positive regulation of smoothened signaling pathway |
| 6. F | GO:0000930 | gamma-tubulin complex |
| 6. F | GO:0005524 | ATP binding |
| 6. F | GO:0005881 | cytoplasmic microtubule |
| 6. F | GO:0000226 | microtubule cytoskeleton organization |
| 6. F | GO:1990791 | dorsal root ganglion development |
| 6. F | GO:0031122 | cytoplasmic microtubule organization |
| 6. F | GO:0038007 | netrin-activated signaling pathway |
| 6. F | GO:0030030 | cell projection organization |
| 6. F | GO:0050807 | regulation of synapse organization |
| 6. F | GO:0031625 | ubiquitin protein ligase binding |
| 6. F | GO:0051417 | microtubule nucleation by spindle pole body |
| 6. F | GO:0005641 | nuclear envelope lumen |
| 6. F | GO:0008275 | gamma-tubulin small complex |
| 6. F | GO:0007020 | microtubule nucleation |
| 6. F | GO:0045298 | tubulin complex |
| 6. F | GO:2000767 | positive regulation of cytoplasmic translation |
| 6. F | GO:0000278 | mitotic cell cycle |
| 6. F | GO:0005822 | inner plaque of spindle pole body |
| 6. F | GO:1990890 | netrin receptor binding |
| 6. F | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 7. B | GO:0009532 | plastid stroma |
| 7. B | GO:0009658 | chloroplast organization |
| 7. B | GO:0009570 | chloroplast stroma |
| 7. B | GO:0010637 | negative regulation of mitochondrial fusion |
| 7. B | GO:0043621 | protein self-association |
| 7. B | GO:0009637 | response to blue light |
| 7. B | GO:0009534 | chloroplast thylakoid |
| 7. B | GO:0090258 | negative regulation of mitochondrial fission |
| 7. B | GO:0007005 | mitochondrion organization |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0000917 | division septum assembly |
| GO:0051258 | protein polymerization |
| GO:0090529 | cell septum assembly |
| GO:0032153 | cell division site |
| GO:0003924 | GTPase activity |
| GO:0043093 | FtsZ-dependent cytokinesis |
| GO:0005737 | cytoplasm |
| GO:0051301 | cell division |
| GO:0007049 | cell cycle |
| GO:0000166 | nucleotide binding |
| GO:0005525 | GTP binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q5JH31 | Cell division protein FtsZ 1 | 0.00e+00 | 1.95e-07 | 2.58e-75 | 0.8985 |
| 1. PBF | Q9UZ61 | Cell division protein FtsZ 2 | 0.00e+00 | 1.28e-24 | 6.74e-68 | 0.8751 |
| 1. PBF | Q6GA26 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.8038 |
| 1. PBF | O08466 | Cell division protein FtsZ | 1.11e-16 | 5.00e-21 | 4.60e-46 | 0.8268 |
| 1. PBF | P75464 | Cell division protein FtsZ | 0.00e+00 | 7.98e-16 | 1.52e-33 | 0.7276 |
| 1. PBF | Q9K9T7 | Cell division protein FtsZ | 0.00e+00 | 3.94e-51 | 9.03e-103 | 0.8046 |
| 1. PBF | Q83MF6 | Cell division protein FtsZ | 0.00e+00 | 1.77e-42 | 3.11e-74 | 0.7985 |
| 1. PBF | Q9ZAW3 | Cell division protein FtsZ | 0.00e+00 | 1.67e-43 | 3.95e-66 | 0.8103 |
| 1. PBF | O08458 | Cell division protein FtsZ | 0.00e+00 | 8.01e-44 | 2.77e-93 | 0.8084 |
| 1. PBF | Q59692 | Cell division protein FtsZ | 0.00e+00 | 4.28e-44 | 9.74e-62 | 0.8719 |
| 1. PBF | P45499 | Cell division protein FtsZ | 0.00e+00 | 4.51e-41 | 1.68e-83 | 0.79 |
| 1. PBF | P45500 | Cell division protein FtsZ | 0.00e+00 | 1.44e-44 | 4.57e-87 | 0.8109 |
| 1. PBF | Q4UMT7 | Cell division protein FtsZ | 0.00e+00 | 2.43e-29 | 6.94e-87 | 0.7986 |
| 1. PBF | Q5HGP5 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.796 |
| 1. PBF | O59060 | Tubulin-like protein CetZ | 0.00e+00 | 1.39e-13 | 2.77e-10 | 0.83 |
| 1. PBF | Q5HQ06 | Cell division protein FtsZ | 0.00e+00 | 1.98e-48 | 2.79e-96 | 0.8038 |
| 1. PBF | Q52630 | Cell division protein FtsZ 1 | 0.00e+00 | 4.34e-12 | 6.87e-75 | 0.8971 |
| 1. PBF | B0R383 | Cell division protein FtsZ 1 | 0.00e+00 | 6.48e-10 | 1.10e-72 | 0.8515 |
| 1. PBF | Q8U3E3 | Cell division protein FtsZ 2 | 0.00e+00 | 2.58e-24 | 1.65e-63 | 0.8546 |
| 1. PBF | Q9ALA3 | Cell division protein FtsZ | 0.00e+00 | 2.80e-38 | 6.75e-76 | 0.807 |
| 1. PBF | P45482 | Cell division protein FtsZ | 0.00e+00 | 2.38e-13 | 6.21e-88 | 0.8149 |
| 1. PBF | Q92GV7 | Cell division protein FtsZ | 0.00e+00 | 5.37e-29 | 1.28e-86 | 0.8024 |
| 1. PBF | P0A9A7 | Cell division protein FtsZ | 0.00e+00 | 2.09e-44 | 5.89e-77 | 0.7921 |
| 1. PBF | P0A029 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.8025 |
| 1. PBF | Q50318 | Cell division protein FtsZ | 0.00e+00 | 3.70e-39 | 3.61e-98 | 0.9528 |
| 1. PBF | Q1RHL2 | Cell division protein FtsZ | 1.11e-16 | 1.39e-27 | 8.06e-75 | 0.8004 |
| 1. PBF | O27712 | Cell division protein FtsZ | 0.00e+00 | 5.40e-17 | 5.47e-73 | 0.9653 |
| 1. PBF | P45484 | Cell division protein FtsZ 2 | 0.00e+00 | 9.04e-20 | 1.54e-56 | 0.8695 |
| 1. PBF | Q3BK72 | FtsZ-like protein | 0.00e+00 | 6.61e-04 | 1.42e-61 | 0.9556 |
| 1. PBF | Q9HHC9 | Cell division protein FtsZ 2 | 0.00e+00 | 5.51e-25 | 4.43e-71 | 0.8498 |
| 1. PBF | P0A0S5 | Cell division protein FtsZ | 2.44e-15 | 2.87e-34 | 1.68e-74 | 0.8358 |
| 1. PBF | Q9HS71 | Cell division protein FtsZ 1 | 0.00e+00 | 6.48e-10 | 1.10e-72 | 0.8362 |
| 1. PBF | O29715 | Cell division protein FtsZ 1 | 0.00e+00 | 6.16e-03 | 8.10e-76 | 0.9341 |
| 1. PBF | Q8TZK3 | Cell division protein FtsZ 1 | 0.00e+00 | 9.71e-08 | 3.49e-74 | 0.8982 |
| 1. PBF | B0R2V3 | Cell division protein FtsZ 2 | 0.00e+00 | 2.01e-24 | 5.00e-60 | 0.9473 |
| 1. PBF | D4GSH7 | Cell division protein FtsZ 2 | 0.00e+00 | 1.09e-31 | 6.21e-62 | 0.9553 |
| 1. PBF | P64171 | Cell division protein FtsZ | 0.00e+00 | 6.06e-41 | 2.03e-78 | 0.8045 |
| 1. PBF | P0A9A8 | Cell division protein FtsZ | 0.00e+00 | 2.09e-44 | 5.89e-77 | 0.7958 |
| 1. PBF | O83405 | Cell division protein FtsZ | 3.33e-16 | 5.29e-36 | 6.80e-77 | 0.8047 |
| 1. PBF | P77817 | Cell division protein FtsZ | 6.66e-16 | 3.16e-47 | 1.54e-67 | 0.8685 |
| 1. PBF | O51929 | Cell division protein FtsZ | 0.00e+00 | 1.26e-43 | 1.76e-69 | 0.8026 |
| 1. PBF | P99108 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.8042 |
| 1. PBF | P0A031 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.7985 |
| 1. PBF | O30992 | Cell division protein FtsZ | 4.44e-16 | 1.99e-04 | 3.99e-50 | 0.7898 |
| 1. PBF | D4GQ67 | Tubulin-like protein CetZ4 | 0.00e+00 | 1.06e-12 | 8.36e-06 | 0.7371 |
| 1. PBF | Q6GHP9 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.7952 |
| 1. PBF | Q74JY1 | Cell division protein FtsZ | 0.00e+00 | 2.92e-23 | 6.11e-94 | 0.8233 |
| 1. PBF | B8H080 | Cell division protein FtsZ | 0.00e+00 | 4.42e-11 | 1.20e-71 | 0.8078 |
| 1. PBF | O66809 | Cell division protein FtsZ | 0.00e+00 | 1.27e-41 | 4.27e-63 | 0.8553 |
| 1. PBF | O31314 | Cell division protein FtsZ | 1.07e-14 | 1.49e-03 | 6.69e-49 | 0.7935 |
| 1. PBF | Q9CCE4 | Cell division protein FtsZ | 0.00e+00 | 5.11e-43 | 7.95e-79 | 0.801 |
| 1. PBF | Q8U0S7 | Tubulin-like protein CetZ | 1.44e-15 | 1.84e-15 | 6.64e-10 | 0.8311 |
| 1. PBF | P45483 | Cell division protein FtsZ | 1.11e-16 | 1.16e-44 | 1.20e-84 | 0.7915 |
| 1. PBF | P56097 | Cell division protein FtsZ | 0.00e+00 | 1.65e-23 | 7.31e-58 | 0.8739 |
| 1. PBF | P0A030 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | 0.8022 |
| 1. PBF | P47466 | Cell division protein FtsZ | 0.00e+00 | 5.69e-13 | 1.50e-34 | 0.7688 |
| 1. PBF | P0CAU9 | Cell division protein FtsZ | 0.00e+00 | 4.42e-11 | 1.20e-71 | 0.8207 |
| 1. PBF | P0DMR7 | Cell division protein FtsZ 2 | 0.00e+00 | 2.01e-24 | 5.00e-60 | 0.9439 |
| 1. PBF | P94337 | Cell division protein FtsZ | 0.00e+00 | 1.49e-23 | 7.01e-85 | 0.8041 |
| 1. PBF | P17865 | Cell division protein FtsZ | 0.00e+00 | 1.10e-51 | 2.19e-98 | 0.8135 |
| 1. PBF | V6F5E5 | Cell division protein FtsZ | 3.33e-16 | 1.04e-03 | 3.66e-61 | 0.7899 |
| 1. PBF | O58491 | Cell division protein FtsZ 2 | 0.00e+00 | 3.16e-22 | 1.92e-63 | 0.9193 |
| 1. PBF | P47204 | Cell division protein FtsZ | 2.22e-16 | 1.26e-46 | 1.81e-70 | 0.7955 |
| 1. PBF | O59635 | Cell division protein FtsZ | 0.00e+00 | 5.56e-10 | 4.11e-57 | 0.9489 |
| 1. PBF | Q68W73 | Cell division protein FtsZ | 0.00e+00 | 2.56e-29 | 2.30e-81 | 0.8017 |
| 1. PBF | O57776 | Cell division protein FtsZ 1 | 0.00e+00 | 5.86e-07 | 4.10e-76 | 0.8971 |
| 1. PBF | Q9HHD0 | Tubulin-like protein CetZ | 0.00e+00 | 6.29e-16 | 2.31e-11 | 0.8237 |
| 1. PBF | A0B5R2 | Tubulin-like protein CetZ | 0.00e+00 | 2.17e-09 | 4.02e-06 | 0.7653 |
| 1. PBF | A5U4H7 | Cell division protein FtsZ | 0.00e+00 | 6.06e-41 | 2.03e-78 | 0.8224 |
| 1. PBF | Q9ZCQ3 | Cell division protein FtsZ | 0.00e+00 | 3.30e-29 | 2.92e-81 | 0.794 |
| 1. PBF | P45485 | Cell division protein FtsZ | 9.99e-16 | 5.65e-40 | 2.32e-54 | 0.7996 |
| 1. PBF | P57308 | Cell division protein FtsZ | 0.00e+00 | 5.45e-41 | 1.02e-69 | 0.8041 |
| 1. PBF | Q9V2S6 | Cell division protein FtsZ | 0.00e+00 | 6.53e-06 | 1.25e-75 | 0.961 |
| 1. PBF | Q8CPK4 | Cell division protein FtsZ | 0.00e+00 | 7.34e-48 | 1.01e-96 | 0.8195 |
| 1. PBF | Q9V2S0 | Cell division protein FtsZ 1 | 0.00e+00 | 3.02e-07 | 1.01e-74 | 0.8842 |
| 1. PBF | Q9ZKM2 | Cell division protein FtsZ | 0.00e+00 | 1.79e-23 | 1.12e-57 | 0.8957 |
| 1. PBF | P0A0S6 | Cell division protein FtsZ | 0.00e+00 | 2.87e-34 | 1.68e-74 | 0.8206 |
| 1. PBF | P73456 | Cell division protein FtsZ | 0.00e+00 | 1.17e-12 | 6.83e-87 | 0.8031 |
| 1. PBF | P45501 | Cell division protein FtsZ | 0.00e+00 | 1.38e-39 | 1.52e-85 | 0.8086 |
| 1. PBF | P9WN94 | Cell division protein FtsZ | 0.00e+00 | 6.06e-41 | 2.03e-78 | 0.8269 |
| 1. PBF | O08398 | Cell division protein FtsZ | 0.00e+00 | 9.94e-15 | 2.45e-85 | 0.9336 |
| 1. PBF | Q48327 | Cell division protein FtsZ 1 | 0.00e+00 | 9.53e-06 | 6.23e-76 | 0.9591 |
| 1. PBF | Q89AQ5 | Cell division protein FtsZ | 7.55e-15 | 4.28e-44 | 1.01e-75 | 0.8057 |
| 1. PBF | Q83F12 | Cell division protein FtsZ | 0.00e+00 | 9.28e-42 | 6.79e-66 | 0.9486 |
| 1. PBF | P30327 | Cell division protein FtsZ 1 | 2.22e-16 | 6.61e-04 | 3.66e-51 | 0.8245 |
| 1. PBF | P72079 | Cell division protein FtsZ | 0.00e+00 | 1.07e-34 | 2.15e-74 | 0.7897 |
| 1. PBF | O29685 | Cell division protein FtsZ 2 | 0.00e+00 | 1.58e-26 | 3.08e-56 | 0.948 |
| 1. PBF | Q9ALA4 | Cell division protein FtsZ | 0.00e+00 | 1.60e-43 | 1.60e-74 | 0.7905 |
| 1. PBF | P50907 | Cell division protein FtsZ (Fragment) | 0.00e+00 | 2.20e-15 | 1.97e-47 | 0.809 |
| 1. PBF | O08439 | Cell division protein FtsZ | 0.00e+00 | 1.13e-47 | 4.32e-96 | 0.7971 |
| 1. PBF | P45069 | Cell division protein FtsZ | 0.00e+00 | 5.71e-31 | 3.26e-57 | 0.7842 |
| 1. PBF | Q9V0H5 | Tubulin-like protein CetZ | 0.00e+00 | 1.95e-16 | 1.40e-09 | 0.7971 |
| 2. PF | Q8KNP3 | Tubulin-like protein TubZ | 1.71e-06 | 2.27e-02 | NA | 0.6251 |
| 2. PF | D4GW48 | Tubulin-like protein CetZ3 | 0.00e+00 | 2.42e-11 | NA | 0.76 |
| 2. PF | D4GU81 | Tubulin-like protein CetZ6 | 0.00e+00 | 9.99e-10 | NA | 0.7484 |
| 2. PF | Q9X315 | Tubulin-like protein TubZ | 8.88e-12 | 3.64e-16 | NA | 0.6995 |
| 2. PF | Q4MKK8 | Tubulin-like protein TubZ | 4.69e-12 | 4.82e-16 | NA | 0.6445 |
| 2. PF | D4GU26 | Tubulin-like protein CetZ5 | 2.33e-15 | 7.16e-14 | NA | 0.7654 |
| 2. PF | Q74P24 | Tubulin-like protein TubZ | 4.50e-12 | 1.76e-15 | NA | 0.6354 |
| 2. PF | D4GVD7 | Tubulin-like protein CetZ1 | 0.00e+00 | 2.21e-14 | NA | 0.7673 |
| 4. PB | P9WN95 | Cell division protein FtsZ | 0.00e+00 | 6.06e-41 | 2.03e-78 | NA |
| 4. PB | P0A9A6 | Cell division protein FtsZ | 0.00e+00 | 2.09e-44 | 5.89e-77 | NA |
| 4. PB | Q2FZ89 | Cell division protein FtsZ | 0.00e+00 | 7.90e-47 | 8.23e-98 | NA |
| 4. PB | Q57816 | Cell division protein FtsZ 1 | 0.00e+00 | 8.81e-08 | 1.85e-66 | NA |
| 4. PB | Q42545 | Cell division protein FtsZ homolog 1, chloroplastic | 0.00e+00 | 1.64e-02 | 8.42e-76 | NA |
| 4. PB | D4GTC1 | Tubulin-like protein CetZ2 | 2.44e-15 | 7.96e-17 | 6.88e-05 | NA |
| 4. PB | Q9KH25 | Cell division protein FtsZ | NA | 3.48e-48 | 2.05e-81 | NA |
| 4. PB | Q58039 | Cell division protein FtsZ 2 | 0.00e+00 | 2.00e-15 | 4.52e-68 | NA |
| 4. PB | Q54Z54 | Mitochondrial division protein fszA | 0.00e+00 | 3.82e-11 | 5.52e-57 | NA |
| 5. P | Q3ILL8 | D-erythrose-4-phosphate dehydrogenase | 2.09e-01 | 2.06e-02 | NA | NA |
| 5. P | B7MMA9 | D-erythrose-4-phosphate dehydrogenase | 1.94e-01 | 3.16e-02 | NA | NA |
| 5. P | A8APE1 | D-erythrose-4-phosphate dehydrogenase | 1.92e-01 | 3.70e-02 | NA | NA |
| 5. P | Q47XD5 | D-erythrose-4-phosphate dehydrogenase | 1.42e-01 | 9.59e-03 | NA | NA |
| 5. P | P64180 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.06e-01 | 8.33e-03 | NA | NA |
| 5. P | C6DFH8 | D-erythrose-4-phosphate dehydrogenase | 1.87e-01 | 1.75e-02 | NA | NA |
| 5. P | A6TDT2 | D-erythrose-4-phosphate dehydrogenase | 1.85e-01 | 3.31e-02 | NA | NA |
| 5. P | B7N7H3 | D-erythrose-4-phosphate dehydrogenase | 2.20e-01 | 3.21e-02 | NA | NA |
| 5. P | B5BFN5 | D-erythrose-4-phosphate dehydrogenase | 2.57e-01 | 2.60e-02 | NA | NA |
| 5. P | A1AFB1 | D-erythrose-4-phosphate dehydrogenase | 1.93e-01 | 3.16e-02 | NA | NA |
| 5. P | B1IT76 | D-erythrose-4-phosphate dehydrogenase | 2.14e-01 | 3.21e-02 | NA | NA |
| 5. P | B7NHY6 | D-erythrose-4-phosphate dehydrogenase | 2.17e-01 | 3.53e-02 | NA | NA |
| 5. P | A8A467 | D-erythrose-4-phosphate dehydrogenase | 2.16e-01 | 3.21e-02 | NA | NA |
| 5. P | Q6LMN0 | D-erythrose-4-phosphate dehydrogenase | 2.36e-01 | 2.14e-02 | NA | NA |
| 5. P | B5FUI3 | D-erythrose-4-phosphate dehydrogenase | 1.94e-01 | 4.70e-02 | NA | NA |
| 5. P | P0A9B8 | D-erythrose-4-phosphate dehydrogenase | 2.21e-01 | 3.21e-02 | NA | NA |
| 5. P | A7ZR35 | D-erythrose-4-phosphate dehydrogenase | 2.00e-01 | 3.21e-02 | NA | NA |
| 5. P | B7LYU4 | D-erythrose-4-phosphate dehydrogenase | 2.24e-01 | 3.21e-02 | NA | NA |
| 5. P | A9N3Q6 | D-erythrose-4-phosphate dehydrogenase | 2.02e-01 | 4.62e-02 | NA | NA |
| 5. P | Q6D086 | D-erythrose-4-phosphate dehydrogenase | 1.73e-01 | 3.39e-02 | NA | NA |
| 5. P | C0PY46 | D-erythrose-4-phosphate dehydrogenase | 1.95e-01 | 4.44e-02 | NA | NA |
| 5. P | P54226 | Glyceraldehyde-3-phosphate dehydrogenase 1 | 2.13e-01 | 3.45e-02 | NA | NA |
| 5. P | B7LPD5 | D-erythrose-4-phosphate dehydrogenase | 2.16e-01 | 3.16e-02 | NA | NA |
| 5. P | B7MZM0 | D-erythrose-4-phosphate dehydrogenase | 1.96e-01 | 3.56e-02 | NA | NA |
| 5. P | P0A9B7 | D-erythrose-4-phosphate dehydrogenase | 1.97e-01 | 3.21e-02 | NA | NA |
| 5. P | Q6G8N9 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.06e-01 | 8.33e-03 | NA | NA |
| 5. P | Q0T0X3 | D-erythrose-4-phosphate dehydrogenase | 2.14e-01 | 3.21e-02 | NA | NA |
| 5. P | Q8XGA4 | D-erythrose-4-phosphate dehydrogenase | 1.76e-01 | 4.44e-02 | NA | NA |
| 5. P | A9MRF0 | D-erythrose-4-phosphate dehydrogenase | 1.38e-01 | 3.98e-02 | NA | NA |
| 5. P | Q6GG19 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.08e-01 | 1.01e-02 | NA | NA |
| 5. P | B5RE31 | D-erythrose-4-phosphate dehydrogenase | 1.96e-01 | 4.96e-02 | NA | NA |
| 5. P | B1LDD2 | D-erythrose-4-phosphate dehydrogenase | 1.98e-01 | 3.21e-02 | NA | NA |
| 5. P | B4EUH7 | D-erythrose-4-phosphate dehydrogenase | 1.78e-01 | 3.91e-02 | NA | NA |
| 5. P | P0A9B6 | D-erythrose-4-phosphate dehydrogenase | 2.18e-01 | 3.21e-02 | NA | NA |
| 5. P | Q1R7A6 | D-erythrose-4-phosphate dehydrogenase | 1.89e-01 | 3.56e-02 | NA | NA |
| 5. P | Q331T7 | Tubulin-like protein TubZ | NA | 1.76e-11 | NA | NA |
| 5. P | C5A0J7 | D-erythrose-4-phosphate dehydrogenase | 2.15e-01 | 3.21e-02 | NA | NA |
| 5. P | B3FK34 | Phage tubulin-like protein | NA | 3.51e-06 | NA | NA |
| 5. P | B5XUB7 | D-erythrose-4-phosphate dehydrogenase | 1.77e-01 | 3.98e-02 | NA | NA |
| 5. P | Q32BY7 | D-erythrose-4-phosphate dehydrogenase | 2.19e-01 | 3.47e-02 | NA | NA |
| 5. P | B7LFI3 | D-erythrose-4-phosphate dehydrogenase | 2.26e-01 | 3.21e-02 | NA | NA |
| 5. P | B7UHW9 | D-erythrose-4-phosphate dehydrogenase | 2.23e-01 | 3.56e-02 | NA | NA |
| 5. P | P64181 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.07e-01 | 8.33e-03 | NA | NA |
| 5. P | C5BAU7 | D-erythrose-4-phosphate dehydrogenase | 1.91e-01 | 3.34e-02 | NA | NA |
| 5. P | P99067 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 1.87e-01 | 8.33e-03 | NA | NA |
| 5. P | P0A9B9 | D-erythrose-4-phosphate dehydrogenase | 2.20e-01 | 3.21e-02 | NA | NA |
| 5. P | Q0TDS9 | D-erythrose-4-phosphate dehydrogenase | 2.19e-01 | 3.21e-02 | NA | NA |
| 5. P | B5YQB9 | D-erythrose-4-phosphate dehydrogenase | 1.93e-01 | 3.21e-02 | NA | NA |
| 5. P | B5F5J5 | D-erythrose-4-phosphate dehydrogenase | 1.89e-01 | 4.44e-02 | NA | NA |
| 5. P | Q5HNL7 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.40e-01 | 4.27e-02 | NA | NA |
| 5. P | B6I761 | D-erythrose-4-phosphate dehydrogenase | 2.26e-01 | 3.21e-02 | NA | NA |
| 5. P | Q5PJI5 | D-erythrose-4-phosphate dehydrogenase | 2.28e-01 | 2.60e-02 | NA | NA |
| 5. P | Q31WI6 | D-erythrose-4-phosphate dehydrogenase | 2.21e-01 | 3.21e-02 | NA | NA |
| 5. P | Q3YXU5 | D-erythrose-4-phosphate dehydrogenase | 2.22e-01 | 3.21e-02 | NA | NA |
| 5. P | F8SJR0 | Phage tubulin-like protein | NA | 9.04e-09 | NA | NA |
| 5. P | B2U0U3 | D-erythrose-4-phosphate dehydrogenase | 1.99e-01 | 3.21e-02 | NA | NA |
| 5. P | Q5QVL6 | D-erythrose-4-phosphate dehydrogenase | 1.74e-01 | 1.26e-02 | NA | NA |
| 5. P | Q7CPU5 | D-erythrose-4-phosphate dehydrogenase | 1.85e-01 | 4.44e-02 | NA | NA |
| 5. P | B4TV39 | D-erythrose-4-phosphate dehydrogenase | 1.90e-01 | 3.79e-02 | NA | NA |
| 5. P | Q57K44 | D-erythrose-4-phosphate dehydrogenase | 1.83e-01 | 4.44e-02 | NA | NA |
| 5. P | B4THF4 | D-erythrose-4-phosphate dehydrogenase | 1.93e-01 | 4.44e-02 | NA | NA |
| 5. P | B4T5H2 | D-erythrose-4-phosphate dehydrogenase | 2.54e-01 | 4.44e-02 | NA | NA |
| 5. P | B5QXJ7 | D-erythrose-4-phosphate dehydrogenase | 2.37e-01 | 4.70e-02 | NA | NA |
| 5. P | E3VWI2 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.33e-01 | 1.81e-02 | NA | NA |
| 5. P | B1XEL0 | D-erythrose-4-phosphate dehydrogenase | 1.93e-01 | 3.21e-02 | NA | NA |
| 5. P | Q5HF86 | Glyceraldehyde-3-phosphate dehydrogenase 2 | 2.48e-01 | 8.33e-03 | NA | NA |
| 5. P | A7MJQ2 | D-erythrose-4-phosphate dehydrogenase | 1.74e-01 | 2.08e-02 | NA | NA |
| 6. F | Q9ZRJ4 | Tubulin alpha chain | 3.34e-13 | NA | NA | 0.6062 |
| 6. F | Q92335 | Tubulin alpha chain | 4.06e-13 | NA | NA | 0.5962 |
| 6. F | Q2HJ86 | Tubulin alpha-1D chain | 5.10e-13 | NA | NA | 0.5906 |
| 6. F | Q94570 | Tubulin alpha-2 chain | 8.58e-13 | NA | NA | 0.5837 |
| 6. F | P41799 | Tubulin beta chain | 2.04e-13 | NA | NA | 0.5874 |
| 6. F | P10875 | Tubulin beta chain | 1.72e-13 | NA | NA | 0.5915 |
| 6. F | P46259 | Tubulin alpha-1 chain | 7.00e-13 | NA | NA | 0.5872 |
| 6. F | A7HUC7 | Bifunctional protein HldE | 3.48e-02 | NA | NA | 0.2606 |
| 6. F | Q9ZRB7 | Tubulin alpha chain | 6.59e-13 | NA | NA | 0.5865 |
| 6. F | P87066 | Tubulin alpha chain | 3.16e-13 | NA | NA | 0.6051 |
| 6. F | P33625 | Tubulin alpha chain | 6.97e-13 | NA | NA | 0.585 |
| 6. F | Q94571 | Tubulin beta-2 chain | 7.55e-13 | NA | NA | 0.6166 |
| 6. F | P09205 | Tubulin alpha-2 chain | 8.44e-13 | NA | NA | 0.5878 |
| 6. F | Q6VAG0 | Tubulin alpha-2 chain | 6.84e-13 | NA | NA | 0.5874 |
| 6. F | O17449 | Tubulin beta-1 chain | 9.48e-14 | NA | NA | 0.6171 |
| 6. F | P41385 | Tubulin beta chain | 9.97e-14 | NA | NA | 0.6136 |
| 6. F | P10874 | Tubulin beta-2 chain | 7.24e-14 | NA | NA | 0.5904 |
| 6. F | P34787 | Tubulin gamma chain | 6.25e-13 | NA | NA | 0.6405 |
| 6. F | Q4R538 | Tubulin alpha-1B chain | 3.13e-13 | NA | NA | 0.5749 |
| 6. F | P13602 | Tubulin beta-2 chain | 1.19e-13 | NA | NA | 0.6163 |
| 6. F | Q75A43 | Tubulin gamma chain | 1.14e-13 | NA | NA | 0.6472 |
| 6. F | P69893 | Tubulin beta-5 chain | 3.09e-13 | NA | NA | 0.6171 |
| 6. F | P02554 | Tubulin beta chain | 1.08e-13 | NA | NA | 0.6174 |
| 6. F | O44388 | Tubulin beta chain | 7.38e-14 | NA | NA | 0.6185 |
| 6. F | P54402 | Tubulin gamma chain | 7.32e-13 | NA | NA | 0.6165 |
| 6. F | P41741 | Tubulin beta chain | 6.28e-14 | NA | NA | 0.6005 |
| 6. F | Q7JJU6 | Tubulin beta chain | 1.85e-13 | NA | NA | 0.6137 |
| 6. F | Q96TU8 | Tubulin beta chain | 1.74e-13 | NA | NA | 0.5972 |
| 6. F | P34786 | Tubulin gamma-1 chain | 2.36e-13 | NA | NA | 0.6373 |
| 6. F | P28268 | Tubulin alpha chain | 8.02e-13 | NA | NA | 0.5825 |
| 6. F | Q9ZRR5 | Tubulin alpha-3 chain | 7.21e-13 | NA | NA | 0.5878 |
| 6. F | Q2HJ81 | Tubulin beta-6 chain | 1.30e-13 | NA | NA | 0.6146 |
| 6. F | P12458 | Tubulin beta-2 chain | 1.38e-13 | NA | NA | 0.6247 |
| 6. F | P54403 | Tubulin gamma-1 chain | 5.09e-13 | NA | NA | 0.6502 |
| 6. F | Q3ZBU7 | Tubulin beta-4A chain | 1.62e-13 | NA | NA | 0.6169 |
| 6. F | Q40831 | Tubulin alpha-1 chain | 1.18e-09 | NA | NA | 0.6015 |
| 6. F | Q43473 | Tubulin alpha-1 chain | 6.74e-13 | NA | NA | 0.5793 |
| 6. F | P90548 | Tubulin gamma-2 chain | 2.90e-13 | NA | NA | 0.6381 |
| 6. F | Q4R7T7 | Tubulin delta chain | 9.82e-11 | NA | NA | 0.5616 |
| 6. F | P09203 | Tubulin beta-1 chain | 1.50e-13 | NA | NA | 0.6137 |
| 6. F | Q25563 | Tubulin alpha-13 chain | 2.60e-09 | NA | NA | 0.5897 |
| 6. F | P09204 | Tubulin alpha-1 chain | 4.23e-13 | NA | NA | 0.6108 |
| 6. F | Q52NY7 | Tubulin beta chain | 2.49e-13 | NA | NA | 0.606 |
| 6. F | P04106 | Tubulin alpha chain | 7.29e-13 | NA | NA | 0.5866 |
| 6. F | P09206 | Tubulin beta-3 chain | 1.89e-13 | NA | NA | 0.6043 |
| 6. F | P41388 | Tubulin beta chain | 3.46e-13 | NA | NA | 0.5885 |
| 6. F | P11481 | Tubulin alpha-1/alpha-2 chain | 3.50e-13 | NA | NA | 0.5901 |
| 6. F | Q9SCC8 | Tubulin alpha chain, nucleomorph | 1.83e-13 | NA | NA | 0.5682 |
| 6. F | P24637 | Tubulin beta chain | 3.48e-13 | NA | NA | 0.6202 |
| 6. F | P33629 | Tubulin alpha chain | 6.54e-13 | NA | NA | 0.5871 |
| 6. F | Q752Y2 | Tubulin alpha chain | 3.28e-13 | NA | NA | 0.6046 |
| 6. F | P24633 | Tubulin alpha-1 chain | 4.96e-13 | NA | NA | 0.5852 |
| 6. F | Q96460 | Tubulin alpha-2 chain | 3.54e-09 | NA | NA | 0.5875 |
| 6. F | Q5UBX3 | Tubulin beta chain | 2.06e-13 | NA | NA | 0.5886 |
| 6. F | P33127 | Tubulin beta chain | 7.48e-10 | NA | NA | 0.6123 |
| 6. F | Q9FT36 | Tubulin alpha chain | 1.64e-13 | NA | NA | 0.5906 |
| 6. F | P49742 | Tubulin alpha-1B chain | 3.64e-13 | NA | NA | 0.5962 |
| 6. F | Q2T9S0 | Tubulin beta-3 chain | 2.90e-13 | NA | NA | 0.6158 |
| 6. F | P40905 | Tubulin beta-2 chain | 7.74e-14 | NA | NA | 0.5954 |
| 6. F | O94128 | Tubulin alpha chain | 4.19e-13 | NA | NA | 0.6019 |
| 6. F | P92120 | Tubulin alpha chain (Fragment) | 5.11e-12 | NA | NA | 0.634 |
| 6. F | P11833 | Tubulin beta chain | 1.78e-13 | NA | NA | 0.6161 |
| 6. F | P36221 | Tubulin beta-1 chain | 1.57e-13 | NA | NA | 0.6122 |
| 6. F | Q9UV72 | Tubulin beta chain | 3.05e-13 | NA | NA | 0.6016 |
| 6. F | P81947 | Tubulin alpha-1B chain | 3.26e-13 | NA | NA | 0.5805 |
| 6. F | P22014 | Tubulin beta-2 chain | 7.38e-14 | NA | NA | 0.6098 |
| 6. F | P09244 | Tubulin beta-7 chain | 2.12e-13 | NA | NA | 0.6185 |
| 6. F | P07436 | Tubulin beta-1 chain | 1.21e-13 | NA | NA | 0.6156 |
| 6. F | P54404 | Tubulin gamma-2 chain | 3.75e-13 | NA | NA | 0.6516 |
| 6. F | P53374 | Tubulin beta chain | 2.66e-13 | NA | NA | 0.5932 |
| 6. F | P16040 | Tubulin beta chain | 2.68e-13 | NA | NA | 0.5929 |
| 6. F | P11237 | Tubulin alpha-1/2/3 chain | 4.60e-09 | NA | NA | 0.5894 |
| 6. F | Q6EVK8 | Tubulin beta-1 chain | 1.31e-09 | NA | NA | 0.596 |
| 6. F | Q3MHM5 | Tubulin beta-4B chain | 1.37e-13 | NA | NA | 0.618 |
| 6. F | Q91240 | Tubulin beta chain | 2.22e-13 | NA | NA | 0.6176 |
| 6. F | P05304 | Tubulin beta chain | 1.17e-13 | NA | NA | 0.6172 |
| 6. F | Q4R9N3 | Tubulin beta chain | 2.37e-13 | NA | NA | 0.5937 |
| 6. F | P10873 | Tubulin alpha chain | 1.06e-09 | NA | NA | 0.5934 |
| 6. F | P18241 | Tubulin beta-1 chain | 1.04e-13 | NA | NA | 0.6189 |
| 6. F | O22348 | Tubulin alpha-2 chain | 1.42e-13 | NA | NA | 0.5849 |
| 6. F | Q8SRI6 | Tubulin alpha chain | 1.80e-13 | NA | NA | 0.6006 |
| 6. F | P68361 | Tubulin alpha-1B chain | 2.89e-13 | NA | NA | 0.5704 |
| 6. F | O22349 | Tubulin alpha-3 chain | 6.33e-13 | NA | NA | 0.5869 |
| 6. F | O22347 | Tubulin alpha-1 chain | 6.36e-13 | NA | NA | 0.5877 |
| 6. F | Q5R943 | Tubulin beta chain | 9.10e-14 | NA | NA | 0.619 |
| 6. F | Q8HZV4 | Tubulin delta chain | 4.09e-11 | NA | NA | 0.5343 |
| 6. F | Q27U48 | Tubulin beta-1 chain | 3.00e-13 | NA | NA | 0.6106 |
| 7. B | Q9GPZ7 | Mitochondrial division protein fszB | 0.00e+00 | NA | 9.68e-57 | NA |
| 7. B | O82533 | Cell division protein FtsZ homolog 2-1, chloroplastic | 0.00e+00 | NA | 2.40e-81 | NA |
| 7. B | Q9LXJ0 | Cell division protein FtsZ homolog 2-2, chloroplastic | 3.00e-15 | NA | 1.73e-80 | NA |