Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54840.1

JCVISYN3A_0524

16S rRNA (cytosine(1402)-N(4))-methyltransferase.
M. mycoides homolog: P62473.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.

Statistics

Total GO Annotation: 33
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 26

Total Homologs: 967
Unique PROST Homologs: 1
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 118

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rsmH; 16S rRNA (cytosine(1402)-N(4))-methyltransferase
Zhang et al. [4]: GO:0071424|rRNA (cytosine-N4-)-methyltran sferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was C5J697 (Ribosomal RNA small subunit methyltransferase H) with a FATCAT P-Value: 0 and RMSD of 1.54 angstrom. The sequence alignment identity is 44.6%.
Structural alignment shown in left. Query protein AVX54840.1 colored as red in alignment, homolog C5J697 colored as blue. Query protein AVX54840.1 is also shown in right top, homolog C5J697 showed in right bottom. They are colored based on secondary structures.

  AVX54840.1 MDKHIPVLLKES-IEYLNIKPDGIYVDCTLGRAGHSSEILKKLNQKGFLYAIDQDQIAIDQAKEKLEQINNNFLLIQGNFSNLSALLAINHVFNVDGILY 99
      C5J697 M--HIPVLI-DSLIENLNIREDGIYVDLTLGRGGHAAAILSKLT-TGLLIVFDKDEKAIEESKERLLAISKNVIFIWEDFRNFAVELEKRQIYKVDGFIM 96

  AVX54840.1 DLGVSSPQIDIASRGFSYKMDGPLDMRMDLNSTLTAHQVINTYSESQISEILFKYGEESFSKSISKKIVESRPINSTLELVEIIKSVLPQKVLKQKKHPA 199
      C5J697 DLGVSSPQIDQGERGFSYTKNARLDMRMNQNQELDAHHVVNNYNQDLLTKVLQNYGELKNARSLTKAIIDSRPINTTFELVNLIRSSSPAALLR-KKNIV 195

  AVX54840.1 KKTFQALRIYINNELIALENSLKQALDLLNSKARICVITFHSLEEKIVKNIFNNSTNYYQEQLL----SNL--PIKANLNSKFKLVIKKPIKPSLLELEQ 293
      C5J697 KNVFQAIRIEVNDELGALEAFLSLFISYLKQDSQVAIITFHSLEDRIVKMKFKS--------LLISSKTHLFDP-RAQ---QFSV---KTIKPSTSEIQL 280

  AVX54840.1 NHRSHSAKLWVIEKN- 308
      C5J697 NKRSKSAKLRILSKNY 296

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0005829	cytosol
1. PBF	GO:0070475	rRNA base methylation
1. PBF	GO:0071424	rRNA (cytosine-N4-)-methyltransferase activity
3. BF	GO:0043776	cobalt-precorrin-6B C5-methyltransferase activity
3. BF	GO:0046140	corrin biosynthetic process
4. PB	GO:0005886	plasma membrane
6. F	GO:0102094	S-adenosylmethionine:2-demethylmenaquinol methyltransferase activity
6. F	GO:0003723	RNA binding
6. F	GO:0006744	ubiquinone biosynthetic process
6. F	GO:0043333	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity
6. F	GO:0033485	cyanidin 3-O-glucoside biosynthetic process
6. F	GO:0033486	delphinidin 3-O-glucoside biosynthetic process
6. F	GO:0004719	protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
6. F	GO:0070448	laricitrin 5'-O-methyltransferase activity
6. F	GO:0046872	metal ion binding
6. F	GO:0008171	O-methyltransferase activity
6. F	GO:0009060	aerobic respiration
6. F	GO:1901771	daunorubicin biosynthetic process
6. F	GO:0052624	2-phytyl-1,4-naphthoquinone methyltransferase activity
6. F	GO:0016429	tRNA (adenine-N1-)-methyltransferase activity
6. F	GO:0042372	phylloquinone biosynthetic process
6. F	GO:0043770	demethylmenaquinone methyltransferase activity
6. F	GO:0009236	cobalamin biosynthetic process
6. F	GO:0009234	menaquinone biosynthetic process
6. F	GO:0032259	methylation
6. F	GO:0016434	rRNA (cytosine) methyltransferase activity
6. F	GO:0031515	tRNA (m1A) methyltransferase complex
6. F	GO:0102027	S-adenosylmethionine:2-demethylquinol-8 methyltransferase activity
6. F	GO:0008276	protein methyltransferase activity
6. F	GO:0008649	rRNA methyltransferase activity
6. F	GO:0102955	S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity
6. F	GO:0070041	rRNA (uridine-C5-)-methyltransferase activity

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0070475	rRNA base methylation
GO:0005737	cytoplasm
GO:0006364	rRNA processing
GO:0008168	methyltransferase activity
GO:0071424	rRNA (cytosine-N4-)-methyltransferase activity
GO:0032259	methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q1AVW6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.62e-59	1.04e-52	0.8984
1. PBF	B0TZ13	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.44e-66	1.80e-73	0.9058
1. PBF	Q83GN7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.51e-55	2.12e-61	0.8957
1. PBF	Q2IG17	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.76e-64	9.72e-51	0.9116
1. PBF	Q31PL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.38e-51	1.08e-67	0.9061
1. PBF	Q2K6B3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.95e-41	2.76e-51	0.868
1. PBF	B9MFS0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.65e-58	5.47e-65	0.883
1. PBF	A1WYV1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.10e-50	1.29e-65	0.8988
1. PBF	A1TKC3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.64e-60	6.37e-57	0.8764
1. PBF	Q8ZRU8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8778
1. PBF	A9WRE6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.78e-49	7.13e-65	0.9072
1. PBF	Q1WT95	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.84e-72	1.54e-104	0.9312
1. PBF	A5IS65	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9285
1. PBF	Q8A251	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.54e-58	1.36e-70	0.8884
1. PBF	Q3M882	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.80e-48	4.18e-67	0.883
1. PBF	A9BHH9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.53e-60	9.66e-74	0.9497
1. PBF	P59658	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.40e-68	2.85e-102	0.9303
1. PBF	Q3J4N3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.08e-46	2.88e-60	0.872
1. PBF	A9AJ24	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.89e-60	5.78e-69	0.8905
1. PBF	A7FM74	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8736
1. PBF	B5YEM1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.23e-54	4.79e-74	0.9164
1. PBF	A1A2F7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.74e-47	5.50e-59	0.9106
1. PBF	A8G9R9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.46e-68	2.07e-68	0.8884
1. PBF	B6JCF0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.69e-48	4.73e-63	0.8994
1. PBF	Q2S535	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.48e-45	4.10e-66	0.8912
1. PBF	Q894B4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.15e-72	2.11e-88	0.9265
1. PBF	B4RQD7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.02e-64	6.08e-69	0.9041
1. PBF	Q6F7D1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.67e-71	4.02e-66	0.9126
1. PBF	B1JUW4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.50e-61	2.36e-69	0.8912
1. PBF	C1A8A2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.39e-49	3.28e-42	0.8541
1. PBF	B9JH59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-40	3.61e-51	0.8817
1. PBF	B7N7V5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8905
1. PBF	A0AKE1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.74e-72	2.75e-101	0.9422
1. PBF	Q4QLG6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.51e-68	2.40e-67	0.8959
1. PBF	Q8NNM7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.74e-55	3.47e-60	0.8865
1. PBF	C1A0Y3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.60e-49	2.11e-56	0.9029
1. PBF	Q039S2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.92e-76	3.35e-94	0.9341
1. PBF	B4U4K4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.02e-67	2.09e-100	0.9265
1. PBF	Q3YRX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.17e-60	2.95e-65	0.9364
1. PBF	A5VRI5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.54e-41	9.19e-52	0.8901
1. PBF	Q7NPZ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.61e-69	1.06e-74	0.894
1. PBF	A8F758	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.35e-54	4.19e-66	0.9334
1. PBF	B4UER3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.11e-65	1.68e-50	0.9136
1. PBF	Q03EX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.58e-72	5.95e-100	0.935
1. PBF	Q92HB4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.54e-55	1.11e-63	0.906
1. PBF	Q8E9P0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.95e-68	3.40e-70	0.8957
1. PBF	A9MZL1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.28e-70	8.52e-74	0.889
1. PBF	Q5HB44	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.44e-58	5.32e-63	0.9244
1. PBF	A6VB93	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.03e-69	2.95e-70	0.9116
1. PBF	A5EY11	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.73e-66	1.41e-66	0.8881
1. PBF	A3NDX2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.9025
1. PBF	Q3JND0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.9025
1. PBF	Q5NGY1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-73	3.12e-68	0.909
1. PBF	Q1MPC6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.79e-61	3.71e-57	0.9133
1. PBF	B1GZH8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.24e-60	2.05e-52	0.927
1. PBF	Q6F170	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.88e-87	1.79e-143	0.9739
1. PBF	Q68WG7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.84e-58	4.01e-60	0.8976
1. PBF	A1VBE0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.65e-46	5.60e-63	0.9097
1. PBF	Q46HK1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.46e-45	1.10e-49	0.8701
1. PBF	Q2YM63	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8902
1. PBF	Q7MSS6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.17e-54	3.30e-44	0.8762
1. PBF	Q1Q846	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.76e-37	2.58e-59	0.8911
1. PBF	A9VW37	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.94e-39	4.70e-64	0.9121
1. PBF	B3PMB4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.42e-56	6.24e-78	0.94
1. PBF	A7ZD05	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.24e-57	1.34e-44	0.8629
1. PBF	A2C000	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.21e-47	2.82e-48	0.8715
1. PBF	O83399	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.12e-24	1.74e-29	0.8496
1. PBF	C6AJH2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.84e-31	8.12e-58	0.91
1. PBF	Q9CPB4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.58e-66	1.58e-70	0.8865
1. PBF	B0BYA0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.11e-54	1.41e-63	0.9048
1. PBF	A5G8K8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.93e-69	2.69e-75	0.9132
1. PBF	Q6AJ47	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.66e-55	1.49e-64	0.9372
1. PBF	Q4FPN5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.63e-37	5.24e-43	0.8911
1. PBF	Q5ZX19	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.07e-63	2.10e-79	0.9191
1. PBF	C6BYH4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-58	5.76e-63	0.9116
1. PBF	A4QFN1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.23e-53	1.84e-60	0.8926
1. PBF	C0M7A8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.04e-67	7.32e-100	0.9271
1. PBF	A5IIR1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.37e-54	6.45e-76	0.9307
1. PBF	P62470	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.65e-46	5.60e-63	0.9101
1. PBF	Q5XAL3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.42e-70	4.40e-101	0.9305
1. PBF	Q5HQ13	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.93e-70	4.61e-91	0.9269
1. PBF	Q493Q9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.66e-55	2.87e-61	0.8831
1. PBF	Q6G2P7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.79e-41	2.46e-47	0.8879
1. PBF	A4W3H4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-67	1.03e-97	0.9279
1. PBF	Q6HEP6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.16e-72	2.01e-101	0.934
1. PBF	Q48EF0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.08e-70	2.95e-66	0.9021
1. PBF	P60485	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9226
1. PBF	A1UI62	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.26e-17	2.71e-66	0.9204
1. PBF	Q1JAG5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9319
1. PBF	B4RFS8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-52	4.67e-54	0.8772
1. PBF	Q1JKL7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9321
1. PBF	C6UM45	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8891
1. PBF	B1IKR0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-69	1.62e-89	0.9166
1. PBF	A6TUM7	Ribosomal RNA small subunit methyltransferase H 2	0.00e+00	2.46e-14	8.13e-48	0.8743
1. PBF	C4Z530	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.43e-67	1.07e-86	0.9252
1. PBF	A4TQ91	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.30e-65	2.04e-71	0.8853
1. PBF	Q5LU79	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.16e-45	3.49e-60	0.8596
1. PBF	A0L5N9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.36e-69	2.89e-68	0.9151
1. PBF	Q5R0L7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.08e-70	1.28e-67	0.9012
1. PBF	C5D8L5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.23e-74	1.75e-97	0.94
1. PBF	B9E0V5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.62e-68	2.41e-87	0.9217
1. PBF	P60394	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9238
1. PBF	Q7VQJ5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.43e-63	2.42e-58	0.8837
1. PBF	A9BD32	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.81e-43	2.29e-53	0.8814
1. PBF	B0RI49	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.13e-59	7.53e-56	0.9077
1. PBF	B3QWS9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.85e-62	8.79e-71	0.9039
1. PBF	C3P688	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9346
1. PBF	A4JB86	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.60e-61	4.32e-69	0.8924
1. PBF	Q0BXT4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.43e-41	5.56e-53	0.8917
1. PBF	A4VX71	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-67	1.03e-97	0.9276
1. PBF	A8FQ92	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.30e-71	1.61e-67	0.8939
1. PBF	A0Q055	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.29e-68	1.41e-91	0.9259
1. PBF	Q5N4L0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.38e-51	1.08e-67	0.9055
1. PBF	Q12EM3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.25e-65	1.76e-62	0.8958
1. PBF	C6DEV1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.78e-69	2.08e-71	0.893
1. PBF	Q3KM90	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.54e-56	3.10e-45	0.8869
1. PBF	Q3K736	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.46e-69	5.08e-72	0.9052
1. PBF	B1IR96	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8898
1. PBF	Q0I1E1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.27e-68	1.04e-67	0.8955
1. PBF	B3PCM8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.11e-64	7.67e-75	0.9005
1. PBF	Q47VQ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.73e-70	5.49e-74	0.8964
1. PBF	Q2JLV1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.86e-36	1.00e-59	0.8801
1. PBF	B0TQM9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.17e-71	2.32e-68	0.8963
1. PBF	Q1LIL8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.72e-51	2.09e-65	0.8881
1. PBF	A5CS59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.68e-61	7.14e-56	0.9085
1. PBF	B3EQC6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.87e-61	2.26e-65	0.8825
1. PBF	C1AQ81	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	0.9034
1. PBF	C6AKG2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.58e-65	2.54e-66	0.8912
1. PBF	C5W331	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8923
1. PBF	B2I9C0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.00e-61	1.85e-66	0.8813
1. PBF	A5UCX6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.51e-68	2.40e-67	0.8986
1. PBF	A5UIQ3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.14e-39	6.17e-61	0.821
1. PBF	Q11GR7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.87e-42	2.58e-49	0.8867
1. PBF	P60391	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8906
1. PBF	Q1CMN5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8734
1. PBF	B5Y8C1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.29e-57	7.79e-58	0.9153
1. PBF	Q5E2P2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.57e-72	6.32e-76	0.8985
1. PBF	P0CB58	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.68e-70	3.56e-103	0.9264
1. PBF	Q9CH73	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.09e-66	9.95e-98	0.9282
1. PBF	Q13TY4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.60e-56	6.92e-67	0.8936
1. PBF	Q1GF19	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.21e-46	3.78e-56	0.8737
1. PBF	B1Z8U3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.65e-44	4.99e-61	0.9147
1. PBF	Q7MNV9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.20e-65	9.78e-73	0.9056
1. PBF	A8GVV6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.17e-58	1.10e-64	0.9154
1. PBF	Q133W3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.56e-47	4.78e-64	0.8925
1. PBF	P60396	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.98e-69	6.67e-79	0.9195
1. PBF	Q2LR39	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.01e-64	3.20e-79	0.9095
1. PBF	B7J1N4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.21e-46	4.14e-46	0.8744
1. PBF	Q28NM6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.62e-44	6.63e-55	0.8602
1. PBF	Q9WZX6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.34e-50	3.59e-76	0.931
1. PBF	B1JK89	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8892
1. PBF	C1DTV7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.32e-54	1.61e-56	0.9429
1. PBF	Q71XX2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.56e-73	6.67e-102	0.9432
1. PBF	B0S989	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.97e-59	5.31e-46	0.8882
1. PBF	B9KA96	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.86e-51	1.22e-71	0.9299
1. PBF	B7GGJ0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.60e-76	5.13e-106	0.925
1. PBF	Q49WW1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.69e-68	5.09e-91	0.9083
1. PBF	B8I6G6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.08e-73	1.12e-89	0.93
1. PBF	B4E6K0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.84e-58	1.09e-67	0.8915
1. PBF	B3WDX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-76	3.49e-95	0.9376
1. PBF	Q83SN7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.92e-69	1.31e-74	0.8899
1. PBF	A4SH10	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.67e-56	2.94e-66	0.8808
1. PBF	B0VPF9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-74	8.30e-68	0.9035
1. PBF	A6LEV0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.17e-58	4.13e-66	0.8731
1. PBF	Q8PPB5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.42e-39	2.00e-67	0.8892
1. PBF	B6J5L7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-75	2.36e-75	0.9104
1. PBF	Q8YRT9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-51	1.79e-66	0.892
1. PBF	Q2W0I1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.84e-52	2.44e-63	0.9152
1. PBF	Q11RG6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.19e-68	1.62e-75	0.9069
1. PBF	C6ARU7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.16e-38	1.02e-45	0.8619
1. PBF	A0KPY0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.81e-69	5.42e-71	0.8821
1. PBF	B5ZWK2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.70e-41	1.11e-49	0.865
1. PBF	Q0I6T7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.82e-39	1.78e-46	0.8524
1. PBF	A3MR55	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.9026
1. PBF	A4IM00	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-73	4.17e-96	0.9372
1. PBF	Q65RX8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.92e-65	2.73e-69	0.894
1. PBF	A5EPL2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.09e-45	6.65e-57	0.9035
1. PBF	A1AU69	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.50e-65	3.58e-74	0.9208
1. PBF	P62476	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.24e-57	5.86e-71	0.9381
1. PBF	B0BYK8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.69e-48	9.27e-68	0.9043
1. PBF	B9MQ93	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.79e-76	1.18e-87	0.918
1. PBF	Q0T8B5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.42e-69	1.38e-74	0.8899
1. PBF	Q3Z9L1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.31e-34	1.30e-74	0.9113
1. PBF	A5U4J2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	0.9156
1. PBF	B8GMM1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.20e-65	1.85e-67	0.9093
1. PBF	C4ZD30	Ribosomal RNA small subunit methyltransferase H 2	0.00e+00	5.39e-73	3.86e-94	0.9309
1. PBF	Q7NB79	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.66e-69	7.57e-70	0.9238
1. PBF	Q6MEG4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.46e-62	1.40e-57	0.9002
1. PBF	Q57C70	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8832
1. PBF	B1J1Y2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.47e-63	8.66e-70	0.9007
1. PBF	B5ZBN2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.47e-73	1.01e-82	0.9315
1. PBF	Q5LIJ0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.43e-56	3.56e-68	0.89
1. PBF	A4TBF6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.50e-11	7.04e-63	0.9102
1. PBF	Q3IFZ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.23e-71	4.68e-77	0.9032
1. PBF	C5B9E8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.97e-66	9.33e-65	0.8803
1. PBF	B5RRC5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.03e-51	2.47e-48	0.8944
1. PBF	B4RWY7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.91e-70	3.84e-73	0.8901
1. PBF	A3M9K5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.74e-74	5.56e-69	0.9045
1. PBF	B2RIE4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-56	1.42e-58	0.8735
1. PBF	B6J2R7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.23e-74	2.41e-73	0.908
1. PBF	B9M164	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.32e-66	2.87e-77	0.9042
1. PBF	B1LYT9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.12e-42	1.01e-59	0.9125
1. PBF	B1I953	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	3.18e-102	0.9224
1. PBF	B8D922	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.83e-67	2.54e-66	0.8875
1. PBF	A2CD93	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.51e-46	2.12e-50	0.8524
1. PBF	P62474	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.39e-13	9.22e-65	0.908
1. PBF	Q5GW34	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.94e-46	6.39e-67	0.8876
1. PBF	A7GDE2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.51e-69	3.28e-89	0.915
1. PBF	Q9PPL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.21e-64	6.52e-46	0.8619
1. PBF	Q8DH87	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.33e-48	3.10e-68	0.9261
1. PBF	A9FI25	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.60e-42	3.72e-51	0.8636
1. PBF	B9EB47	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.15e-72	4.02e-95	0.9332
1. PBF	B6YS33	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.28e-61	7.94e-63	0.8765
1. PBF	Q38XN3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.94e-66	3.10e-92	0.9245
1. PBF	B4S6R7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.14e-56	6.46e-63	0.8895
1. PBF	A5GWA2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.75e-58	4.27e-52	0.8699
1. PBF	Q9PF88	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.85e-62	1.59e-65	0.8824
1. PBF	A6WCY2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.14e-19	9.86e-61	0.9167
1. PBF	Q98KA5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.63e-43	3.88e-51	0.8707
1. PBF	A1SL88	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.28e-61	1.79e-61	0.931
1. PBF	Q182Z2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.66e-73	4.54e-98	0.9214
1. PBF	P62477	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.60e-60	2.58e-50	0.8596
1. PBF	Q5PAS3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.39e-52	2.93e-56	0.9348
1. PBF	P75466	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.56e-63	8.46e-58	0.8852
1. PBF	A5VDD4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.47e-46	3.19e-62	0.8818
1. PBF	A3DE34	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.82e-69	5.27e-93	0.9331
1. PBF	A0JV86	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.11e-49	9.05e-63	0.9026
1. PBF	A4XQR6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.35e-65	5.61e-72	0.9004
1. PBF	B2SYY3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.28e-57	4.73e-66	0.8988
1. PBF	A9KM86	Ribosomal RNA small subunit methyltransferase H 2	0.00e+00	8.65e-70	5.51e-92	0.9258
1. PBF	B0V8N7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.74e-74	5.56e-69	0.9038
1. PBF	Q1D0S2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.35e-65	1.38e-59	0.9013
1. PBF	Q3Z5S7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.22e-69	2.92e-74	0.8892
1. PBF	Q5FUK3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.29e-55	3.88e-57	0.9084
1. PBF	Q8ZIF7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8804
1. PBF	Q9PKC2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.98e-57	5.74e-46	0.8824
1. PBF	A4SV66	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.85e-57	4.17e-56	0.8778
1. PBF	A3Q1M6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-17	1.88e-70	0.9191
1. PBF	B2GJQ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-54	5.89e-59	0.904
1. PBF	C4K1M0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.29e-55	9.18e-62	0.9072
1. PBF	Q9HVZ5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.13e-69	1.26e-69	0.9057
1. PBF	A9KY21	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-68	1.63e-68	0.8916
1. PBF	Q9K9S0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.17e-72	2.75e-101	0.9313
1. PBF	Q30SF5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.09e-62	2.30e-56	0.8702
1. PBF	C3MEN7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.26e-41	5.00e-55	0.8807
1. PBF	Q8G4R0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.98e-29	2.74e-59	0.8955
1. PBF	B0KFT4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.60e-62	9.97e-70	0.8979
1. PBF	Q0SRV9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-71	1.09e-88	0.9307
1. PBF	P65430	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	0.9084
1. PBF	Q63QI9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.96e-55	9.10e-68	0.8938
1. PBF	B6IRH0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.96e-49	1.18e-70	0.9079
1. PBF	B1V910	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.73e-70	9.28e-74	0.9354
1. PBF	A9NFP3	Ribosomal RNA small subunit methyltransferase H 1	0.00e+00	4.23e-74	8.92e-88	0.9264
1. PBF	Q2S9Y4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.22e-66	1.97e-81	0.9176
1. PBF	B2G6K1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.12e-61	1.22e-98	0.9251
1. PBF	A7NDP7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.97e-72	3.22e-69	0.9103
1. PBF	B7JK06	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9349
1. PBF	A6H1A2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.05e-64	2.43e-62	0.8943
1. PBF	A4J2A3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.20e-71	2.83e-91	0.9194
1. PBF	Q8CSX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.15e-70	1.17e-91	0.919
1. PBF	Q6AE56	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.30e-59	6.19e-58	0.911
1. PBF	A6L078	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.23e-59	9.52e-66	0.8796
1. PBF	Q07876	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.01e-75	4.87e-99	0.9442
1. PBF	C5J697	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.47e-69	8.64e-78	0.9506
1. PBF	Q9REQ9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.51e-44	1.05e-62	0.9032
1. PBF	B8DSU7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.84e-31	8.12e-58	0.9133
1. PBF	A1BJY6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.98e-60	5.02e-63	0.8919
1. PBF	Q6GHQ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.922
1. PBF	Q216E6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.62e-51	6.16e-52	0.9036
1. PBF	Q57TD8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.04e-69	3.26e-74	0.8859
1. PBF	Q5YYY7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.53e-62	8.58e-58	0.912
1. PBF	A0K478	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.50e-61	2.36e-69	0.9
1. PBF	Q2GCL1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.41e-50	3.22e-72	0.9273
1. PBF	C1KWZ4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.08e-73	5.42e-102	0.9448
1. PBF	Q9KPF9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.30e-70	4.77e-76	0.8999
1. PBF	Q5GTH5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.31e-38	3.31e-57	0.8965
1. PBF	O85295	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.75e-65	6.32e-62	0.8841
1. PBF	Q5WXZ4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.07e-63	2.10e-79	0.9178
1. PBF	A9KET2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.12e-75	1.40e-75	0.9087
1. PBF	B0K8J9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.09e-62	3.29e-89	0.9239
1. PBF	B0K3H8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.09e-62	1.83e-89	0.9232
1. PBF	Q9ZLD4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-57	4.08e-51	0.8687
1. PBF	Q1I5B0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-65	6.53e-71	0.8999
1. PBF	Q32K10	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-68	8.57e-75	0.8839
1. PBF	Q98Q75	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.79e-75	1.47e-88	0.9625
1. PBF	B1L164	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.73e-69	2.77e-88	0.9171
1. PBF	C6AEK6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.13e-41	1.38e-45	0.89
1. PBF	B5XML3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.46e-70	1.03e-100	0.9322
1. PBF	B3DVX0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.12e-59	8.76e-41	0.8736
1. PBF	A9MQD1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.16e-71	2.04e-74	0.8882
1. PBF	B4F119	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.65e-70	4.20e-69	0.8821
1. PBF	C5VZR6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-67	1.03e-97	0.9263
1. PBF	C1CIJ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-68	1.79e-102	0.9282
1. PBF	Q15Q09	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.68e-74	4.72e-74	0.8978
1. PBF	Q326F3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8901
1. PBF	Q3A2F8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-67	2.92e-68	0.9187
1. PBF	C3KCS2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.79e-68	3.53e-68	0.9017
1. PBF	Q62GR9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.9028
1. PBF	Q87AF2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.00e-61	1.85e-66	0.8818
1. PBF	B8F3A8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.19e-71	1.06e-75	0.8952
1. PBF	Q5F6K7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.13e-65	5.34e-69	0.9164
1. PBF	B0JKS7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.29e-55	1.90e-67	0.927
1. PBF	C0MGV8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.20e-68	1.22e-99	0.9261
1. PBF	C1D5M5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.02e-64	1.75e-71	0.9164
1. PBF	Q0HZS4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.75e-67	1.46e-69	0.8947
1. PBF	Q3B121	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.48e-59	1.90e-56	0.8757
1. PBF	P65427	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8901
1. PBF	A0L1Q0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.31e-67	1.94e-69	0.8929
1. PBF	B1LG19	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8809
1. PBF	Q3AW00	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.65e-51	2.03e-49	0.9052
1. PBF	A8EYC5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.86e-49	4.28e-63	0.9005
1. PBF	Q7VE18	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.71e-41	2.69e-53	0.8649
1. PBF	B1XC59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8904
1. PBF	B0S0Y9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.30e-71	2.75e-92	0.9057
1. PBF	A9BUJ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.72e-61	1.85e-58	0.8743
1. PBF	B4SHF1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.43e-53	3.22e-63	0.8878
1. PBF	Q9ZCY2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.12e-56	8.15e-60	0.9136
1. PBF	A1JJI5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.09e-65	3.88e-70	0.8965
1. PBF	Q4FQ05	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.33e-45	2.31e-59	0.8913
1. PBF	A1U3G6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.96e-55	7.79e-74	0.9023
1. PBF	Q929X6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.47e-71	4.96e-101	0.9444
1. PBF	Q2G9A3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.40e-52	1.31e-57	0.868
1. PBF	Q3ZZA4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.53e-35	7.74e-74	0.9076
1. PBF	B5R2L6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8807
1. PBF	Q3K394	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.43e-72	7.75e-98	0.9265
1. PBF	A3CPZ9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.09e-68	5.72e-101	0.9295
1. PBF	B7HM39	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-71	2.62e-100	0.9347
1. PBF	B7MAK5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8905
1. PBF	B1W0I2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.25e-59	6.50e-65	0.9141
1. PBF	Q8R9F9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.82e-63	3.47e-89	0.9206
1. PBF	Q07PU1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.69e-44	1.13e-51	0.8864
1. PBF	Q03QH0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.33e-72	9.03e-94	0.931
1. PBF	Q2JSF0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.32e-41	2.12e-54	0.8718
1. PBF	Q88N84	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.70e-63	3.17e-70	0.899
1. PBF	Q313R1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-48	2.34e-67	0.9125
1. PBF	Q0BV17	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.02e-46	1.67e-71	0.8973
1. PBF	P65431	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9323
1. PBF	A1SU11	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.67e-64	1.04e-70	0.9044
1. PBF	A2SCX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.29e-60	1.77e-69	0.899
1. PBF	C5CNE6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.78e-59	3.74e-60	0.875
1. PBF	A4WQC5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.58e-47	2.46e-58	0.864
1. PBF	O69560	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-23	7.43e-65	0.9053
1. PBF	A7MIE1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.08e-68	4.76e-69	0.8861
1. PBF	Q5X6J0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.07e-63	2.10e-79	0.9203
1. PBF	B9KD58	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.38e-58	1.15e-39	0.8471
1. PBF	A5VJ28	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.12e-61	1.22e-98	0.929
1. PBF	Q5FH93	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.50e-58	4.83e-63	0.9279
1. PBF	Q0HE75	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.95e-67	2.26e-69	0.8915
1. PBF	A7ZHH3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8786
1. PBF	A3NZM3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.14e-58	7.57e-68	0.9027
1. PBF	O67721	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.07e-57	4.98e-79	0.9311
1. PBF	A9I4S5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.25e-35	4.82e-56	0.894
1. PBF	Q4K6I5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.08e-67	2.01e-69	0.9018
1. PBF	Q88V76	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.68e-66	3.57e-100	0.9443
1. PBF	Q39JX8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.79e-61	3.92e-69	0.8928
1. PBF	A6VQP1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.07e-70	2.62e-68	0.9025
1. PBF	A8EUF3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.16e-56	1.74e-53	0.8836
1. PBF	Q7VP62	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.00e-65	2.25e-70	0.8935
1. PBF	B0CHM8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.60e-41	1.20e-51	0.8899
1. PBF	Q0TLQ7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8909
1. PBF	B6ELI3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.64e-68	7.86e-76	0.9036
1. PBF	P57319	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.83e-67	2.54e-66	0.8889
1. PBF	A1VSU4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.85e-64	1.35e-56	0.8773
1. PBF	Q1IKG1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.94e-40	2.40e-66	0.8868
1. PBF	A0QF44	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.51e-13	1.36e-64	0.9091
1. PBF	A2RD40	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9312
1. PBF	B8IZT3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-57	7.54e-53	0.9041
1. PBF	B3GZK0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.55e-68	2.20e-71	0.9012
1. PBF	A5I1T3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.65e-69	3.78e-89	0.9159
1. PBF	B4SU42	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.72e-70	7.98e-74	0.8808
1. PBF	A0RNH4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.72e-56	2.96e-45	0.8509
1. PBF	B2GB73	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.12e-74	3.23e-97	0.9272
1. PBF	A5W8Q8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.09e-63	2.81e-70	0.8994
1. PBF	B5FI64	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8812
1. PBF	B0RVB2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.61e-37	1.66e-66	0.898
1. PBF	B3QLX2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.60e-64	4.44e-69	0.8999
1. PBF	A9B518	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.55e-50	1.14e-72	0.9233
1. PBF	B8DP86	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.00e-39	4.72e-67	0.908
1. PBF	B2S017	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-51	1.96e-47	0.8896
1. PBF	A5FSB7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.53e-35	7.74e-74	0.9115
1. PBF	A1V0S6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.8938
1. PBF	Q21SW1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.55e-51	2.12e-54	0.8696
1. PBF	Q1ME25	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.58e-41	7.16e-53	0.8662
1. PBF	B8ZL51	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-70	2.25e-103	0.9278
1. PBF	Q6G116	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.37e-42	3.03e-45	0.878
1. PBF	P60399	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.06e-76	6.45e-94	0.935
1. PBF	C1CCA8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.40e-68	2.85e-102	0.9301
1. PBF	Q03J09	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.44e-71	2.34e-101	0.9293
1. PBF	Q0VS10	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.93e-71	2.14e-70	0.9001
1. PBF	B7LWH0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8874
1. PBF	Q0BKT7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.97e-72	3.22e-69	0.91
1. PBF	Q4UL18	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.10e-59	8.88e-63	0.9033
1. PBF	B5Y1V5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-70	9.95e-73	0.8918
1. PBF	Q0A6J4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.52e-57	2.17e-66	0.8962
1. PBF	Q21MH7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.35e-71	1.74e-76	0.8986
1. PBF	A8Z694	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.37e-62	1.01e-47	0.8963
1. PBF	A4IZB0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.65e-63	1.01e-67	0.9075
1. PBF	B1XP73	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.44e-54	5.10e-68	0.9341
1. PBF	B6HZ59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8894
1. PBF	A1QZA2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.18e-52	4.51e-49	0.8834
1. PBF	B2UTC1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.83e-59	6.06e-50	0.8691
1. PBF	Q7V4B2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-46	1.57e-50	0.8677
1. PBF	Q04Y87	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.09e-51	6.26e-54	0.8895
1. PBF	B2S6R2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8899
1. PBF	Q5PDH4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-70	2.16e-73	0.8784
1. PBF	Q2FHQ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9262
1. PBF	B9DV78	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.39e-71	1.33e-99	0.9336
1. PBF	A7HNY7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-54	1.34e-74	0.9385
1. PBF	Q2SZJ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.43e-58	4.32e-68	0.9002
1. PBF	Q17XC0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.95e-62	8.92e-51	0.8719
1. PBF	B7IAX1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.23e-73	5.10e-69	0.9037
1. PBF	Q83F35	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-75	2.36e-75	0.9096
1. PBF	B8G5X3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.85e-57	1.11e-71	0.9239
1. PBF	P60392	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9293
1. PBF	Q10VG1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.26e-58	2.40e-68	0.9657
1. PBF	Q1CTG3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.01e-59	1.25e-48	0.8615
1. PBF	C3KV90	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.97e-69	4.75e-89	0.9158
1. PBF	B1YSR6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.79e-61	1.80e-69	0.8936
1. PBF	Q7UFX8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.10e-26	9.17e-48	0.8652
1. PBF	Q1RGB3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8905
1. PBF	Q0K6L6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.57e-52	4.56e-68	0.8932
1. PBF	Q1J0B6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.04e-49	6.86e-65	0.8763
1. PBF	A1UTD3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.00e-43	1.41e-43	0.8789
1. PBF	A9WG80	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.63e-56	6.64e-65	0.9263
1. PBF	Q9Z8C2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.91e-49	7.63e-44	0.8839
1. PBF	Q1QVF9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.50e-40	2.49e-64	0.8913
1. PBF	C6A8W4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.84e-31	8.12e-58	0.9099
1. PBF	P0DC37	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9335
1. PBF	A8FLC2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.25e-64	7.82e-48	0.8667
1. PBF	Q7V3B1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.21e-41	1.28e-41	0.8937
1. PBF	B2TS30	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.46e-70	8.15e-86	0.9281
1. PBF	Q82AE4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.89e-64	5.79e-66	0.9163
1. PBF	C5WIJ4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.46e-70	1.18e-97	0.933
1. PBF	O07104	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.22e-72	1.23e-107	0.9272
1. PBF	P62471	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.25e-65	4.32e-86	0.9143
1. PBF	A8GP28	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.85e-62	2.43e-63	0.9014
1. PBF	A1WC14	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.18e-59	1.13e-64	0.8757
1. PBF	C3LQV4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.30e-70	4.77e-76	0.9032
1. PBF	C3L6F3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9291
1. PBF	Q0TP92	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-71	1.09e-88	0.9296
1. PBF	A6T4M5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.22e-69	1.33e-72	0.8821
1. PBF	Q8KGC6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.43e-62	2.92e-74	0.9009
1. PBF	P65433	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9353
1. PBF	Q1RJ43	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-58	2.83e-65	0.9059
1. PBF	B7K639	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.10e-41	1.11e-67	0.8857
1. PBF	B8H0A2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.20e-53	5.54e-51	0.8865
1. PBF	A8ALL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.47e-69	2.08e-74	0.8765
1. PBF	Q66EL3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8911
1. PBF	B8E088	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.84e-48	1.39e-69	0.9296
1. PBF	B2J183	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.59e-43	5.52e-67	0.8976
1. PBF	Q7NCQ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.05e-32	1.26e-61	0.8692
1. PBF	B2SDL2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.53e-73	1.61e-69	0.9091
1. PBF	B2IGF2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.08e-35	3.23e-57	0.909
1. PBF	Q1GYZ3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.48e-56	1.23e-82	0.9241
1. PBF	B5YZB8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8811
1. PBF	C7BZ94	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.41e-59	4.21e-50	0.8702
1. PBF	B2UCY5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.33e-57	5.42e-72	0.9077
1. PBF	Q7VGP1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.88e-51	1.02e-47	0.8679
1. PBF	Q2IYL6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.21e-43	3.16e-66	0.909
1. PBF	A0LTL5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-51	4.09e-59	0.9047
1. PBF	Q253Y0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.57e-45	4.15e-48	0.9023
1. PBF	Q2SS95	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.65e-92	0.0	0.9958
1. PBF	A9KS30	Ribosomal RNA small subunit methyltransferase H 1	0.00e+00	1.68e-06	4.12e-49	0.8778
1. PBF	B2A2G4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.44e-68	1.12e-77	0.9183
1. PBF	Q31D10	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.46e-41	2.62e-48	0.8864
1. PBF	B7GVN1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.74e-74	5.56e-69	0.9042
1. PBF	B3R0Q2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.65e-70	6.02e-83	0.9305
1. PBF	C0QWF7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.93e-51	4.07e-37	0.9144
1. PBF	C4LI42	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.38e-20	1.55e-54	0.8877
1. PBF	Q3AGW9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.26e-52	7.67e-50	0.894
1. PBF	A1REY8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.16e-69	1.74e-68	0.8912
1. PBF	Q0RNP9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.60e-50	6.57e-53	0.9121
1. PBF	C4ZQ04	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8905
1. PBF	B5Z772	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.74e-60	1.92e-49	0.8715
1. PBF	A6Q7Y2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.83e-59	2.33e-56	0.8826
1. PBF	B8FBS6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.83e-51	2.14e-64	0.8925
1. PBF	C1CBB2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.38e-69	1.52e-102	0.9276
1. PBF	B0US59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.93e-69	1.57e-67	0.8824
1. PBF	Q5WFG1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.00e-72	2.72e-98	0.9415
1. PBF	Q4A9T0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-68	3.97e-66	0.9457
1. PBF	A8LSB5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.32e-43	1.02e-48	0.8753
1. PBF	Q1JFK8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9322
1. PBF	Q0AMV9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.08e-37	8.85e-57	0.9014
1. PBF	B1MP29	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.81e-11	2.71e-57	0.9159
1. PBF	A7X1B8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9281
1. PBF	O07665	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.07e-70	2.70e-101	0.9352
1. PBF	Q9RT99	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.21e-37	1.65e-67	0.8715
1. PBF	Q47A96	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.27e-65	3.24e-79	0.903
1. PBF	A5WBQ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.42e-43	3.76e-62	0.8966
1. PBF	A0RHT9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.934
1. PBF	B0U504	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.74e-61	2.46e-67	0.8818
1. PBF	Q2A265	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.97e-72	3.22e-69	0.9089
1. PBF	Q8DVM7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.10e-71	7.02e-104	0.9326
1. PBF	Q636A8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9341
1. PBF	Q6D0H5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.07e-69	5.01e-69	0.8824
1. PBF	A6QG79	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.34e-65	3.21e-94	0.9293
1. PBF	Q9K0Z0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.81e-59	1.12e-69	0.9062
1. PBF	A4W6I5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.97e-69	2.58e-72	0.8837
1. PBF	Q8EW81	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.53e-62	1.32e-79	0.9044
1. PBF	A8H992	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.03e-68	3.04e-69	0.9002
1. PBF	Q24TD8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.71e-69	5.40e-83	0.9205
1. PBF	C0R598	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.60e-60	1.70e-63	0.9246
1. PBF	Q02H20	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.82e-69	4.60e-69	0.9027
1. PBF	C0Q8N5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.01e-59	9.02e-70	0.922
1. PBF	C6GW75	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-67	1.03e-97	0.9283
1. PBF	Q5L0Y4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.61e-73	6.77e-97	0.9372
1. PBF	Q12SD4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.75e-72	1.67e-72	0.8917
1. PBF	C4LA17	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.14e-64	6.02e-74	0.8887
1. PBF	A7MWK7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.37e-64	4.56e-71	0.9061
1. PBF	C5BW67	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.94e-58	3.70e-56	0.9022
1. PBF	A1TAX6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.21e-11	4.30e-65	0.9148
1. PBF	Q057T6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.69e-67	5.15e-61	0.8915
1. PBF	A1VZ48	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.30e-63	6.66e-48	0.8674
1. PBF	Q8Y5L7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.51e-73	6.53e-102	0.9457
1. PBF	Q8KTR3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.71e-48	1.69e-27	0.81
1. PBF	P59522	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.20e-71	6.26e-68	0.8993
1. PBF	Q8GE08	Ribosomal RNA small subunit methyltransferase H (Fragment)	0.00e+00	1.03e-68	1.69e-78	0.9125
1. PBF	Q3ANW1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.99e-57	2.70e-58	0.8872
1. PBF	A6WIC3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-68	1.63e-68	0.8973
1. PBF	Q8XVH9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.85e-59	1.47e-70	0.9079
1. PBF	A7H4D2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.12e-60	6.40e-47	0.8656
1. PBF	O51286	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.22e-47	7.21e-46	0.8718
1. PBF	Q6KHR2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.04e-73	3.28e-76	0.9263
1. PBF	P62473	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-123	0.0	0.9984
1. PBF	B0BRG9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.59e-68	1.49e-71	0.9024
1. PBF	C1AU63	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.01e-47	1.45e-60	0.9078
1. PBF	A5D113	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.17e-66	1.14e-82	0.9192
1. PBF	A6T2G6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.66e-52	1.82e-72	0.9048
1. PBF	A8AVS9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.51e-68	2.18e-100	0.925
1. PBF	B2JHG8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.05e-58	1.37e-64	0.8966
1. PBF	B1MXV5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-73	2.78e-92	0.9237
1. PBF	Q600P9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.99e-68	2.34e-66	0.9414
1. PBF	Q67Q57	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.46e-64	1.67e-83	0.921
1. PBF	B2U287	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.89
1. PBF	A5FUK2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.92e-58	2.76e-57	0.8993
1. PBF	B8E4L2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-68	1.63e-68	0.892
1. PBF	A7GRP4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.08e-73	4.07e-98	0.9339
1. PBF	B8HTI9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.51e-47	4.62e-63	0.9094
1. PBF	A1KKK8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	0.9161
1. PBF	Q9JSY9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-57	2.04e-68	0.9008
1. PBF	A4YZL1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.71e-46	2.06e-63	0.904
1. PBF	A0R024	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.29e-12	1.24e-62	0.9146
1. PBF	A9VU80	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-72	5.06e-101	0.9342
1. PBF	B4TJ79	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8886
1. PBF	B8HGW2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.41e-50	1.02e-61	0.904
1. PBF	C6DZJ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.24e-65	2.25e-76	0.9154
1. PBF	A5IFZ9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.43e-65	4.90e-80	0.9194
1. PBF	B3CVD8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.45e-57	2.90e-52	0.8998
1. PBF	Q2RK87	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.26e-59	3.86e-70	0.9038
1. PBF	Q6A9R0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.60e-50	2.44e-62	0.9099
1. PBF	B3QFN9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.30e-48	3.82e-66	0.9077
1. PBF	C0RE78	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8829
1. PBF	Q83HJ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.51e-55	2.12e-61	0.8953
1. PBF	Q92NL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.30e-43	9.48e-54	0.877
1. PBF	B2S2Y1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.12e-24	1.74e-29	0.8552
1. PBF	A8Z3M0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9288
1. PBF	B1XY20	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.82e-60	5.11e-59	0.9087
1. PBF	A8G2H7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.24e-41	3.75e-46	0.8843
1. PBF	P62469	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.27e-28	5.99e-48	0.8529
1. PBF	Q0BIK9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.74e-62	1.70e-69	0.8924
1. PBF	Q2KVE4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.99e-41	1.65e-57	0.8946
1. PBF	Q1J5F8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.73e-70	6.39e-99	0.9326
1. PBF	B1I4D9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.84e-64	2.28e-79	0.9195
1. PBF	Q8FNT2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.97e-55	1.62e-58	0.8954
1. PBF	P62478	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.15e-46	4.65e-57	0.8747
1. PBF	Q5SJD8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-57	1.20e-70	0.9378
1. PBF	B7MNU1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.52e-69	3.32e-74	0.8898
1. PBF	A4Y2M8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.16e-69	1.74e-68	0.8938
1. PBF	P47464	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.22e-62	1.88e-61	0.9077
1. PBF	P9WJP0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	0.915
1. PBF	Q02ZY9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-65	1.05e-97	0.9257
1. PBF	P62468	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.24e-71	3.64e-100	0.9341
1. PBF	P65428	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8903
1. PBF	B1ZU25	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.62e-56	1.71e-53	0.8955
1. PBF	B7H6Q4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.93e-72	3.87e-102	0.9339
1. PBF	Q01Q40	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.60e-54	3.94e-54	0.946
1. PBF	B8CWI8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.49e-68	5.88e-86	0.9073
1. PBF	A4XHZ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.24e-76	3.54e-90	0.9169
1. PBF	C0ZGB3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.88e-65	3.93e-95	0.9215
1. PBF	Q6GA33	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.922
1. PBF	B9L9G3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.09e-64	1.70e-50	0.8477
1. PBF	C1DQ91	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.09e-66	6.51e-69	0.9012
1. PBF	B3PTW8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.33e-43	1.68e-52	0.8677
1. PBF	Q5FKV7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.17e-61	6.25e-83	0.9069
1. PBF	C1CPL0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.16e-69	2.02e-103	0.9271
1. PBF	A8F247	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.95e-56	4.13e-64	0.9031
1. PBF	Q14ID3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-73	3.12e-68	0.9112
1. PBF	Q2GK29	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.37e-55	4.10e-49	0.9319
1. PBF	Q0SNK4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.41e-46	5.21e-43	0.891
1. PBF	Q89FT9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.79e-50	4.23e-60	0.9069
1. PBF	B7IEL8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.96e-54	3.52e-77	0.9414
1. PBF	A8GSS6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.11e-54	1.41e-63	0.9064
1. PBF	A3PAN9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.66e-43	2.58e-45	0.8854
1. PBF	A0LNY2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.99e-63	1.72e-73	0.9158
1. PBF	C4L5T9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.47e-71	9.05e-102	0.938
1. PBF	A6LTS0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-70	8.71e-85	0.9312
1. PBF	C4XK86	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.30e-58	1.29e-58	0.9026
1. PBF	Q04MC7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.40e-68	2.85e-102	0.9299
1. PBF	Q604V0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.66e-66	1.15e-68	0.8982
1. PBF	A7HVT9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.49e-45	4.94e-59	0.9136
1. PBF	C1FME6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.17e-69	2.20e-89	0.9177
1. PBF	P60398	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.02e-46	5.63e-66	0.9085
1. PBF	A8MH28	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.06e-69	8.00e-92	0.9315
1. PBF	C0QP68	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.45e-53	1.23e-65	0.933
1. PBF	Q48RZ0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9335
1. PBF	Q81WC3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9338
1. PBF	A6UB93	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.43e-41	2.46e-48	0.8857
1. PBF	Q8E1R8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.43e-72	7.75e-98	0.9271
1. PBF	Q8PCK7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.61e-37	1.66e-66	0.8879
1. PBF	B0T839	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.41e-50	1.60e-55	0.8944
1. PBF	A1WRK3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.34e-40	6.36e-60	0.8893
1. PBF	Q5HGQ2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.34e-65	3.21e-94	0.928
1. PBF	A5IYG2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.76e-74	2.25e-89	0.9517
1. PBF	Q64ZL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.48e-56	2.14e-68	0.8799
1. PBF	C4K744	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.58e-71	5.37e-71	0.8996
1. PBF	B5FB43	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.86e-72	1.54e-75	0.9029
1. PBF	Q2GGS8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.12e-61	5.05e-63	0.9216
1. PBF	B5ELD1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.93e-55	4.75e-63	0.8998
1. PBF	A8LX88	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.22e-30	2.37e-64	0.9031
1. PBF	Q03W30	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-74	5.10e-90	0.9086
1. PBF	C1EPT2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-72	3.42e-101	0.9342
1. PBF	A7ZW34	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8881
1. PBF	B8IMX2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.56e-41	4.19e-66	0.9127
1. PBF	A5CX97	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.22e-74	1.31e-66	0.9075
1. PBF	B5F7V6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8854
1. PBF	B1AJ25	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.21e-75	7.50e-81	0.9387
1. PBF	Q5R5T5	12S rRNA N4-methylcytidine methyltransferase	0.00e+00	3.08e-16	3.46e-49	0.8971
1. PBF	A7IGF4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-36	1.21e-62	0.9034
1. PBF	B1WZ70	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.78e-30	1.11e-66	0.8743
1. PBF	Q2JD58	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.84e-45	5.84e-54	0.8922
1. PBF	A4VIH0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.09e-64	1.26e-69	0.9052
1. PBF	B3DQM3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.98e-29	2.74e-59	0.8959
1. PBF	A1KVM4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.01e-58	1.78e-70	0.9048
1. PBF	C0Q5H8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.875
1. PBF	A7HH59	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.01e-59	1.14e-49	0.91
1. PBF	Q39YM7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	4.52e-73	0.9245
1. PBF	Q8DEK2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.20e-65	9.78e-73	0.904
1. PBF	A2S5V3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.34e-57	2.60e-68	0.9031
1. PBF	C3PNZ9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.19e-56	1.15e-62	0.9046
1. PBF	Q5M2U6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.02e-70	2.69e-101	0.9284
1. PBF	B3E3Z0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.31e-68	3.71e-69	0.9161
1. PBF	A1K3T8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.33e-66	4.83e-64	0.9047
1. PBF	B8ZQP2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-23	7.43e-65	0.905
1. PBF	A4X9S3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.50e-29	1.73e-64	0.9089
1. PBF	Q8FL68	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-70	1.57e-74	0.8776
1. PBF	A3CZL3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.71e-68	1.63e-68	0.8832
1. PBF	B2V5J5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.51e-60	3.33e-58	0.9387
1. PBF	B3ESS3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.89e-60	2.23e-60	0.8771
1. PBF	B1KKY5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.40e-71	1.68e-68	0.8949
1. PBF	Q7U3X9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.15e-52	6.59e-49	0.8981
1. PBF	B1VHD2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.04e-45	7.14e-53	0.9074
1. PBF	Q0AJD3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.55e-58	5.60e-76	0.9051
1. PBF	Q4JWA3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.61e-53	4.04e-53	0.8943
1. PBF	C4ZBW8	Ribosomal RNA small subunit methyltransferase H 1	0.00e+00	6.32e-14	1.54e-44	0.88
1. PBF	B7J3W0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.93e-55	4.75e-63	0.9059
1. PBF	B7IVF3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.58e-72	1.21e-101	0.9343
1. PBF	A8FCX3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.18e-76	1.13e-99	0.9412
1. PBF	A3PHR7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.20e-46	1.31e-59	0.873
1. PBF	Q1QNV1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-48	3.74e-59	0.8836
1. PBF	Q2Y630	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.75e-70	2.96e-78	0.9249
1. PBF	O84274	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.54e-56	3.10e-45	0.8907
1. PBF	Q4L5N0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.99e-68	1.59e-91	0.9255
1. PBF	C1D1L8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.65e-50	4.47e-65	0.8912
1. PBF	Q7N139	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.68e-69	1.25e-67	0.893
1. PBF	B0UFI0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.94e-44	3.08e-64	0.8992
1. PBF	C6GPU1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-67	1.03e-97	0.9294
1. PBF	A5FIX6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.75e-64	1.44e-66	0.8889
1. PBF	A8HZ68	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.02e-36	7.64e-62	0.8845
1. PBF	A7NIA2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.55e-40	1.43e-65	0.8951
1. PBF	A9R132	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8796
1. PBF	B2ISQ2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-70	2.25e-103	0.9305
1. PBF	Q661V8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.59e-44	4.23e-41	0.8784
1. PBF	A6LNR5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-53	3.80e-77	0.95
1. PBF	B7UID2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.26e-70	1.74e-75	0.8902
1. PBF	B7M125	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8844
1. PBF	Q042P4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.64e-65	1.41e-87	0.9042
1. PBF	Q07WH7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.56e-70	1.34e-68	0.8956
1. PBF	A6U0Z9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	0.9299
1. PBF	Q4ZNY2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.51e-68	5.11e-66	0.9024
1. PBF	Q46WY6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.51e-53	1.18e-69	0.8876
1. PBF	B1LCF9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.01e-53	5.85e-76	0.933
1. PBF	Q823N6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.89e-46	6.26e-48	0.8956
1. PBF	A9IWB6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.87e-42	2.23e-43	0.8849
1. PBF	Q5P6Y9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.22e-69	1.37e-65	0.9122
1. PBF	C5BP42	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.08e-60	1.87e-73	0.8983
1. PBF	Q5LY91	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.44e-71	2.34e-101	0.9315
1. PBF	P45057	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.29e-68	3.24e-67	0.8955
1. PBF	B2KE60	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.56e-59	7.41e-53	0.9257
1. PBF	A5UZS9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.84e-38	2.51e-69	0.895
1. PBF	Q1GRX1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.33e-38	4.01e-54	0.8931
1. PBF	Q9AJG9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.27e-68	2.40e-75	0.8959
1. PBF	A9M698	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-40	1.78e-51	0.8827
1. PBF	Q8ER53	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.18e-60	2.41e-91	0.9232
1. PBF	Q47QX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.95e-42	2.59e-63	0.915
1. PBF	B9IVZ5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.24e-71	3.64e-100	0.9342
1. PBF	Q87WX7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.78e-68	1.18e-64	0.9021
1. PBF	Q8XJ96	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.26e-69	2.54e-88	0.9292
1. PBF	B6JLU2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.74e-62	4.47e-49	0.8717
1. PBF	Q4A667	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.76e-71	2.94e-82	0.9477
1. PBF	Q31I68	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.58e-65	6.37e-73	0.8987
1. PBF	Q82VT1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.54e-57	7.67e-76	0.898
1. PBF	Q8R6F5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.99e-68	4.66e-86	0.9038
1. PBF	Q65JY8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.21e-75	1.82e-94	0.9377
1. PBF	B7KU77	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.12e-39	9.89e-64	0.9128
1. PBF	A3MY82	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-69	9.16e-72	0.8833
1. PBF	A6VYK6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.47e-63	2.59e-76	0.9045
1. PBF	Q04ES5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.56e-67	3.07e-96	0.9265
1. PBF	Q819P8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.58e-72	1.21e-101	0.9299
1. PBF	Q7VUP6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.26e-34	5.33e-62	0.9026
1. PBF	Q2NZB1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.49e-45	4.96e-68	0.8884
1. PBF	B7UZJ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.38e-69	2.30e-69	0.9039
1. PBF	Q163I0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.01e-45	4.60e-51	0.863
1. PBF	B5YFU3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.02e-63	2.05e-66	0.9243
1. PBF	B5RH56	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8908
1. PBF	B7K9F0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.13e-37	1.52e-68	0.8885
1. PBF	A0PTJ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.43e-11	4.77e-56	0.9042
1. PBF	A0M534	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.26e-65	4.01e-61	0.8828
1. PBF	B2SNY6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.49e-45	4.96e-68	0.9008
1. PBF	C5ATZ5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.07e-40	2.01e-64	0.9097
1. PBF	B8D7C6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.38e-67	1.59e-65	0.8895
1. PBF	A1AVX1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.39e-73	1.49e-68	0.9092
1. PBF	Q8Z9H4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.16e-71	5.71e-74	0.8814
1. PBF	Q2NVV9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.81e-71	4.48e-68	0.8989
1. PBF	Q3AAD7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.12e-63	1.56e-85	0.9073
1. PBF	A1A7C7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8863
1. PBF	A8ZXX1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.79e-61	6.29e-63	0.9213
1. PBF	B1XT01	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.69e-58	8.08e-58	0.8467
1. PBF	Q3STT6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.52e-50	4.69e-51	0.883
1. PBF	Q4UQW3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.97e-37	5.93e-65	0.897
1. PBF	Q9AJH1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.11e-65	9.06e-73	0.8903
1. PBF	A6Q3T0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.71e-60	3.99e-56	0.8689
1. PBF	A1S2F1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.16e-69	3.85e-72	0.8945
1. PBF	A9NGP8	Ribosomal RNA small subunit methyltransferase H 2	0.00e+00	1.12e-13	5.58e-48	0.844
1. PBF	B5EBP3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.60e-67	2.21e-70	0.9155
1. PBF	C6CJW6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.31e-68	2.26e-64	0.8937
1. PBF	C5CA38	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.05e-51	1.26e-55	0.9055
1. PBF	P58745	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.19e-44	2.85e-51	0.8836
1. PBF	Q9S2W4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.56e-63	1.32e-62	0.8994
1. PBF	A6TS69	Ribosomal RNA small subunit methyltransferase H 1	0.00e+00	3.89e-70	5.79e-88	0.9259
1. PBF	A1AZK1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.88e-45	3.28e-57	0.8726
1. PBF	Q1B6W3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.26e-17	2.71e-66	0.9194
1. PBF	Q8E782	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.66e-72	3.29e-99	0.9286
1. PBF	A9H0G9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.26e-41	8.91e-58	0.9014
1. PBF	B2V4W0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.00e-69	4.84e-86	0.9293
1. PBF	P73460	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.33e-41	6.95e-68	0.8807
1. PBF	B7GQ70	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.11e-29	3.78e-58	0.8969
1. PBF	Q9RQJ6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.20e-53	5.54e-51	0.886
1. PBF	A1R5F0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.41e-50	3.26e-60	0.8997
1. PBF	Q1C206	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8735
1. PBF	Q5L6B5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.11e-43	4.05e-46	0.8868
1. PBF	A7Z4D7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.70e-74	2.06e-97	0.9344
1. PBF	B8DH88	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.53e-74	2.61e-102	0.9453
1. PBF	Q9PQA4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.21e-75	7.50e-81	0.9376
1. PBF	A3QIM9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.13e-67	2.65e-68	0.893
1. PBF	B8ETL4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.36e-41	1.32e-60	0.9119
1. PBF	A6WZP8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.92e-40	2.69e-50	0.891
1. PBF	B3R6W7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.61e-53	2.22e-69	0.8931
1. PBF	A7FTX8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.65e-69	3.78e-89	0.9153
1. PBF	B9JY62	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.06e-40	2.82e-48	0.8833
1. PBF	A5CD85	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.49e-60	3.23e-55	0.8893
1. PBF	P62475	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.43e-67	2.36e-72	0.8897
1. PBF	B5E6Z2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.70e-68	1.79e-102	0.9274
1. PBF	Q4A7X8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.38e-68	3.97e-66	0.9469
1. PBF	B2K4D8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.35e-66	9.60e-72	0.8731
1. PBF	Q1GAU0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-60	1.03e-88	0.9211
1. PBF	B0SRS3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.97e-59	5.31e-46	0.8818
1. PBF	C6C9K0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.70e-63	2.28e-68	0.8985
1. PBF	A2BUE8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.02e-41	1.93e-47	0.8896
1. PBF	B9KNI8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.57e-45	1.11e-60	0.8749
1. PBF	Q7MWN0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.51e-57	1.06e-58	0.8759
1. PBF	B8J8E0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.68e-64	1.22e-50	0.9115
1. PBF	Q8D2Y8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.53e-64	5.18e-60	0.8714
1. PBF	B7LFV2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	0.8908
1. PBF	Q2NCZ8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.37e-54	2.78e-56	0.8707
1. PBF	A9NA25	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.99e-75	2.36e-75	0.9094
1. PBF	A4SI48	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.03e-70	1.32e-70	0.8887
1. PBF	Q3SMI1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.69e-68	1.13e-73	0.9037
1. PBF	B7VIZ5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.44e-68	1.82e-74	0.8942
1. PBF	A7GYX6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.53e-62	3.33e-51	0.8575
1. PBF	Q7WFR5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.26e-34	5.33e-62	0.8956
1. PBF	Q3J781	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.95e-68	1.28e-66	0.8986
1. PBF	Q2YXE3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.99e-66	2.02e-93	0.9267
1. PBF	B2I0K7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.74e-74	5.56e-69	0.904
1. PBF	B9LKK0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.63e-56	6.64e-65	0.9278
1. PBF	A4FLX5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.18e-50	3.91e-57	0.9199
1. PBF	B2FNN0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.84e-46	5.16e-69	0.903
1. PBF	B3CMB5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.43e-62	1.62e-60	0.9379
1. PBF	Q8F4J6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.86e-41	2.87e-50	0.891
1. PBF	B4TXH0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.89e-70	8.07e-74	0.8785
1. PBF	C1F466	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.69e-54	2.14e-67	0.9257
1. PBF	Q1BZH1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.14e-62	5.47e-68	0.8899
1. PBF	Q9F1N8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.28e-73	5.90e-69	0.8934
1. PBF	B8FT64	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.71e-69	5.40e-83	0.9073
1. PBF	B0TGB2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.25e-63	2.27e-74	0.9126
1. PBF	B1HPY0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.21e-68	2.86e-99	0.9324
1. PBF	B2HGS5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.72e-11	8.04e-59	0.9076
1. PBF	Q0SHR3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.13e-46	5.48e-60	0.9039
1. PBF	B9DPQ9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.27e-67	1.90e-89	0.9263
1. PBF	P62472	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.71e-41	2.50e-50	0.8831
1. PBF	B4SJW8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.22e-45	2.52e-67	0.899
1. PBF	B7NHI8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.04e-68	2.95e-74	0.8876
1. PBF	Q5HV88	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.59e-63	2.64e-47	0.8569
1. PBF	P60397	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.95e-67	3.27e-76	0.9228
1. PBF	Q04B77	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.25e-60	1.03e-88	0.9245
1. PBF	C6D563	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.40e-69	2.05e-96	0.9346
1. PBF	C6BEJ1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.41e-57	1.90e-71	0.9074
1. PBF	Q1LSW0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.85e-68	1.82e-68	0.8878
1. PBF	C3PHG4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.32e-49	2.17e-50	0.8921
1. PBF	A8YUN6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.48e-59	6.45e-81	0.9183
1. PBF	Q04V89	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.30e-51	5.50e-54	0.8902
1. PBF	P0DC36	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.81e-70	1.12e-100	0.9346
1. PBF	B9KIK0	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.21e-51	2.96e-56	0.9347
1. PBF	A0Q5I5	Ribosomal RNA small subunit methyltransferase H	0.00e+00	9.86e-73	2.80e-69	0.9105
1. PBF	C5CGS3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.16e-56	9.43e-70	0.926
1. PBF	A2RLT4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-65	1.05e-97	0.9289
1. PBF	P60395	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.64e-43	1.36e-60	0.9012
1. PBF	A9M2I4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	8.86e-58	4.03e-68	0.9009
1. PBF	B0BBQ3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.04e-55	2.94e-45	0.8865
1. PBF	B5RLD2	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.71e-52	3.08e-47	0.8897
1. PBF	B8CM48	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.03e-67	1.37e-67	0.8965
1. PBF	A7I1J3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	7.12e-62	4.04e-51	0.8581
1. PBF	B3EIL6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.96e-59	5.28e-70	0.8785
1. PBF	Q3BXF9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.85e-43	3.47e-68	0.8904
1. PBF	B9L274	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.10e-52	6.81e-65	0.9081
1. PBF	B5BLG4	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.83e-70	2.16e-73	0.8832
1. PBF	A8KZA9	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.06e-53	2.72e-60	0.9219
1. PBF	Q97H81	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.23e-71	4.28e-97	0.9261
1. PBF	A4G8U6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.44e-58	2.50e-72	0.9083
1. PBF	B1YIU3	Ribosomal RNA small subunit methyltransferase H	0.00e+00	5.56e-73	4.09e-99	0.9357
1. PBF	B2VD83	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.91e-64	4.49e-71	0.8923
1. PBF	A2BNW6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	3.26e-43	1.70e-47	0.8694
1. PBF	A0JN95	12S rRNA N4-methylcytidine methyltransferase	0.00e+00	5.70e-14	3.48e-50	0.8846
1. PBF	B0B7I8	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.04e-55	2.94e-45	0.8888
1. PBF	B4U8T1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.13e-59	1.41e-60	0.9161
1. PBF	Q7W4A7	Ribosomal RNA small subunit methyltransferase H	0.00e+00	6.26e-34	5.33e-62	0.8958
1. PBF	Q2RVT6	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.24e-53	9.87e-64	0.9056
1. PBF	O25411	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.22e-58	9.06e-49	0.8708
1. PBF	A5GP74	Ribosomal RNA small subunit methyltransferase H	0.00e+00	2.44e-44	9.27e-51	0.8714
4. PB	P60393	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.83e-65	4.17e-94	NA
4. PB	P9WJP1	Ribosomal RNA small subunit methyltransferase H	0.00e+00	1.31e-10	2.43e-69	NA
4. PB	Q2NIH4	Ribosomal RNA small subunit methyltransferase H	NA	7.43e-69	3.47e-71	NA
4. PB	P60390	Ribosomal RNA small subunit methyltransferase H	0.00e+00	4.25e-69	8.39e-75	NA
4. PB	Q9DCL4	12S rRNA N4-methylcytidine methyltransferase	0.00e+00	6.84e-15	5.93e-51	NA
4. PB	Q9VGY5	Probable methyltransferase-like protein 15 homolog	0.00e+00	2.45e-37	2.46e-53	NA
4. PB	A6NJ78	12S rRNA N4-methylcytidine (m4C) methyltransferase	0.00e+00	1.31e-15	2.62e-50	NA
5. P	O34614	Putative rRNA methylase YtqB	4.70e-05	1.67e-02	NA	NA
6. F	A5ISZ9	Demethylmenaquinone methyltransferase	2.01e-03	NA	NA	0.4803
6. F	C3MTW8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.03e-08	NA	NA	0.6433
6. F	Q66CE0	Ribosomal RNA large subunit methyltransferase I	8.05e-03	NA	NA	0.4251
6. F	Q8YLP4	2-phytyl-1,4-naphtoquinone methyltransferase	2.15e-03	NA	NA	0.4952
6. F	A3QAZ2	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.47e-07	NA	NA	0.4836
6. F	Q5PIT6	Ribosomal RNA small subunit methyltransferase B	1.68e-03	NA	NA	0.4376
6. F	C3NJQ5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.92e-08	NA	NA	0.6548
6. F	Q2Y6R0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.50e-03	NA	NA	0.4748
6. F	B4TE06	Ribosomal RNA large subunit methyltransferase I	4.73e-03	NA	NA	0.4224
6. F	Q4L6H3	Demethylmenaquinone methyltransferase	2.01e-03	NA	NA	0.4854
6. F	C3N0H8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.76e-08	NA	NA	0.6496
6. F	Q74LY0	Demethylmenaquinone methyltransferase	8.95e-04	NA	NA	0.4826
6. F	Q0HXZ5	Ribosomal RNA large subunit methyltransferase I	7.90e-03	NA	NA	0.3924
6. F	B5BBK0	Ribosomal RNA large subunit methyltransferase I	2.26e-02	NA	NA	0.4168
6. F	A1UKA3	Putative O-methyltransferase Mkms_4069	2.03e-03	NA	NA	0.5435
6. F	Q5N4X9	2-phytyl-1,4-naphtoquinone methyltransferase	2.92e-03	NA	NA	0.4725
6. F	B4F1L5	Ribosomal RNA small subunit methyltransferase B	2.54e-03	NA	NA	0.4444
6. F	B8ZQZ1	Putative O-methyltransferase MLBr01075	1.86e-03	NA	NA	0.5393
6. F	Q9HKE4	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.95e-08	NA	NA	0.6392
6. F	O66128	Demethylmenaquinone methyltransferase	2.02e-03	NA	NA	0.4516
6. F	Q8XD85	Ribosomal RNA large subunit methyltransferase I	1.67e-05	NA	NA	0.4643
6. F	Q8CSH9	Demethylmenaquinone methyltransferase	1.81e-03	NA	NA	0.4749
6. F	B5XY38	Ribosomal RNA large subunit methyltransferase I	2.15e-02	NA	NA	0.4228
6. F	B5EFL1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.88e-03	NA	NA	0.4649
6. F	Q2YY85	Demethylmenaquinone methyltransferase	2.22e-03	NA	NA	0.4599
6. F	A7ZK71	Ribosomal RNA large subunit methyltransferase I	2.27e-02	NA	NA	0.4249
6. F	A1JRZ3	Ribosomal RNA small subunit methyltransferase B	1.47e-03	NA	NA	0.444
6. F	Q67LE6	Demethylmenaquinone methyltransferase	2.71e-03	NA	NA	0.4363
6. F	B1JQP6	Ribosomal RNA large subunit methyltransferase I	7.79e-03	NA	NA	0.424
6. F	A6U1T9	Demethylmenaquinone methyltransferase	2.12e-03	NA	NA	0.4788
6. F	Q0TJ93	Ribosomal RNA large subunit methyltransferase I	1.66e-05	NA	NA	0.4643
6. F	B2JYU4	Ribosomal RNA large subunit methyltransferase I	1.09e-02	NA	NA	0.4236
6. F	Q7VF27	Carboxy-S-adenosyl-L-methionine synthase	8.25e-03	NA	NA	0.4203
6. F	C4KJM8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.69e-08	NA	NA	0.6506
6. F	Q49XS5	Demethylmenaquinone methyltransferase	1.91e-03	NA	NA	0.4793
6. F	A0PVW4	Putative O-methyltransferase MUL_4520	2.17e-03	NA	NA	0.5283
6. F	Q6GGU0	Demethylmenaquinone methyltransferase	2.11e-03	NA	NA	0.4799
6. F	Q7CHM1	Ribosomal RNA large subunit methyltransferase I	1.95e-02	NA	NA	0.4232
6. F	Q9YDA1	Protein-L-isoaspartate O-methyltransferase	4.18e-04	NA	NA	0.823
6. F	Q7VKC4	Ribosomal RNA small subunit methyltransferase B	8.11e-04	NA	NA	0.4132
6. F	A0KKF0	Ribosomal RNA large subunit methyltransferase I	7.87e-03	NA	NA	0.4202
6. F	Q97A64	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	8.63e-08	NA	NA	0.579
6. F	A8Z450	Demethylmenaquinone methyltransferase	2.13e-03	NA	NA	0.4784
6. F	A6QH20	Demethylmenaquinone methyltransferase	1.96e-03	NA	NA	0.4784
6. F	B2IUM7	2-phytyl-1,4-naphtoquinone methyltransferase	2.28e-03	NA	NA	0.5053
6. F	Q6G992	Demethylmenaquinone methyltransferase	1.88e-03	NA	NA	0.4807
6. F	Q15TV2	Ribosomal RNA large subunit methyltransferase I	7.32e-03	NA	NA	0.4019
6. F	A0A077ESS0	Norbelladine 4'-O-methyltransferase 5	8.09e-03	NA	NA	0.4771
6. F	Q4FUU5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.90e-04	NA	NA	0.3757
6. F	Q1B4T4	Putative O-methyltransferase Mmcs_3995	2.04e-03	NA	NA	0.5434
6. F	A0A077EW86	Norbelladine 4'-O-methyltransferase 2	3.24e-03	NA	NA	0.4737
6. F	Q9CCA7	Putative O-methyltransferase ML1075	1.85e-03	NA	NA	0.5393
6. F	C7AE94	Flavonoid 3',5'-methyltransferase	8.32e-06	NA	NA	0.5024
6. F	A1TDM2	Putative O-methyltransferase Mvan_4497	2.18e-03	NA	NA	0.5352
6. F	Q31P90	2-phytyl-1,4-naphtoquinone methyltransferase	2.76e-03	NA	NA	0.4729
6. F	Q88RR3	Ribosomal RNA small subunit methyltransferase B	9.76e-04	NA	NA	0.4351
6. F	Q97WC7	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.74e-08	NA	NA	0.6307
6. F	Q7MYI0	Ribosomal RNA small subunit methyltransferase B	1.47e-03	NA	NA	0.4263
6. F	Q72IH5	tRNA (guanine(6)-N2)-methyltransferase	5.44e-07	NA	NA	0.4377
6. F	B4RRY8	Ribosomal RNA large subunit methyltransferase I	2.34e-02	NA	NA	0.4323
6. F	C0Q8C5	Ribosomal RNA large subunit methyltransferase I	4.87e-03	NA	NA	0.4594
6. F	A0KTU3	Ribosomal RNA large subunit methyltransferase I	8.20e-03	NA	NA	0.3923
6. F	C3N8G6	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.80e-08	NA	NA	0.6501
6. F	B9DNV5	Demethylmenaquinone methyltransferase	1.71e-03	NA	NA	0.4757
6. F	Q07VV2	Ribosomal RNA large subunit methyltransferase I	8.45e-03	NA	NA	0.4181
6. F	A7FNK4	Ribosomal RNA small subunit methyltransferase B	1.48e-03	NA	NA	0.4392
6. F	A4TH21	Ribosomal RNA small subunit methyltransferase B	1.48e-03	NA	NA	0.4405
6. F	B1LJ30	Ribosomal RNA large subunit methyltransferase I	1.66e-05	NA	NA	0.4645
6. F	C4L7I7	Ribosomal RNA large subunit methyltransferase I	8.26e-03	NA	NA	0.4259
6. F	Q482P5	Ribosomal RNA large subunit methyltransferase I	2.24e-05	NA	NA	0.4301
6. F	A6T766	Ribosomal RNA large subunit methyltransferase I	2.05e-02	NA	NA	0.4271
6. F	Q8GBB2	tRNA (adenine(58)-N(1))-methyltransferase TrmI	5.91e-07	NA	NA	0.4771
6. F	A1A9N6	Ribosomal RNA large subunit methyltransferase I	1.68e-05	NA	NA	0.4642
6. F	Q1CA17	Ribosomal RNA large subunit methyltransferase I	2.02e-02	NA	NA	0.4473
6. F	Q24W96	Demethylmenaquinone methyltransferase	4.40e-03	NA	NA	0.4501
6. F	A4SML8	Ribosomal RNA large subunit methyltransferase I	8.10e-03	NA	NA	0.4405
6. F	A7HL14	Protein-L-isoaspartate O-methyltransferase	9.65e-05	NA	NA	0.7791
6. F	Q0T667	Ribosomal RNA large subunit methyltransferase I	2.03e-02	NA	NA	0.4228
6. F	A3Q3Q7	Putative O-methyltransferase Mjls_4009	2.13e-03	NA	NA	0.544
6. F	Q1QDU2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.66e-04	NA	NA	0.3805
6. F	B0V5N2	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.77e-05	NA	NA	0.3912
6. F	C6DFR7	Ribosomal RNA small subunit methyltransferase B	6.49e-04	NA	NA	0.4375
6. F	B7I675	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.91e-05	NA	NA	0.3999
6. F	P67062	Demethylmenaquinone methyltransferase	2.09e-03	NA	NA	0.4804
6. F	A0R2D5	Putative O-methyltransferase MSMEG_5073/MSMEI_4947	1.72e-03	NA	NA	0.5682
6. F	A1S9W1	Ribosomal RNA large subunit methyltransferase I	8.29e-03	NA	NA	0.4355
6. F	A3D7R1	Ribosomal RNA large subunit methyltransferase I	8.33e-03	NA	NA	0.4216
6. F	Q5HFV2	Demethylmenaquinone methyltransferase	2.04e-03	NA	NA	0.4785
6. F	Q6F847	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.97e-05	NA	NA	0.3739
6. F	B7H018	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.94e-05	NA	NA	0.3877
6. F	Q31IM5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-03	NA	NA	0.4499
6. F	B2HTF7	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	9.72e-05	NA	NA	0.3861
6. F	P44788	Ribosomal RNA small subunit methyltransferase B	1.09e-03	NA	NA	0.4591
6. F	Q5SKN4	tRNA (adenine(58)-N(1))-methyltransferase TrmI	5.90e-07	NA	NA	0.4821
6. F	Q5HP74	Demethylmenaquinone methyltransferase	2.03e-03	NA	NA	0.4723
6. F	Q8ZZA9	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.07e-04	NA	NA	0.627
6. F	B0VKL3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.05e-04	NA	NA	0.3814
6. F	Q12JE5	Ribosomal RNA large subunit methyltransferase I	8.58e-03	NA	NA	0.4203
6. F	P67061	Demethylmenaquinone methyltransferase	1.93e-03	NA	NA	0.4788
6. F	Q3MD91	2-phytyl-1,4-naphtoquinone methyltransferase	2.24e-03	NA	NA	0.4956
6. F	Q55214	Aklanonic acid methyltransferase DauC	5.87e-04	NA	NA	0.3818
6. F	A4JHS6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.71e-03	NA	NA	0.4746
6. F	P67063	Demethylmenaquinone methyltransferase	1.88e-03	NA	NA	0.4789
6. F	Q8D382	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	9.15e-04	NA	NA	0.475
6. F	P93711	Caffeoyl-CoA O-methyltransferase	9.55e-06	NA	NA	0.4796
6. F	Q32HT9	Ribosomal RNA large subunit methyltransferase I	1.95e-02	NA	NA	0.4203
6. F	Q491V7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.01e-03	NA	NA	0.4546
6. F	A7X2H6	Demethylmenaquinone methyltransferase	2.10e-03	NA	NA	0.4784
6. F	C3MJI5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.75e-08	NA	NA	0.6505
6. F	A8AIB0	Ribosomal RNA large subunit methyltransferase I	2.08e-02	NA	NA	0.4147
6. F	B3PH48	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.43e-03	NA	NA	0.471
6. F	Q1RDP5	Ribosomal RNA large subunit methyltransferase I	1.66e-05	NA	NA	0.4499
6. F	A6TEU2	Ribosomal RNA small subunit methyltransferase B	6.77e-04	NA	NA	0.4369
6. F	Q0HLL4	Ribosomal RNA large subunit methyltransferase I	8.03e-03	NA	NA	0.3923
6. F	B5F1W3	Ribosomal RNA large subunit methyltransferase I	2.19e-02	NA	NA	0.425
6. F	Q9V1J7	tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI	9.42e-07	NA	NA	0.4884
6. F	Q0W2W0	Protein-L-isoaspartate O-methyltransferase	7.49e-05	NA	NA	0.8304
6. F	A6Q7G6	Carboxy-S-adenosyl-L-methionine synthase	5.34e-03	NA	NA	0.4367
7. B	A6UPM1	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.27e-03	NA	0.003	NA
7. B	P0C7V9	Putative methyltransferase-like protein 15P1	2.10e-11	NA	3.20e-19	NA
7. B	Q57836	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.21e-03	NA	0.013	NA