Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54844.1
JCVISYN3A_0528

Phenylalanine--tRNA ligase subunit beta.
M. mycoides homolog: Q6MT18.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 18
Unique PROST Go: 5
Unique BLAST Go: 0
Unique Foldseek Go: 3

Total Homologs: 384
Unique PROST Homologs: 8
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 35

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: pheT_2; Phenylalanine--tRNA ligase beta subunit
Zhang et al. [4]: GO:0006432|phenylalanyl-tRNA aminoacylation
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q669Z6 (Phenylalanine--tRNA ligase beta subunit) with a FATCAT P-Value: 0 and RMSD of 3.03 angstrom. The sequence alignment identity is 25.4%.
Structural alignment shown in left. Query protein AVX54844.1 colored as red in alignment, homolog Q669Z6 colored as blue. Query protein AVX54844.1 is also shown in right top, homolog Q669Z6 showed in right bottom. They are colored based on secondary structures.

  AVX54844.1 MIITRNWLKKYLNLDNISND----QINMALNSLGFEVDSVYD--LNSLNSELILGYVEQSKQIPNTH-LKLNQVNI-GTKSLQIVCGASNVDVNQFVIIA 92
      Q669Z6 MKFSELWLREWVN-PAISSDDLAHQITMA----GLEVDGV-DAVAGEFNG-VVVGHVVECGQHPNADKLRVTKIDVGGDRLLDIVCGAPNCRQGLKVAVA 93

  AVX54844.1 PINATIANGLTLTSKKIQNYESQGMICALNEIGIDLSVINKEDQLKIYNVFDHN--LDL--KKYIGSDVKQIIGLDDYLFEIDLTLNRSDCLASFQILKE 188
      Q669Z6 TVGAVLPGDFKIKAAKLRGESSEGMLCSFSELAIS-------D--------DHDGIIELPADAPIGVDVREYLHLDDKTIEISVTPNRADCLGIIGVARD 178

  AVX54844.1 LA--NYFDL---EIKNLDNNFSDFKKNNLDLKID--------LVNQVKD-QIKTISYSYF--ELNN---KN-DK-LDSKDEIFLKLNQINSSNHL--ITN 265
      Q669Z6 VAVVNQLPLTEPDMAEVVASIND----TLPIRVDAPQACPRYLGRVVKGINVKAATPLWMREKLRRCGIRSIDPVVDVTNFVLLELGQPMHAFDLDRISG 274

  AVX54844.1 LSLISTLSTAQTHILIDLDKLKSSNLKLEFINHDNKELLCLTNNNKLVNIIGLDTQNEFNVDNNSKNVL--NIMLNIEPNLM---RKQQKLLNISNTYLQ 360
      Q669Z6 -GVIVRLATEGEELTL-LDGTK---VKL---NADT---LVIADHQKPLAMAGIFGGEHSGVNEETRNVLLESAFFN--P-LSITGRARRHGLHTDASH-- 358

  AVX54844.1 RYIKPINPNLFNLANQTFSNLLNDY------QLIN--KAYEVKILKQ-TFKNKQSL--EIKLNEIND-LLGTNLTIKQIKSLFKHLDFKITNKDDLLDFQ 448
      Q669Z6 RYERGVDPALQHKAIERATRLLIDICGGEAGPVVDVTTASELP--KQATI----TLRRE-KL----DRLIGHHIPSEQVSDILRRLGCKVTECGS--DWQ 445

  AVX54844.1 -IDQN-RIDITSKNDLCEEVARLYSYDKIDEVP----LSFTSFKKAKNLNLKLENKLTNYLIGLGFNNTKTYSLTSLNEAKYWNLFN-ISEFINLVSPLS 541
      Q669Z6 AVAPSWRFDMAIEEDLVEEVARIYGYNNIPDVPVRADLVMTKHREA-SLSLK---RVKTALVDRGYQEAITYSFV---DPKVQALLHPQQEALILPNPIS 538

  AVX54844.1 -NLRQTYRTNLSKSLIDVAIFNHSINNKELKLFE-----IAD-IYDLNNLKQRHLVF--LTSNHIYKN--SLNQQLIENNFYYNKEILENIFNLYNLDLS 630
      Q669Z6 VDM-SAMRLSLLTGLLSAVVYNQNRQQSRLRLFESGLRFVPDNTADL-GIRQ-DVMLAGVIAGHRYDEHWDLARQPID--FYDLKGDLEAILELTG-KLS 632

  AVX54844.1 EIQYQNDLNLIKEIHPYINTTIYYQNQLIGYLYKLNPKFESENKLN-PTFVCEINLDILNQFKNSFI-EAKTLSKFQSSSRDLTIDISNDLTYQKVLFNA 728
      Q669Z6 DVQFRAEAH--SALHPGQSAAIYLAGEHIGFIGVVHPELERKLDLNGRTVVFEVQ---WNKLADRAVPQAREISRFPANRRDIAVVVAENVPAEDI---- 723

  AVX54844.1 LSDVKYLKSHKIV-----DLYLDDNLIKNNTKALTIQFVFNDLDHQLTENEINQEFEKIIKNIKQ-MKVVIR- 794
      Q669Z6 LAECKKVGANQVVGVNLFDVYRGKGVAE-GYKSLAISLVLQDTARTLEEEEIAATVAKCVEALKQRFQASLRD 795

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0006432 phenylalanyl-tRNA aminoacylation
1. PBF GO:0003723 RNA binding
1. PBF GO:0009328 phenylalanine-tRNA ligase complex
1. PBF GO:0005829 cytosol
1. PBF GO:0000049 tRNA binding
1. PBF GO:0005524 ATP binding
1. PBF GO:0005737 cytoplasm
1. PBF GO:0000287 magnesium ion binding
1. PBF GO:0004826 phenylalanine-tRNA ligase activity
4. PB GO:0005886 plasma membrane
5. P GO:0006412 translation
5. P GO:0051290 protein heterotetramerization
5. P GO:0005634 nucleus
5. P GO:0015970 guanosine tetraphosphate biosynthetic process
5. P GO:0008728 GTP diphosphokinase activity
6. F GO:0006418 tRNA aminoacylation for protein translation
6. F GO:0006431 methionyl-tRNA aminoacylation
6. F GO:0004825 methionine-tRNA ligase activity

Uniprot GO Annotations

GO Description
GO:0006432 phenylalanyl-tRNA aminoacylation
GO:0006412 translation
GO:0003723 RNA binding
GO:0000049 tRNA binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0005737 cytoplasm
GO:0046872 metal ion binding
GO:0000287 magnesium ion binding
GO:0004826 phenylalanine-tRNA ligase activity
GO:0000166 nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF A4FWS3 Phenylalanine--tRNA ligase beta subunit 6.13e-09 4.14e-06 0.019 0.6027
1. PBF P17922 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.70e-71 2.80e-61 0.9042
1. PBF Q2SDJ7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.49e-61 2.52e-44 0.8582
1. PBF Q5N5G8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.77e-67 5.03e-45 0.6946
1. PBF Q5SGX1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.60e-61 1.32e-29 0.8466
1. PBF Q7VR66 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.80e-68 2.93e-21 0.8345
1. PBF P67040 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.31e-72 7.73e-71 0.917
1. PBF Q5QXL8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.55e-65 4.33e-46 0.874
1. PBF Q6B8Z8 Phenylalanine--tRNA ligase beta subunit, chloroplastic 8.34e-13 1.95e-26 0.027 0.7435
1. PBF Q492V0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.37e-69 6.27e-41 0.865
1. PBF Q7MXR4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.58e-68 2.17e-32 0.7599
1. PBF Q7VBX6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.93e-66 7.35e-27 0.8024
1. PBF Q31F19 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.03e-61 1.49e-38 0.8507
1. PBF Q9I0A4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.27e-68 3.74e-37 0.8579
1. PBF Q8AA39 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.03e-65 1.08e-44 0.7378
1. PBF Q5HUR2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.92e-72 1.09e-61 0.8528
1. PBF Q7V1J8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.84e-71 9.74e-29 0.7007
1. PBF Q76KA7 Phenylalanine--tRNA ligase beta subunit 1.32e-10 2.15e-06 0.002 0.5594
1. PBF Q9AGR3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.39e-71 3.47e-71 0.9171
1. PBF Q633N5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.11e-67 8.07e-60 0.9049
1. PBF A6UPQ4 Phenylalanine--tRNA ligase beta subunit 6.69e-09 1.52e-05 0.015 0.6629
1. PBF Q92SS9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.07e-59 8.17e-32 0.7998
1. PBF Q3SWK8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.46e-62 1.22e-30 0.8061
1. PBF P47437 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.77e-63 2.70e-26 0.8612
1. PBF B0SAR6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.63e-70 7.05e-17 0.8595
1. PBF Q4L5E4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.86e-69 5.84e-71 0.8969
1. PBF A4YIL0 Phenylalanine--tRNA ligase beta subunit 2.48e-09 3.84e-04 4.19e-06 0.6116
1. PBF Q3AVJ1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.63e-66 2.00e-39 0.8251
1. PBF Q5GXY5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.54e-65 2.64e-36 0.853
1. PBF Q2LR26 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.95e-65 2.32e-62 0.7628
1. PBF Q7N3Q1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.58e-66 7.05e-53 0.8671
1. PBF P75563 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.24e-66 8.81e-26 0.8572
1. PBF Q92I38 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.26e-70 4.14e-29 0.817
1. PBF Q3B4Z2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.09e-69 1.23e-27 0.7355
1. PBF Q8KEF9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.34e-65 2.60e-40 0.8
1. PBF Q5F9T6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.95e-65 1.12e-36 0.8473
1. PBF P74296 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.58e-71 8.98e-35 0.8083
1. PBF Q9Z7W0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.20e-73 1.69e-29 0.6941
1. PBF Q7NBB7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.17e-67 8.22e-27 0.8762
1. PBF P0DG53 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.80e-73 5.71e-63 0.799
1. PBF Q5ZS09 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.17e-66 8.58e-47 0.867
1. PBF Q3ZZD2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.72e-62 6.66e-28 0.7456
1. PBF Q2RYT3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.22e-59 5.92e-35 0.7322
1. PBF A9AA58 Phenylalanine--tRNA ligase beta subunit 6.72e-09 2.70e-06 0.008 0.6698
1. PBF Q5P7Y0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.60e-63 3.46e-22 0.8153
1. PBF Q49WQ6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.33e-67 6.85e-69 0.898
1. PBF Q5L6W7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.54e-68 3.44e-20 0.7524
1. PBF P59505 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.72e-67 6.26e-06 0.8416
1. PBF Q9JVA0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.04e-69 1.53e-36 0.85
1. PBF Q7W7C6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.18e-64 1.44e-32 0.8548
1. PBF Q5HAU7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.96e-70 2.00e-33 0.8489
1. PBF Q74IE2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.56e-68 2.62e-66 0.9156
1. PBF Q30Y16 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.03e-68 2.61e-38 0.8403
1. PBF Q3A4N8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.96e-64 2.48e-42 0.8323
1. PBF C5A5Z0 Phenylalanine--tRNA ligase beta subunit 1.92e-09 4.90e-06 1.32e-05 0.5469
1. PBF Q3MAZ7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.38e-68 1.79e-39 0.842
1. PBF Q46KZ8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.52e-68 9.12e-26 0.6461
1. PBF Q3SK29 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.77e-65 2.81e-36 0.8576
1. PBF Q5X1H8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.83e-67 6.31e-47 0.8288
1. PBF Q38VV4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.47e-69 9.29e-70 0.8876
1. PBF Q97S34 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.90e-70 1.98e-66 0.8998
1. PBF Q7VK65 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.18e-68 6.15e-24 0.7044
1. PBF Q5WEJ6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.93e-68 6.86e-72 0.8966
1. PBF Q3IIL2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.30e-67 9.02e-43 0.8573
1. PBF Q5LMS3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.11e-63 1.46e-15 0.7893
1. PBF Q7U6V9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.40e-70 2.18e-35 0.7181
1. PBF Q8RHB5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.80e-66 1.41e-47 0.7535
1. PBF Q7V7K5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.20e-63 2.05e-32 0.843
1. PBF Q883H7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.30e-67 1.69e-39 0.8442
1. PBF Q4J8Q0 Phenylalanine--tRNA ligase beta subunit 3.51e-11 2.21e-07 5.98e-08 0.6185
1. PBF Q47N76 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.41e-59 9.78e-16 0.8645
1. PBF P43820 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.00e-67 3.01e-32 0.86
1. PBF O88054 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.19e-57 1.26e-23 0.8841
1. PBF Q5FIY7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.56e-69 8.70e-63 0.9086
1. PBF Q47CM9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.49e-64 7.12e-33 0.8307
1. PBF Q9ZDB4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.70e-69 2.70e-30 0.8417
1. PBF Q8DQT6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.97e-71 4.65e-69 0.9009
1. PBF Q2NJZ2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.42e-51 4.62e-30 0.8292
1. PBF B0R807 Phenylalanine--tRNA ligase beta subunit 2.41e-08 2.56e-05 0.006 0.5952
1. PBF Q8XJ76 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.80e-61 2.12e-49 0.8051
1. PBF Q64T65 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.43e-66 1.56e-42 0.7447
1. PBF Q39H50 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.94e-65 4.11e-34 0.8413
1. PBF Q98CQ1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.98e-59 1.09e-30 0.7593
1. PBF Q4UW52 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.00e-67 2.82e-30 0.8627
1. PBF Q9PP35 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.58e-74 3.95e-61 0.8468
1. PBF Q4FQ66 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.03e-65 2.47e-41 0.8502
1. PBF Q2RNH7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.41e-65 5.08e-39 0.7959
1. PBF Q7UP77 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.98e-22 2.50e-10 0.8503
1. PBF Q3AQC6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.02e-69 5.95e-37 0.7125
1. PBF Q5NG54 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.52e-66 1.97e-35 0.8565
1. PBF Q9K896 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.02e-67 4.35e-71 0.8989
1. PBF Q728S0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.24e-66 3.29e-38 0.8494
1. PBF Q6ANC2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.53e-61 6.03e-34 0.8617
1. PBF Q9KSN6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.10e-61 9.18e-43 0.8654
1. PBF Q89WI2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.55e-58 4.12e-34 0.7685
1. PBF Q6AGD6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.58e-54 4.52e-31 0.873
1. PBF P57859 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.78e-67 7.90e-31 0.8565
1. PBF Q2YX86 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.70e-71 6.14e-69 0.909
1. PBF Q5PH85 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.75e-66 8.49e-42 0.8528
1. PBF Q8G5E8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.55e-56 2.43e-10 0.8783
1. PBF Q5LC76 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.40e-66 5.15e-43 0.7542
1. PBF Q828C6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.59e-53 1.70e-26 0.8693
1. PBF Q6GHU6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.62e-71 1.30e-71 0.9157
1. PBF Q31AV5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.61e-70 8.01e-32 0.7312
1. PBF Q32FI6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.17e-67 2.80e-44 0.864
1. PBF Q87Q59 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.48e-61 3.23e-42 0.8633
1. PBF Q5FFS3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.00e-70 2.56e-33 0.8537
1. PBF A9CS50 Probable phenylalanine--tRNA ligase beta subunit 3.24e-10 7.26e-07 0.001 0.5802
1. PBF Q9RRX5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.31e-64 1.15e-28 0.7765
1. PBF Q9PFD6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.66e-66 1.22e-33 0.7947
1. PBF Q6LXU2 Phenylalanine--tRNA ligase beta subunit 1.18e-10 5.07e-06 0.013 0.5879
1. PBF Q01SP7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.67e-63 3.89e-14 0.8555
1. PBF B8GEX4 Phenylalanine--tRNA ligase beta subunit 1.84e-08 1.91e-07 1.66e-04 0.5868
1. PBF Q39VS4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.43e-68 4.31e-50 0.7919
1. PBF P59664 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.94e-67 3.63e-45 0.853
1. PBF Q3JBZ7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.23e-64 1.58e-37 0.8494
1. PBF Q9PJR8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.23e-63 7.00e-24 0.7027
1. PBF P56145 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.36e-65 5.20e-37 0.8752
1. PBF Q6KHC8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.80e-66 3.61e-25 0.784
1. PBF Q971D8 Phenylalanine--tRNA ligase beta subunit 7.20e-10 6.54e-07 4.00e-05 0.6231
1. PBF Q9HMK3 Phenylalanine--tRNA ligase beta subunit 3.06e-08 2.56e-05 0.006 0.5951
1. PBF Q8XE32 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.46e-67 1.78e-44 0.8565
1. PBF P15434 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.30e-65 1.92e-42 0.8581
1. PBF Q3KEX7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.56e-66 2.85e-38 0.851
1. PBF Q5GSH5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.78e-67 1.29e-27 0.8184
1. PBF Q6G5I2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.12e-60 1.88e-41 0.8019
1. PBF Q472N3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.29e-64 1.05e-25 0.8418
1. PBF Q6GA75 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.51e-72 1.03e-70 0.9168
1. PBF Q82VV6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.03e-65 4.51e-38 0.8596
1. PBF Q2IJB3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.19e-60 3.70e-28 0.8232
1. PBF P59057 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.82e-72 5.73e-10 0.8675
1. PBF Q9A0I0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.97e-72 8.02e-62 0.9009
1. PBF Q4A891 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.78e-52 3.94e-12 0.8334
1. PBF B9LU47 Phenylalanine--tRNA ligase beta subunit 3.65e-09 2.38e-06 0.002 0.5843
1. PBF Q8Z6I4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.91e-66 3.23e-42 0.8583
1. PBF Q5E5G5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.02e-63 1.57e-45 0.8555
1. PBF Q8YMH5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.71e-69 3.25e-41 0.8347
1. PBF Q8YE74 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.02e-60 5.95e-29 0.7901
1. PBF Q5NMC3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.09e-66 1.60e-25 0.8578
1. PBF Q5LZ72 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.68e-73 1.57e-70 0.9097
1. PBF Q817I7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.24e-66 2.55e-61 0.9129
1. PBF Q9A9E5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.02e-60 2.09e-17 0.8081
1. PBF Q2JHU3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.27e-66 2.75e-36 0.8542
1. PBF Q6A7V6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.35e-55 1.28e-24 0.8763
1. PBF Q63TM7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.16e-64 3.07e-31 0.8428
1. PBF Q891T8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.97e-59 6.75e-50 0.7462
1. PBF Q2YQV4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.92e-60 2.60e-30 0.8009
1. PBF Q4A6A2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.42e-59 3.02e-24 0.8434
1. PBF Q6MEA6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.79e-63 3.72e-35 0.8688
1. PBF Q6F166 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.07e-91 0.0 0.9786
1. PBF Q98QL4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.05e-52 2.05e-30 0.626
1. PBF Q0W0X4 Phenylalanine--tRNA ligase beta subunit 2.98e-09 6.27e-06 5.34e-08 0.6051
1. PBF Q47ZS5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.50e-65 1.85e-33 0.847
1. PBF Q5KWE5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.48e-70 1.04e-62 0.9101
1. PBF A2ST82 Phenylalanine--tRNA ligase beta subunit 4.38e-09 1.01e-03 2.21e-05 0.639
1. PBF B1L7C0 Phenylalanine--tRNA ligase beta subunit 9.61e-11 9.52e-08 0.021 0.6022
1. PBF Q6NDR9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.60e-61 2.13e-33 0.803
1. PBF Q2NT27 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.08e-69 8.64e-38 0.8697
1. PBF Q8CSY8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.43e-70 8.19e-69 0.904
1. PBF Q2YBS1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.37e-69 1.07e-42 0.8475
1. PBF Q7M8Y8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.44e-67 4.39e-52 0.8367
1. PBF Q57AD9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.92e-60 2.60e-30 0.7647
1. PBF P51346 Phenylalanine--tRNA ligase beta subunit, chloroplastic 0.00e+00 6.04e-33 9.51e-20 0.7878
1. PBF Q8Y7Q1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.12e-68 1.49e-34 0.8841
1. PBF Q8XZ24 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.69e-65 1.20e-23 0.8414
1. PBF Q7NYC1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.68e-62 4.05e-32 0.8534
1. PBF P0DG52 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.80e-73 5.71e-63 0.906
1. PBF P67041 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.31e-72 7.73e-71 0.9171
1. PBF Q836J5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.33e-70 1.53e-59 0.8324
1. PBF Q57PU8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.06e-65 1.42e-42 0.8652
1. PBF Q6MMJ1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.71e-69 8.35e-31 0.8239
1. PBF Q7MK40 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.99e-62 1.86e-41 0.8527
1. PBF Q5YYH6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.13e-56 3.78e-16 0.8677
1. PBF Q8EPH5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.28e-67 1.67e-56 0.9002
1. PBF P27002 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.60e-61 1.32e-29 0.8487
1. PBF Q97GL0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.22e-62 1.32e-46 0.6912
1. PBF Q4AA64 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.45e-51 2.10e-13 0.8297
1. PBF Q04XL9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.98e-66 8.86e-19 0.8407
1. PBF Q60AY9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.13e-66 3.56e-41 0.8514
1. PBF Q321K5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.21e-67 1.05e-44 0.8579
1. PBF Q3AJY9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.50e-68 1.07e-35 0.8283
1. PBF P37984 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.09e-66 4.29e-46 0.8603
1. PBF Q1RIS8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.22e-65 8.28e-15 0.7089
1. PBF Q6F873 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.83e-67 2.14e-40 0.8539
1. PBF Q65TL3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.14e-67 1.74e-29 0.8504
1. PBF Q6NHH1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.22e-64 8.89e-27 0.8732
1. PBF Q2P100 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.45e-65 6.82e-35 0.8342
1. PBF P9WFU0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.03e-61 2.40e-22 0.8694
1. PBF P57230 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.64e-74 5.05e-35 0.8589
1. PBF Q48JR8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.03e-66 2.72e-39 0.8465
1. PBF Q8FXX4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.92e-60 5.22e-31 0.7892
1. PBF Q83C15 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.21e-67 1.66e-36 0.8734
1. PBF C6A237 Phenylalanine--tRNA ligase beta subunit 1.24e-10 3.54e-05 2.35e-05 0.6184
1. PBF Q9UYX2 Phenylalanine--tRNA ligase beta subunit 9.35e-11 1.79e-06 0.012 0.586
1. PBF A6VGJ4 Phenylalanine--tRNA ligase beta subunit 7.95e-09 6.13e-06 0.011 0.6603
1. PBF Q87AB6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.26e-65 5.29e-34 0.7898
1. PBF Q3JT07 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.49e-64 7.93e-31 0.8396
1. PBF Q72MG8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.69e-65 1.44e-16 0.838
1. PBF Q30S83 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.41e-71 3.03e-57 0.825
1. PBF Q65GD3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.35e-71 2.02e-60 0.9054
1. PBF Q8E064 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.61e-71 2.30e-64 0.9089
1. PBF Q2JXF6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.61e-67 1.86e-40 0.852
1. PBF Q3ABT5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.76e-64 7.29e-41 0.8941
1. PBF Q8D3B5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.91e-68 1.29e-15 0.8535
1. PBF Q8CWX2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.64e-74 1.20e-67 0.8935
1. PBF Q4KEV9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.69e-67 1.88e-39 0.8634
1. PBF Q73HW5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.58e-64 8.16e-28 0.8548
1. PBF Q12YP2 Phenylalanine--tRNA ligase beta subunit 3.13e-09 1.17e-05 2.65e-05 0.6214
1. PBF Q88K22 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.74e-67 6.22e-42 0.8575
1. PBF Q1XDE1 Phenylalanine--tRNA ligase beta subunit, chloroplastic 0.00e+00 6.93e-23 3.01e-17 0.8061
1. PBF Q8E5U1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.00e-70 1.24e-64 0.9069
1. PBF Q4JW05 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.74e-62 3.37e-17 0.874
1. PBF Q6MT18 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.02e-126 0.0 0.9917
1. PBF Q5FUA2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.71e-67 6.44e-27 0.7609
1. PBF Q88WR2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.64e-71 3.61e-25 0.9056
1. PBF Q7WKR4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.49e-64 8.17e-32 0.8569
1. PBF O28848 Phenylalanine--tRNA ligase beta subunit 3.58e-09 8.85e-07 1.91e-08 0.6425
1. PBF Q6D4H3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.28e-66 1.98e-42 0.8609
1. PBF Q8DL37 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.79e-62 1.98e-45 0.7543
1. PBF P74764 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.36e-67 3.37e-44 0.8382
1. PBF Q2SS99 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.15e-113 0.0 0.9973
1. PBF O84481 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.94e-70 4.60e-27 0.6894
1. PBF Q83HH4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.48e-48 1.27e-06 0.8369
1. PBF Q3Z9I7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.96e-65 2.10e-28 0.7441
1. PBF Q9CC16 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.90e-61 9.51e-18 0.861
1. PBF Q6YPX7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.46e-53 3.10e-44 0.8342
1. PBF Q74CZ9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.14e-70 2.60e-27 0.8398
1. PBF Q8R9C7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.35e-58 1.57e-58 0.8568
1. PBF Q8EF99 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.53e-64 5.56e-43 0.8651
1. PBF Q48UC5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 7.83e-69 3.95e-61 0.8544
1. PBF Q9CEB5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.62e-70 1.93e-65 0.8903
1. PBF Q2RHN8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.55e-62 1.93e-44 0.8437
1. PBF Q8DA39 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.33e-61 2.13e-41 0.8584
1. PBF Q6LQ73 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.33e-62 3.56e-36 0.8165
1. PBF Q68WW1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.60e-72 1.74e-29 0.8361
1. PBF A0T0H4 Phenylalanine--tRNA ligase beta subunit, chloroplastic 1.33e-15 3.43e-29 6.38e-06 0.7776
1. PBF Q04VV0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.62e-66 2.17e-18 0.8385
1. PBF Q83L36 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.78e-67 9.90e-45 0.858
1. PBF Q3K1I7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.00e-70 1.32e-63 0.7764
1. PBF Q72ZI2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.94e-67 1.43e-60 0.9081
1. PBF Q8NQN6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.23e-57 4.20e-28 0.8722
1. PBF Q740J0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.45e-59 3.09e-21 0.8662
1. PBF Q824J8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.58e-68 6.49e-18 0.7255
1. PBF Q67QF2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.68e-49 4.47e-17 0.5526
1. PBF B0SJF2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.63e-70 7.05e-17 0.8624
1. PBF Q81L31 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.32e-67 5.95e-61 0.8826
1. PBF Q601U6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.46e-50 3.01e-13 0.832
1. PBF Q83GS8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.44e-47 1.44e-06 0.8453
1. PBF Q8P1K0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.92e-72 1.42e-64 0.9033
1. PBF Q6G0Y3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.20e-59 8.33e-39 0.8237
1. PBF Q3Z261 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.94e-67 9.81e-45 0.8569
1. PBF Q92CI6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.33e-70 4.97e-34 0.901
1. PBF Q7VVR5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.42e-63 9.59e-31 0.8554
1. PBF Q3J5M6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.38e-59 1.01e-09 0.7936
1. PBF Q8EUJ9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.41e-70 4.16e-30 0.8619
1. PBF Q5M3S7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.68e-73 1.57e-70 0.905
1. PBF Q8P7Z6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 9.00e-67 2.82e-30 0.8642
1. PBF Q5HGU5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.83e-72 7.29e-70 0.9076
1. PBF Q5WT87 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.91e-67 1.20e-46 0.8711
1. PBF Q8UIN4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.81e-60 1.00e-40 0.808
1. PBF Q8FTP0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.40e-56 3.57e-29 0.8705
1. PBF Q4FNH4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.53e-67 3.33e-16 0.7964
1. PBF Q9PQ33 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.56e-70 6.43e-45 0.8572
1. PBF Q3YRN4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 8.87e-71 5.36e-31 0.8518
1. PBF O67620 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.81e-58 3.16e-27 0.8219
1. PBF Q5HQ35 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.31e-70 2.59e-67 0.9055
1. PBF Q7VLG3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.27e-68 5.90e-34 0.8627
1. PBF Q8PJE5 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.72e-67 4.17e-34 0.8509
1. PBF Q3BRU2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.14e-67 1.02e-36 0.8512
1. PBF A0B993 Phenylalanine--tRNA ligase beta subunit 2.32e-10 2.98e-05 9.74e-08 0.6042
1. PBF Q62KI7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.16e-64 3.07e-31 0.8415
1. PBF Q8NX60 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.51e-72 1.03e-70 0.9175
1. PBF Q5XCX3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.54e-72 5.26e-64 0.907
1. PBF Q669Z6 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.03e-66 1.46e-51 0.8664
1. PBF Q9ZKF8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.02e-65 6.34e-38 0.8509
1. PBF Q6HCW8 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.32e-67 5.95e-61 0.9027
1. PBF Q7NCQ2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 2.30e-69 2.56e-51 0.8353
1. PBF Q9WZS9 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.03e-62 1.55e-50 0.8439
1. PBF Q720K7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.15e-68 1.45e-33 0.8528
1. PBF Q2GAI7 Phenylalanine--tRNA ligase beta subunit 0.00e+00 4.40e-66 2.50e-22 0.7913
1. PBF Q7VEV3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.69e-61 3.99e-22 0.8647
1. PBF Q4ULS4 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.14e-67 6.01e-31 0.818
1. PBF Q2SVE3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.68e-64 1.91e-30 0.8398
1. PBF Q2VYZ1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.13e-63 2.95e-18 0.8091
1. PBF Q4QKM3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.57e-66 9.73e-33 0.8613
1. PBF Q2FHU2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.53e-71 6.47e-70 0.906
1. PBF Q3KLM3 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.70e-70 1.75e-26 0.7047
1. PBF Q4ZUG2 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.21e-66 1.42e-40 0.8453
1. PBF Q9K089 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.47e-71 2.24e-34 0.8271
1. PBF Q8EZ26 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.09e-66 1.21e-17 0.8416
1. PBF Q5PA83 Phenylalanine--tRNA ligase beta subunit 0.00e+00 6.82e-66 2.64e-28 0.8021
1. PBF Q72HA0 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.17e-60 5.58e-29 0.8207
1. PBF Q8ZDX1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 3.69e-66 4.43e-51 0.8601
2. PF C3MJ88 Phenylalanine--tRNA ligase beta subunit 3.03e-09 4.58e-08 NA 0.6125
2. PF Q8U260 Phenylalanine--tRNA ligase beta subunit 7.25e-11 4.78e-05 NA 0.6314
2. PF Q468N7 Phenylalanine--tRNA ligase beta subunit 4.99e-09 1.48e-04 NA 0.6076
2. PF A1QZU9 Phenylalanine--tRNA ligase beta subunit 3.72e-10 3.16e-04 NA 0.6085
2. PF A3CT77 Phenylalanine--tRNA ligase beta subunit 4.89e-09 7.41e-06 NA 0.6377
2. PF B5RPL7 Phenylalanine--tRNA ligase beta subunit 7.04e-09 8.30e-05 NA 0.5246
2. PF B2S0L6 Phenylalanine--tRNA ligase beta subunit 4.06e-10 1.14e-04 NA 0.6184
2. PF O73984 Phenylalanine--tRNA ligase beta subunit 9.36e-11 8.54e-07 NA 0.6217
2. PF Q8ZWQ7 Phenylalanine--tRNA ligase beta subunit 9.88e-10 3.27e-06 NA 0.6002
2. PF Q97B53 Phenylalanine--tRNA ligase beta subunit 3.32e-08 8.12e-05 NA 0.6258
2. PF Q5UYF3 Phenylalanine--tRNA ligase beta subunit 3.58e-08 7.17e-06 NA 0.5747
2. PF O26864 Phenylalanine--tRNA ligase beta subunit 1.00e-08 5.95e-07 NA 0.6031
2. PF Q2FLL1 Phenylalanine--tRNA ligase beta subunit 3.22e-09 3.51e-07 NA 0.6376
2. PF Q3ITU5 Phenylalanine--tRNA ligase beta subunit 3.91e-08 8.38e-06 NA 0.5938
2. PF O13432 Phenylalanine--tRNA ligase beta subunit 7.93e-09 2.13e-08 NA 0.5996
2. PF A7I615 Phenylalanine--tRNA ligase beta subunit 6.17e-09 1.05e-07 NA 0.6303
2. PF C3MYY0 Phenylalanine--tRNA ligase beta subunit 3.04e-09 7.03e-08 NA 0.6146
2. PF Q8PTA5 Phenylalanine--tRNA ligase beta subunit 3.31e-09 3.87e-06 NA 0.6336
2. PF B6YTJ3 Phenylalanine--tRNA ligase beta subunit 9.58e-11 7.66e-06 NA 0.6055
2. PF O83059 Phenylalanine--tRNA ligase beta subunit 3.36e-07 1.38e-05 NA 0.5905
2. PF Q8SS40 Probable phenylalanine--tRNA ligase beta subunit 6.83e-11 1.22e-06 NA 0.5978
2. PF C3NMS5 Phenylalanine--tRNA ligase beta subunit 3.21e-09 1.04e-07 NA 0.6128
2. PF C4KJ68 Phenylalanine--tRNA ligase beta subunit 2.35e-09 7.03e-08 NA 0.6166
2. PF C3N028 Phenylalanine--tRNA ligase beta subunit 3.15e-09 3.02e-08 NA 0.613
2. PF Q0SMZ4 Phenylalanine--tRNA ligase beta subunit 3.04e-10 5.32e-05 NA 0.6054
2. PF Q2NGX9 Phenylalanine--tRNA ligase beta subunit 1.03e-10 9.12e-05 NA 0.5929
2. PF B5RM71 Phenylalanine--tRNA ligase beta subunit 4.83e-10 7.55e-05 NA 0.6038
2. PF B2S1W3 Phenylalanine--tRNA ligase beta subunit 2.97e-07 1.38e-05 NA 0.5884
2. PF A6UWT1 Phenylalanine--tRNA ligase beta subunit 7.83e-09 7.97e-07 NA 0.6063
2. PF P94283 Phenylalanine--tRNA ligase beta subunit 2.54e-10 2.76e-05 NA 0.6202
2. PF Q8TPF7 Phenylalanine--tRNA ligase beta subunit 2.82e-09 4.34e-05 NA 0.6312
2. PF B7J278 Phenylalanine--tRNA ligase beta subunit 2.79e-10 3.05e-05 NA 0.6206
2. PF Q5R7F7 Phenylalanine--tRNA ligase beta subunit 1.78e-10 3.87e-06 NA 0.6054
2. PF C3N8B1 Phenylalanine--tRNA ligase beta subunit 2.04e-08 1.04e-07 NA 0.4913
2. PF Q661A7 Phenylalanine--tRNA ligase beta subunit 2.46e-10 1.15e-04 NA 0.6142
2. PF Q9Y9I3 Phenylalanine--tRNA ligase beta subunit 2.66e-09 9.27e-07 NA 0.6082
2. PF P57694 Phenylalanine--tRNA ligase beta subunit 4.03e-08 6.48e-06 NA 0.6093
2. PF A1RYS1 Phenylalanine--tRNA ligase beta subunit 5.77e-09 5.26e-05 NA 0.5714
2. PF P95960 Phenylalanine--tRNA ligase beta subunit 5.82e-09 5.48e-07 NA 0.548
3. BF P47687 Uncharacterized protein MG449 5.42e-03 NA 1.64e-10 0.8159
3. BF O34943 Putative tRNA-binding protein YtpR 2.48e-03 NA 1.42e-09 0.6068
3. BF P75128 Uncharacterized protein MG449 homolog 2.38e-02 NA 1.19e-10 0.8137
4. PB Q9VCA5 Phenylalanine--tRNA ligase beta subunit 6.93e-09 7.01e-07 0.007 NA
4. PB Q58508 Phenylalanine--tRNA ligase beta subunit 7.37e-09 3.86e-05 0.037 NA
4. PB Q550D2 Phenylalanine--tRNA ligase beta subunit 1.25e-10 1.54e-08 0.016 NA
4. PB Q9SGE9 Phenylalanine--tRNA ligase beta subunit, cytoplasmic 1.78e-08 2.22e-05 0.024 NA
4. PB P9WFU1 Phenylalanine--tRNA ligase beta subunit 0.00e+00 5.03e-61 2.40e-22 NA
4. PB P07395 Phenylalanine--tRNA ligase beta subunit 0.00e+00 1.49e-67 1.51e-44 NA
5. P Q8CS97 GTP pyrophosphokinase 3.47e-01 4.03e-02 NA NA
5. P O54408 GTP pyrophosphokinase 4.52e-01 1.62e-02 NA NA
5. P O42849 Phenylalanine--tRNA ligase beta subunit 2.72e-10 2.56e-05 NA NA
5. P Q9WUA2 Phenylalanine--tRNA ligase beta subunit 1.63e-10 6.86e-05 NA NA
5. P P15624 Phenylalanine--tRNA ligase beta subunit 8.60e-10 3.01e-09 NA NA
5. P Q5HNR8 GTP pyrophosphokinase 2.67e-01 4.03e-02 NA NA
5. P Q9NSD9 Phenylalanine--tRNA ligase beta subunit 1.91e-10 6.48e-06 NA NA
5. P Q19713 Phenylalanine--tRNA ligase beta subunit 1.16e-08 5.15e-05 NA NA
6. F Q2NI31 Methionine--tRNA ligase 6.26e-01 NA NA 0.4982
6. F A1U4C1 ATP phosphoribosyltransferase regulatory subunit 7.22e-02 NA NA 0.4224
6. F A1BF81 Methionine--tRNA ligase 6.92e-01 NA NA 0.6498
6. F B3ECI3 Methionine--tRNA ligase 7.69e-01 NA NA 0.6528
6. F A3CXH4 Aspartate--tRNA(Asp/Asn) ligase 9.28e-02 NA NA 0.416
6. F B8GFL4 Methionine--tRNA ligase 6.50e-01 NA NA 0.6287
6. F A7I6H7 Methionine--tRNA ligase 7.13e-01 NA NA 0.648
6. F Q3B3N3 Methionine--tRNA ligase 7.13e-01 NA NA 0.6149
6. F Q2S2A3 Methionine--tRNA ligase 6.31e-01 NA NA 0.4932
6. F O33925 Methionine--tRNA ligase 6.68e-01 NA NA 0.5217
6. F P59077 Methionine--tRNA ligase 7.78e-01 NA NA 0.6149
6. F A0M5Z9 Methionine--tRNA ligase 5.99e-01 NA NA 0.6261
6. F A2SRE2 Methionine--tRNA ligase 7.05e-01 NA NA 0.6176
6. F Q6MDG0 Methionine--tRNA ligase 7.81e-01 NA NA 0.638
6. F Q5V1N2 Aspartate--tRNA(Asp/Asn) ligase 1.96e-01 NA NA 0.4372
6. F Q9HSA4 Methionine--tRNA ligase 7.18e-01 NA NA 0.4798
6. F Q5L7I8 Methionine--tRNA ligase 7.23e-01 NA NA 0.6334
6. F Q8TX28 Methionine--tRNA ligase 5.85e-01 NA NA 0.5398
6. F Q8TX56 Phenylalanine--tRNA ligase beta subunit 2.17e-09 NA NA 0.5671
6. F Q64MP7 Methionine--tRNA ligase 7.41e-01 NA NA 0.6336
6. F C4VA52 Probable phenylalanine--tRNA ligase beta subunit 5.65e-10 NA NA 0.572
6. F A5UJ98 Methionine--tRNA ligase 6.50e-01 NA NA 0.6105
6. F A6GVQ2 Methionine--tRNA ligase 6.97e-01 NA NA 0.6067
6. F Q7MXK7 Methionine--tRNA ligase 6.49e-01 NA NA 0.6241
6. F Q3IT47 Methionine--tRNA ligase 7.67e-01 NA NA 0.6313
6. F Q8A3M1 Methionine--tRNA ligase 6.58e-01 NA NA 0.6341
6. F O26687 Methionine--tRNA ligase 7.10e-01 NA NA 0.5053
6. F O28819 Methionine--tRNA ligase 6.69e-01 NA NA 0.6607
6. F A4SE77 Methionine--tRNA ligase 7.10e-01 NA NA 0.6504
6. F B3QT85 Methionine--tRNA ligase 7.11e-01 NA NA 0.6188
6. F A5FLM7 Methionine--tRNA ligase 7.25e-01 NA NA 0.6242
6. F B4SGQ6 Methionine--tRNA ligase 7.82e-01 NA NA 0.6404
6. F Q3AQR4 Methionine--tRNA ligase 7.62e-01 NA NA 0.6446
6. F A3CX39 Methionine--tRNA ligase 6.52e-01 NA NA 0.6287
6. F A6LFP0 Methionine--tRNA ligase 6.62e-01 NA NA 0.6338