Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54854.1
JCVISYN3A_0542
Molecular chaperone.
M. mycoides homolog: Q6MT06.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 207
Unique PROST Go: 5
Unique BLAST Go: 10
Unique Foldseek Go: 2
Total Homologs: 1306
Unique PROST Homologs: 0
Unique BLAST Homologs: 40
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q65RT2
(Chaperone protein HscA homolog) with a FATCAT P-Value: 0 and RMSD of 2.06 angstrom. The sequence alignment identity is 39.2%.
Structural alignment shown in left. Query protein AVX54854.1 colored as red in alignment, homolog Q65RT2 colored as blue.
Query protein AVX54854.1 is also shown in right top, homolog Q65RT2 showed in right bottom. They are colored based on secondary structures.
AVX54854.1 -----------MA---KEKI-IGIDLGTTNSVVSVIEGGQ-PIILENPEGQR-TTPSVVAF-KNSDIIVGGAAKRQAVTNP-NVVQSIKSKMG-TTSKV- 79 Q65RT2 MALLQIAEPGLMAAPHQHKLAVGIDLGTTNSLVATVRSAHTEILLD--EKDRPLVPSIVHFGDNNEITVGYEAGELASIDPQNTVISVKRLIGRSLEDVQ 98 AVX54854.1 ----NL----E----G-------KD-YSPEQISAEILRYMKNYAEAKLGQKVTKAVITVPAYFNDAQRKATKDAGTIAGLQVERIINEPTAAALAYGLDK 159 Q65RT2 ARYPNLPYRFEASENGLPLISTRKSAVSPVEVSSEILKKLTALAKRRLGGELQGAVITVPAYFDDAQRQSTKDAAKLAGLNVLRLLNEPTAAAIAYGLD- 197 AVX54854.1 QDKEETILVYDLGGGTFDVSILAIGGGSFDVIATSGNNKLGGDNFDEEIIKWLL---GKIKAEYNIDLSKEKMALQRLKDEAEKAKINLSSQLE-VEINL 255 Q65RT2 SGKEGVIAVYDLGGGTFDISILRLSKGVFEVLATGGDTALGGDDFDHLVADWITEQSG-ISPQ---D-DKQKRQLVEL---ATRLKIQLTDN-ETVAIQY 288 AVX54854.1 PFIAMNESGPISFATTLTRSEFNKITKHLVDLTIQPVKDALSAAKKTPSEINEVLLVGGSTRIPAVQELVKSLLNKEPNRSINPDEVVAMGAAVQGGVLA 355 Q65RT2 ----QNWHGKIS------RNQFNQLIQPLVKRSLISCRRALKDANVTADEVNEVVMVGGSTRVPFVREQVGEFFKRQPLTSIDPDKVVALGAAVQADILV 378 AVX54854.1 GEVTD--ILLLDVTPLSLGIETMGGVMTKLIERNTTIPAKRTQIFSTATDNQPAVDINVLQGERAMAADNKSLGQFQLTGIQPAPRGIPQIEVTFEIDAN 453 Q65RT2 GNKPDSEMLLLDVIPLSLGIETMGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMTVHIVQGEREMVADCRSLARFTLRGIPPMAAGAAQVRVTYQVDAD 478 AVX54854.1 GIVSVSAKDKNTNEEKTITISNS-GNLSEAEVERMIKEAQENAAND-E---VKKKNIELKNKAENYINII--ETSLLQAGD-KISAEQKEQSQKMVDEIK 545 Q65RT2 GLLNVTAMEKSTGVQSSIQVKPSYG-LTDDEITQMLKASMDNAKQDIDARLLAEQRVEAKRVIESVLSALSHDRDLLN--DEELSAIKKALVE--LDKLQ 573 AVX54854.1 ELVKNENYEALEQKMAELEQAMAQAAEFANKQNESDPNNNSSEQNN----- 591 Q65RT2 Q--QNDTL-AIKQGIKDLD-AATQ--EFAARR--MDKSIRSALTGHSVEDI 616
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0000774 | adenyl-nucleotide exchange factor activity |
1. PBF | GO:0061740 | protein targeting to lysosome involved in chaperone-mediated autophagy |
1. PBF | GO:0051082 | unfolded protein binding |
1. PBF | GO:0031333 | negative regulation of protein-containing complex assembly |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0045646 | regulation of erythrocyte differentiation |
1. PBF | GO:0007041 | lysosomal transport |
1. PBF | GO:0005829 | cytosol |
1. PBF | GO:0008180 | COP9 signalosome |
1. PBF | GO:0045647 | negative regulation of erythrocyte differentiation |
1. PBF | GO:0031204 | posttranslational protein targeting to membrane, translocation |
1. PBF | GO:1990718 | axonemal central pair projection |
1. PBF | GO:0098630 | aggregation of unicellular organisms |
1. PBF | GO:0051787 | misfolded protein binding |
1. PBF | GO:1903895 | negative regulation of IRE1-mediated unfolded protein response |
1. PBF | GO:0036128 | CatSper complex |
1. PBF | GO:0034099 | luminal surveillance complex |
1. PBF | GO:0006450 | regulation of translational fidelity |
1. PBF | GO:0090063 | positive regulation of microtubule nucleation |
1. PBF | GO:0061738 | late endosomal microautophagy |
1. PBF | GO:0006986 | response to unfolded protein |
1. PBF | GO:0140603 | obsolete ATP hydrolysis activity |
1. PBF | GO:1990904 | ribonucleoprotein complex |
1. PBF | GO:0030433 | ubiquitin-dependent ERAD pathway |
1. PBF | GO:0002181 | cytoplasmic translation |
1. PBF | GO:0005844 | polysome |
1. PBF | GO:1903955 | positive regulation of protein targeting to mitochondrion |
1. PBF | GO:0005524 | ATP binding |
1. PBF | GO:0034663 | endoplasmic reticulum chaperone complex |
1. PBF | GO:1903298 | negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway |
1. PBF | GO:0035437 | maintenance of protein localization in endoplasmic reticulum |
1. PBF | GO:0000974 | Prp19 complex |
1. PBF | GO:1990832 | slow axonal transport |
1. PBF | GO:0000054 | ribosomal subunit export from nucleus |
1. PBF | GO:0034620 | cellular response to unfolded protein |
1. PBF | GO:1904764 | chaperone-mediated autophagy translocation complex disassembly |
1. PBF | GO:0042149 | cellular response to glucose starvation |
1. PBF | GO:0051083 | 'de novo' cotranslational protein folding |
1. PBF | GO:0005788 | endoplasmic reticulum lumen |
1. PBF | GO:0042470 | melanosome |
1. PBF | GO:1903707 | negative regulation of hemopoiesis |
1. PBF | GO:0006412 | translation |
1. PBF | GO:1990833 | clathrin-uncoating ATPase activity |
1. PBF | GO:1903842 | response to arsenite ion |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0021589 | cerebellum structural organization |
1. PBF | GO:0099523 | presynaptic cytosol |
1. PBF | GO:0031625 | ubiquitin protein ligase binding |
1. PBF | GO:0097201 | negative regulation of transcription from RNA polymerase II promoter in response to stress |
1. PBF | GO:0006457 | protein folding |
1. PBF | GO:0016192 | vesicle-mediated transport |
1. PBF | GO:0071977 | bacterial-type flagellum-dependent swimming motility |
1. PBF | GO:0006616 | SRP-dependent cotranslational protein targeting to membrane, translocation |
1. PBF | GO:0005576 | extracellular region |
1. PBF | GO:0007339 | binding of sperm to zona pellucida |
1. PBF | GO:0062040 | fungal biofilm matrix |
1. PBF | GO:1901673 | regulation of mitotic spindle assembly |
1. PBF | GO:0030968 | endoplasmic reticulum unfolded protein response |
1. PBF | GO:0016226 | iron-sulfur cluster assembly |
1. PBF | GO:0042026 | protein refolding |
1. PBF | GO:1902037 | negative regulation of hematopoietic stem cell differentiation |
1. PBF | GO:0070880 | fungal-type cell wall beta-glucan biosynthetic process |
1. PBF | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
1. PBF | GO:0051085 | chaperone cofactor-dependent protein refolding |
1. PBF | GO:0006452 | translational frameshifting |
1. PBF | GO:0000742 | karyogamy involved in conjugation with cellular fusion |
1. PBF | GO:0030218 | erythrocyte differentiation |
1. PBF | GO:0031072 | heat shock protein binding |
1. PBF | GO:0006415 | translational termination |
1. PBF | GO:0099524 | postsynaptic cytosol |
1. PBF | GO:0097691 | bacterial extracellular vesicle |
1. PBF | GO:0072687 | meiotic spindle |
1. PBF | GO:0002199 | zona pellucida receptor complex |
1. PBF | GO:0044183 | protein folding chaperone |
4. PB | GO:0034605 | cellular response to heat |
4. PB | GO:0009409 | response to cold |
4. PB | GO:0044788 | modulation by host of viral process |
4. PB | GO:0019899 | enzyme binding |
4. PB | GO:0051861 | glycolipid binding |
4. PB | GO:0009408 | response to heat |
4. PB | GO:0031397 | negative regulation of protein ubiquitination |
4. PB | GO:0099021 | cortical endoplasmic reticulum lumen |
4. PB | GO:0070194 | synaptonemal complex disassembly |
4. PB | GO:0031396 | regulation of protein ubiquitination |
4. PB | GO:1904813 | ficolin-1-rich granule lumen |
4. PB | GO:1901998 | toxin transport |
4. PB | GO:0035967 | cellular response to topologically incorrect protein |
4. PB | GO:0005739 | mitochondrion |
4. PB | GO:0005634 | nucleus |
4. PB | GO:0043195 | terminal bouton |
4. PB | GO:0099634 | postsynaptic specialization membrane |
4. PB | GO:0099175 | regulation of postsynapse organization |
4. PB | GO:0016887 | ATP hydrolysis activity |
4. PB | GO:0044829 | positive regulation by host of viral genome replication |
4. PB | GO:0008566 | mitochondrial protein-transporting ATPase activity |
4. PB | GO:0098880 | maintenance of postsynaptic specialization structure |
4. PB | GO:0046686 | response to cadmium ion |
4. PB | GO:0006611 | protein export from nucleus |
4. PB | GO:1903891 | regulation of ATF6-mediated unfolded protein response |
4. PB | GO:1902904 | negative regulation of supramolecular fiber organization |
4. PB | GO:0001554 | luteolysis |
4. PB | GO:1901029 | negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway |
4. PB | GO:1904313 | response to methamphetamine hydrochloride |
4. PB | GO:0044297 | cell body |
4. PB | GO:0036498 | IRE1-mediated unfolded protein response |
4. PB | GO:0034975 | protein folding in endoplasmic reticulum |
4. PB | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
4. PB | GO:2001240 | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand |
4. PB | GO:0140545 | protein disaggregase activity |
4. PB | GO:0060904 | regulation of protein folding in endoplasmic reticulum |
4. PB | GO:1902946 | protein localization to early endosome |
4. PB | GO:0000049 | tRNA binding |
4. PB | GO:0009615 | response to virus |
4. PB | GO:0048026 | positive regulation of mRNA splicing, via spliceosome |
4. PB | GO:0070370 | cellular heat acclimation |
4. PB | GO:0051135 | positive regulation of NK T cell activation |
4. PB | GO:0030445 | yeast-form cell wall |
4. PB | GO:0090344 | negative regulation of cell aging |
4. PB | GO:1904592 | positive regulation of protein refolding |
4. PB | GO:0061635 | regulation of protein complex stability |
4. PB | GO:0097501 | stress response to metal ion |
4. PB | GO:1901896 | positive regulation of ATPase-coupled calcium transmembrane transporter activity |
4. PB | GO:0044309 | neuron spine |
4. PB | GO:0071353 | cellular response to interleukin-4 |
4. PB | GO:0045648 | positive regulation of erythrocyte differentiation |
4. PB | GO:0006281 | DNA repair |
4. PB | GO:0072562 | blood microparticle |
4. PB | GO:0097718 | disordered domain specific binding |
4. PB | GO:0097214 | positive regulation of lysosomal membrane permeability |
4. PB | GO:0043014 | alpha-tubulin binding |
4. PB | GO:0010971 | positive regulation of G2/M transition of mitotic cell cycle |
4. PB | GO:0072318 | clathrin coat disassembly |
4. PB | GO:0003723 | RNA binding |
4. PB | GO:0070434 | positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway |
4. PB | GO:0046034 | ATP metabolic process |
4. PB | GO:0031249 | denatured protein binding |
4. PB | GO:0071236 | cellular response to antibiotic |
4. PB | GO:0098690 | glycinergic synapse |
4. PB | GO:0055131 | C3HC4-type RING finger domain binding |
4. PB | GO:0031686 | A1 adenosine receptor binding |
4. PB | GO:0005790 | smooth endoplasmic reticulum |
4. PB | GO:0016235 | aggresome |
4. PB | GO:0016246 | RNA interference |
4. PB | GO:0006983 | ER overload response |
4. PB | GO:0035080 | heat shock-mediated polytene chromosome puffing |
4. PB | GO:0051301 | cell division |
4. PB | GO:0043624 | |
4. PB | GO:0016191 | synaptic vesicle uncoating |
4. PB | GO:0016234 | inclusion body |
4. PB | GO:0008270 | zinc ion binding |
4. PB | GO:0030446 | hyphal cell wall |
4. PB | GO:1903897 | regulation of PERK-mediated unfolded protein response |
4. PB | GO:0007141 | male meiosis I |
4. PB | GO:0000795 | synaptonemal complex |
4. PB | GO:0060548 | negative regulation of cell death |
4. PB | GO:0005813 | centrosome |
4. PB | GO:0042277 | peptide binding |
4. PB | GO:0001673 | male germ cell nucleus |
4. PB | GO:0051131 | chaperone-mediated protein complex assembly |
4. PB | GO:0101031 | chaperone complex |
4. PB | GO:1902236 | negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
4. PB | GO:0010499 | proteasomal ubiquitin-independent protein catabolic process |
4. PB | GO:0061077 | chaperone-mediated protein folding |
4. PB | GO:0005681 | spliceosomal complex |
4. PB | GO:1903265 | positive regulation of tumor necrosis factor-mediated signaling pathway |
4. PB | GO:0061684 | chaperone-mediated autophagy |
4. PB | GO:0001664 | G protein-coupled receptor binding |
4. PB | GO:0051087 | chaperone binding |
4. PB | GO:0045036 | protein targeting to chloroplast |
4. PB | GO:0140453 | protein aggregate center |
4. PB | GO:0001916 | positive regulation of T cell mediated cytotoxicity |
4. PB | GO:0090084 | negative regulation of inclusion body assembly |
4. PB | GO:0033120 | positive regulation of RNA splicing |
4. PB | GO:1902380 | positive regulation of endoribonuclease activity |
4. PB | GO:0042645 | mitochondrial nucleoid |
4. PB | GO:0001405 | PAM complex, Tim23 associated import motor |
4. PB | GO:0005840 | ribosome |
4. PB | GO:0035966 | response to topologically incorrect protein |
4. PB | GO:0005776 | autophagosome |
4. PB | GO:0035719 | tRNA import into nucleus |
4. PB | GO:0099503 | secretory vesicle |
4. PB | GO:0098575 | lumenal side of lysosomal membrane |
4. PB | GO:1990836 | lysosomal matrix |
4. PB | GO:1904593 | prostaglandin binding |
4. PB | GO:0098684 | photoreceptor ribbon synapse |
4. PB | GO:0048156 | tau protein binding |
4. PB | GO:0045345 | positive regulation of MHC class I biosynthetic process |
4. PB | GO:0021680 | cerebellar Purkinje cell layer development |
4. PB | GO:0071287 | cellular response to manganese ion |
4. PB | GO:1904589 | regulation of protein import |
5. P | GO:0042220 | response to cocaine |
5. P | GO:0032757 | positive regulation of interleukin-8 production |
5. P | GO:0071480 | cellular response to gamma radiation |
5. P | GO:0032279 | asymmetric synapse |
5. P | GO:0042826 | histone deacetylase binding |
6. F | GO:0031240 | external side of cell outer membrane |
6. F | GO:0005516 | calmodulin binding |
7. B | GO:0000902 | cell morphogenesis |
7. B | GO:0043066 | negative regulation of apoptotic process |
7. B | GO:0002931 | response to ischemia |
7. B | GO:0071682 | endocytic vesicle lumen |
7. B | GO:0071456 | cellular response to hypoxia |
7. B | GO:0016020 | membrane |
7. B | GO:0070062 | extracellular exosome |
7. B | GO:1903382 | negative regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway |
7. B | GO:0099513 | polymeric cytoskeletal fiber |
7. B | GO:0034976 | response to endoplasmic reticulum stress |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0051082 | unfolded protein binding |
GO:0140662 | ATP-dependent protein folding chaperone |
GO:0005524 | ATP binding |
GO:0006457 | protein folding |
GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | B1XB01 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.752 |
1. PBF | C5BEU1 | Chaperone protein HscA | 0.00e+00 | 4.75e-33 | 6.76e-122 | 0.7481 |
1. PBF | B1IA52 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.8784 |
1. PBF | B9LUC7 | Chaperone protein DnaK | 0.00e+00 | 1.08e-32 | 0.0 | 0.9434 |
1. PBF | Q11KJ6 | Chaperone protein DnaK | 0.00e+00 | 1.65e-52 | 0.0 | 0.9349 |
1. PBF | O52064 | Chaperone protein DnaK | 0.00e+00 | 4.55e-60 | 0.0 | 0.9387 |
1. PBF | A1UA31 | Chaperone protein DnaK | 0.00e+00 | 3.60e-53 | 0.0 | 0.9185 |
1. PBF | P0CB32 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 5.36e-31 | 1.97e-170 | 0.9145 |
1. PBF | B5BAX0 | Chaperone protein HscA | 0.00e+00 | 2.51e-32 | 4.37e-126 | 0.7588 |
1. PBF | P0CY98 | Chaperone protein DnaK | 0.00e+00 | 3.00e-57 | 0.0 | 0.9375 |
1. PBF | B1IWD5 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7588 |
1. PBF | Q89YW6 | Chaperone protein DnaK | 0.00e+00 | 1.32e-53 | 0.0 | 0.95 |
1. PBF | Q9XCB1 | Chaperone protein DnaK | 0.00e+00 | 1.12e-54 | 0.0 | 0.943 |
1. PBF | A1V0U6 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | 0.906 |
1. PBF | A6L2X7 | Chaperone protein DnaK | 0.00e+00 | 1.25e-52 | 0.0 | 0.9515 |
1. PBF | Q6F149 | Chaperone protein DnaK | 0.00e+00 | 4.36e-85 | 0.0 | 0.9616 |
1. PBF | A1KFH2 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | 0.9173 |
1. PBF | C0ZB48 | Chaperone protein DnaK | 0.00e+00 | 3.66e-58 | 0.0 | 0.8978 |
1. PBF | C3K275 | Chaperone protein DnaK | 0.00e+00 | 1.30e-54 | 0.0 | 0.9493 |
1. PBF | C3P8M0 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.931 |
1. PBF | B7NRH5 | Chaperone protein HscA | 0.00e+00 | 1.07e-31 | 5.34e-120 | 0.7589 |
1. PBF | P59769 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.71e-17 | 3.90e-170 | 0.9207 |
1. PBF | Q8G6W1 | Chaperone protein DnaK | 0.00e+00 | 3.65e-52 | 0.0 | 0.9429 |
1. PBF | Q48RR3 | Chaperone protein DnaK | 0.00e+00 | 2.30e-62 | 0.0 | 0.8811 |
1. PBF | A3MN99 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | 0.9234 |
1. PBF | Q92J36 | Chaperone protein DnaK | 0.00e+00 | 2.44e-54 | 0.0 | 0.9188 |
1. PBF | Q9PB05 | Chaperone protein DnaK | 0.00e+00 | 9.82e-55 | 0.0 | 0.9335 |
1. PBF | P71331 | Chaperone protein DnaK | 0.00e+00 | 1.66e-60 | 0.0 | 0.9326 |
1. PBF | P53623 | Heat shock protein 70 2 | 0.00e+00 | 1.43e-40 | 2.49e-165 | 0.9044 |
1. PBF | C4Z1J4 | Chaperone protein DnaK | 0.00e+00 | 4.72e-46 | 0.0 | 0.9138 |
1. PBF | Q5XAD6 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.9049 |
1. PBF | Q8EHT7 | Chaperone protein DnaK | 0.00e+00 | 1.55e-54 | 0.0 | 0.9422 |
1. PBF | P05646 | Chaperone protein DnaK | 0.00e+00 | 1.11e-63 | 0.0 | 0.9456 |
1. PBF | P50023 | Chaperone protein DnaK | 0.00e+00 | 7.24e-57 | 0.0 | 0.9299 |
1. PBF | O69298 | Chaperone protein DnaK | 0.00e+00 | 4.03e-52 | 0.0 | 0.9491 |
1. PBF | Q4QJW4 | Chaperone protein DnaK | 0.00e+00 | 3.75e-59 | 0.0 | 0.9361 |
1. PBF | Q75E44 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 1.51e-42 | 9.32e-142 | 0.91 |
1. PBF | O87712 | Chaperone protein DnaK | 0.00e+00 | 2.08e-46 | 0.0 | 0.9434 |
1. PBF | Q03WI2 | Chaperone protein DnaK | 0.00e+00 | 1.93e-55 | 0.0 | 0.9394 |
1. PBF | Q7NXI3 | Chaperone protein DnaK | 0.00e+00 | 5.36e-51 | 0.0 | 0.9346 |
1. PBF | A7Z6W1 | Chaperone protein DnaK | 0.00e+00 | 5.15e-59 | 0.0 | 0.9462 |
1. PBF | O06942 | Chaperone protein DnaK | 0.00e+00 | 1.57e-59 | 0.0 | 0.8888 |
1. PBF | Q1IT15 | Chaperone protein DnaK | 0.00e+00 | 1.40e-47 | 0.0 | 0.9506 |
1. PBF | B5RD08 | Chaperone protein HscA | 0.00e+00 | 3.38e-32 | 5.84e-126 | 0.7518 |
1. PBF | A5IXT5 | Chaperone protein DnaK | 0.00e+00 | 2.73e-73 | 0.0 | 0.9578 |
1. PBF | Q01877 | Heat shock protein HSS1 | 0.00e+00 | 3.76e-34 | 8.77e-170 | 0.9093 |
1. PBF | Q8YE76 | Chaperone protein DnaK | 0.00e+00 | 1.08e-49 | 0.0 | 0.9039 |
1. PBF | Q7U3C4 | Chaperone protein dnaK2 | 0.00e+00 | 1.40e-49 | 0.0 | 0.9577 |
1. PBF | Q1MPW1 | Chaperone protein DnaK | 0.00e+00 | 1.63e-54 | 0.0 | 0.9522 |
1. PBF | A9WQR3 | Chaperone protein DnaK | 0.00e+00 | 1.13e-55 | 0.0 | 0.9445 |
1. PBF | Q8PAK9 | Chaperone protein DnaK | 0.00e+00 | 2.26e-54 | 0.0 | 0.933 |
1. PBF | A9AGU7 | Chaperone protein HscA homolog | 0.00e+00 | 1.65e-34 | 5.09e-123 | 0.7591 |
1. PBF | A4WDA7 | Chaperone protein HscA | 0.00e+00 | 1.03e-34 | 1.09e-120 | 0.7582 |
1. PBF | Q05FS8 | Chaperone protein DnaK | 0.00e+00 | 8.00e-43 | 0.0 | 0.9297 |
1. PBF | A3ND68 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | 0.9062 |
1. PBF | Q326K7 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | 0.9275 |
1. PBF | Q39EU4 | Chaperone protein HscA homolog | 0.00e+00 | 9.31e-36 | 2.83e-120 | 0.7624 |
1. PBF | A0KTS5 | Chaperone protein DnaK | 0.00e+00 | 3.23e-54 | 0.0 | 0.9449 |
1. PBF | Q5F8E8 | Chaperone protein HscA homolog | 0.00e+00 | 3.71e-36 | 3.57e-130 | 0.7583 |
1. PBF | P14834 | Heat shock 70 kDa protein (Fragment) | 0.00e+00 | 8.48e-05 | 4.95e-156 | 0.8987 |
1. PBF | Q7W8U9 | Chaperone protein HscA homolog | 0.00e+00 | 6.52e-34 | 1.90e-116 | 0.7571 |
1. PBF | Q4KIH1 | Chaperone protein DnaK | 0.00e+00 | 3.14e-52 | 0.0 | 0.9555 |
1. PBF | A4VZB5 | Chaperone protein DnaK | 0.00e+00 | 4.50e-62 | 0.0 | 0.8907 |
1. PBF | B8D8B9 | Chaperone protein HscA | 0.00e+00 | 2.03e-34 | 4.95e-103 | 0.7296 |
1. PBF | O32482 | Chaperone protein DnaK | 0.00e+00 | 1.77e-51 | 0.0 | 0.9241 |
1. PBF | P75344 | Chaperone protein DnaK | 0.00e+00 | 1.66e-62 | 0.0 | 0.9592 |
1. PBF | A8IPT1 | Chaperone protein DnaK | 0.00e+00 | 3.95e-54 | 0.0 | 0.9332 |
1. PBF | Q91291 | Heat shock 70 kDa protein | 0.00e+00 | 1.93e-35 | 6.03e-160 | 0.9124 |
1. PBF | B2G6W3 | Chaperone protein DnaK | 0.00e+00 | 1.56e-48 | 0.0 | 0.943 |
1. PBF | O87384 | Chaperone protein DnaK | 0.00e+00 | 1.11e-52 | 0.0 | 0.9324 |
1. PBF | B9KBT4 | Chaperone protein DnaK | 0.00e+00 | 3.16e-57 | 0.0 | 0.9396 |
1. PBF | A1WX31 | Chaperone protein DnaK | 0.00e+00 | 1.01e-51 | 0.0 | 0.9599 |
1. PBF | B3H2X7 | Chaperone protein DnaK | 0.00e+00 | 1.11e-60 | 0.0 | 0.9431 |
1. PBF | B1YKS9 | Chaperone protein DnaK | 0.00e+00 | 8.89e-57 | 0.0 | 0.922 |
1. PBF | Q607A5 | Chaperone protein DnaK | 0.00e+00 | 5.73e-50 | 0.0 | 0.9461 |
1. PBF | Q4U0F3 | Heat shock 70 kDa protein 1B | 0.00e+00 | 4.48e-36 | 2.87e-175 | 0.9157 |
1. PBF | P95829 | Chaperone protein DnaK | 0.00e+00 | 1.39e-61 | 0.0 | 0.8867 |
1. PBF | A3N0T5 | Chaperone protein HscA homolog | 0.00e+00 | 7.40e-36 | 9.89e-128 | 0.7463 |
1. PBF | P0C937 | Chaperone protein DnaK | 0.00e+00 | 1.60e-48 | 0.0 | 0.9551 |
1. PBF | B8J402 | Chaperone protein DnaK | 0.00e+00 | 5.42e-52 | 0.0 | 0.9463 |
1. PBF | B8GNX1 | Chaperone protein DnaK | 0.00e+00 | 5.29e-52 | 0.0 | 0.9332 |
1. PBF | A9KG88 | Chaperone protein DnaK | 0.00e+00 | 2.08e-46 | 0.0 | 0.9432 |
1. PBF | Q1MN11 | Chaperone protein DnaK | 0.00e+00 | 1.05e-49 | 0.0 | 0.9366 |
1. PBF | B3PF33 | Chaperone protein DnaK | 0.00e+00 | 2.08e-55 | 0.0 | 0.9464 |
1. PBF | O73885 | Heat shock cognate 71 kDa protein | 0.00e+00 | 1.97e-35 | 7.83e-174 | 0.915 |
1. PBF | C3K1M1 | Chaperone protein HscA homolog | 0.00e+00 | 3.11e-33 | 9.46e-126 | 0.7466 |
1. PBF | Q95YL7 | Mitochondrial-type heat shock protein 70 | 0.00e+00 | 3.02e-28 | 6.32e-175 | 0.8576 |
1. PBF | Q0T1Z3 | Chaperone protein HscA | 0.00e+00 | 1.82e-31 | 5.53e-119 | 0.7505 |
1. PBF | Q5PAB8 | Chaperone protein DnaK | 0.00e+00 | 4.61e-46 | 0.0 | 0.9365 |
1. PBF | Q9ZEJ0 | Chaperone protein DnaK | 0.00e+00 | 1.54e-77 | 0.0 | 0.97 |
1. PBF | Q835R7 | Chaperone protein DnaK | 0.00e+00 | 4.28e-59 | 0.0 | 0.9069 |
1. PBF | Q9HRY2 | Chaperone protein DnaK | 0.00e+00 | 2.72e-40 | 0.0 | 0.9493 |
1. PBF | Q5QXL1 | Chaperone protein DnaK | 0.00e+00 | 9.60e-48 | 0.0 | 0.9494 |
1. PBF | P37900 | Heat shock 70 kDa protein, mitochondrial | 0.00e+00 | 2.39e-19 | 0.0 | 0.9342 |
1. PBF | B3R475 | Chaperone protein HscA homolog | 0.00e+00 | 8.57e-35 | 1.60e-132 | 0.7611 |
1. PBF | P57660 | Chaperone protein HscA | 0.00e+00 | 2.03e-34 | 4.95e-103 | 0.6763 |
1. PBF | P26791 | Heat shock 70 kDa protein | 0.00e+00 | 7.40e-36 | 1.01e-150 | 0.8962 |
1. PBF | Q8TQR2 | Chaperone protein DnaK | 0.00e+00 | 8.31e-56 | 0.0 | 0.9052 |
1. PBF | C0QGP6 | Chaperone protein DnaK | 0.00e+00 | 3.57e-54 | 0.0 | 0.9584 |
1. PBF | Q0VA61 | Hypoxia up-regulated protein 1 (Fragment) | 0.00e+00 | 3.40e-10 | 4.41e-37 | 0.7396 |
1. PBF | Q92J07 | Chaperone protein HscA homolog | 0.00e+00 | 1.70e-30 | 1.18e-96 | 0.8459 |
1. PBF | B8FGS3 | Chaperone protein DnaK | 0.00e+00 | 9.60e-48 | 0.0 | 0.9498 |
1. PBF | A5V5P9 | Chaperone protein DnaK | 0.00e+00 | 5.24e-56 | 0.0 | 0.9348 |
1. PBF | A2Q0Z1 | Heat shock cognate 71 kDa protein | 0.00e+00 | 4.03e-36 | 2.78e-176 | 0.9125 |
1. PBF | P87047 | Heat shock 70 kDa protein 1 | 0.00e+00 | 4.42e-34 | 1.84e-157 | 0.8973 |
1. PBF | Q253K1 | Chaperone protein DnaK | 0.00e+00 | 2.17e-44 | 0.0 | 0.9491 |
1. PBF | Q6BZH1 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 5.07e-23 | 2.40e-177 | 0.9178 |
1. PBF | Q5R7D3 | Heat shock 70 kDa protein 1 | 0.00e+00 | 1.03e-34 | 1.55e-175 | 0.9208 |
1. PBF | G3I8R9 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 3.70e-26 | 7.22e-177 | 0.9125 |
1. PBF | Q5ZM98 | Stress-70 protein, mitochondrial | 0.00e+00 | 2.22e-12 | 0.0 | 0.9299 |
1. PBF | P64409 | Chaperone protein DnaK | 0.00e+00 | 2.24e-63 | 0.0 | 0.9494 |
1. PBF | A5I640 | Chaperone protein DnaK | 0.00e+00 | 2.45e-49 | 0.0 | 0.9506 |
1. PBF | B9E041 | Chaperone protein DnaK | 0.00e+00 | 2.76e-50 | 0.0 | 0.9628 |
1. PBF | A1STE4 | Chaperone protein DnaK | 0.00e+00 | 8.54e-51 | 0.0 | 0.9227 |
1. PBF | A3D7T4 | Chaperone protein DnaK | 0.00e+00 | 2.41e-53 | 0.0 | 0.946 |
1. PBF | Q5HNW6 | Chaperone protein DnaK | 0.00e+00 | 4.39e-61 | 0.0 | 0.9324 |
1. PBF | B5R598 | Chaperone protein HscA | 0.00e+00 | 3.38e-32 | 5.84e-126 | 0.756 |
1. PBF | Q4A658 | Chaperone protein DnaK | 0.00e+00 | 2.14e-67 | 0.0 | 0.9704 |
1. PBF | Q98QY7 | Chaperone protein DnaK | 0.00e+00 | 1.40e-73 | 0.0 | 0.9526 |
1. PBF | B7LDB8 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7605 |
1. PBF | A1KSG3 | Chaperone protein DnaK | 0.00e+00 | 1.39e-58 | 0.0 | 0.9273 |
1. PBF | Q88VM0 | Chaperone protein DnaK | 0.00e+00 | 3.20e-49 | 0.0 | 0.9229 |
1. PBF | B9IY81 | Chaperone protein DnaK | 0.00e+00 | 1.12e-57 | 0.0 | 0.9278 |
1. PBF | Q4FPS9 | Chaperone protein DnaK | 0.00e+00 | 5.11e-53 | 0.0 | 0.9475 |
1. PBF | P20030 | Heat shock cognate HSP70 protein | 0.00e+00 | 3.45e-32 | 3.63e-129 | 0.9196 |
1. PBF | B6J7U7 | Chaperone protein DnaK | 0.00e+00 | 2.08e-46 | 0.0 | 0.9426 |
1. PBF | P08418 | Heat shock 70 kDa protein homolog | 0.00e+00 | 1.78e-35 | 4.82e-168 | 0.9195 |
1. PBF | B2HPS1 | Chaperone protein DnaK | 0.00e+00 | 2.05e-54 | 0.0 | 0.9335 |
1. PBF | A1VFG6 | Chaperone protein DnaK | 0.00e+00 | 4.59e-55 | 0.0 | 0.9521 |
1. PBF | Q0HY11 | Chaperone protein DnaK | 0.00e+00 | 3.85e-54 | 0.0 | 0.9426 |
1. PBF | A8H2N0 | Chaperone protein HscA homolog | 0.00e+00 | 2.65e-37 | 9.92e-122 | 0.7631 |
1. PBF | B8E4S1 | Chaperone protein DnaK | 0.00e+00 | 1.03e-52 | 0.0 | 0.9429 |
1. PBF | Q0TNS7 | Chaperone protein DnaK | 0.00e+00 | 3.19e-50 | 0.0 | 0.9487 |
1. PBF | Q74ZJ0 | Heat shock protein homolog SSE1 | 0.00e+00 | 3.28e-12 | 6.49e-38 | 0.7679 |
1. PBF | A2SIR4 | Chaperone protein DnaK | 0.00e+00 | 2.06e-52 | 0.0 | 0.9267 |
1. PBF | A6TSM0 | Chaperone protein DnaK | 0.00e+00 | 4.67e-52 | 0.0 | 0.9381 |
1. PBF | Q3IUI0 | Chaperone protein DnaK | 0.00e+00 | 1.92e-25 | 0.0 | 0.942 |
1. PBF | P53421 | Heat shock protein 70 1 | 0.00e+00 | 1.74e-41 | 3.96e-165 | 0.9066 |
1. PBF | B5FAW4 | Chaperone protein HscA homolog | 0.00e+00 | 1.62e-37 | 3.95e-120 | 0.7579 |
1. PBF | A3PNM1 | Chaperone protein DnaK | 0.00e+00 | 8.04e-50 | 0.0 | 0.9578 |
1. PBF | B0BWH1 | Chaperone protein DnaK | 0.00e+00 | 1.29e-51 | 0.0 | 0.9581 |
1. PBF | P83616 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.71e-17 | 3.90e-170 | 0.9163 |
1. PBF | Q03FR7 | Chaperone protein DnaK | 0.00e+00 | 2.83e-50 | 0.0 | 0.943 |
1. PBF | Q84BU4 | Chaperone protein DnaK | 0.00e+00 | 4.19e-51 | 0.0 | 0.9653 |
1. PBF | Q3Z6P1 | Chaperone protein DnaK | 0.00e+00 | 4.37e-54 | 0.0 | 0.9508 |
1. PBF | Q05981 | Chaperone protein DnaK | 0.00e+00 | 2.76e-50 | 0.0 | 0.9006 |
1. PBF | B0BTI7 | Chaperone protein DnaK | 0.00e+00 | 4.43e-60 | 0.0 | 0.9381 |
1. PBF | Q63SN5 | Chaperone protein HscA homolog | 0.00e+00 | 7.73e-35 | 1.55e-121 | 0.7603 |
1. PBF | B9KCH0 | Chaperone protein DnaK | 0.00e+00 | 3.95e-56 | 0.0 | 0.9495 |
1. PBF | Q07437 | Heat shock 70 kDa protein | 0.00e+00 | 1.12e-36 | 3.42e-165 | 0.9134 |
1. PBF | Q0I3V2 | Chaperone protein DnaK | 0.00e+00 | 3.16e-57 | 0.0 | 0.9271 |
1. PBF | Q5WHG1 | Chaperone protein DnaK | 0.00e+00 | 7.62e-57 | 0.0 | 0.9414 |
1. PBF | A6QBG0 | Chaperone protein DnaK | 0.00e+00 | 3.33e-57 | 0.0 | 0.948 |
1. PBF | A5TZ77 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | 0.9172 |
1. PBF | Q7UM31 | Chaperone protein DnaK | 0.00e+00 | 3.13e-48 | 0.0 | 0.9442 |
1. PBF | B7IBK5 | Chaperone protein DnaK | 0.00e+00 | 2.21e-54 | 0.0 | 0.9441 |
1. PBF | Q6FW50 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 1.32e-22 | 3.31e-180 | 0.9055 |
1. PBF | B5FR81 | Chaperone protein HscA | 0.00e+00 | 3.38e-32 | 5.84e-126 | 0.7558 |
1. PBF | B0VD55 | Chaperone protein HscA homolog | 0.00e+00 | 9.50e-35 | 1.10e-124 | 0.7467 |
1. PBF | Q05866 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.02e-30 | 2.71e-170 | 0.9152 |
1. PBF | Q2A328 | Chaperone protein DnaK | 0.00e+00 | 1.50e-55 | 0.0 | 0.9429 |
1. PBF | Q21X09 | Chaperone protein DnaK | 0.00e+00 | 6.68e-51 | 0.0 | 0.9254 |
1. PBF | A3DF25 | Chaperone protein DnaK | 0.00e+00 | 4.40e-53 | 0.0 | 0.9458 |
1. PBF | C4L425 | Chaperone protein DnaK | 0.00e+00 | 7.24e-59 | 0.0 | 0.897 |
1. PBF | A1S8K7 | Chaperone protein DnaK | 0.00e+00 | 3.16e-57 | 0.0 | 0.9445 |
1. PBF | A3PTN4 | Chaperone protein DnaK | 0.00e+00 | 3.60e-53 | 0.0 | 0.95 |
1. PBF | Q0AKB1 | Chaperone protein DnaK | 0.00e+00 | 1.10e-55 | 0.0 | 0.9412 |
1. PBF | A5UBQ1 | Chaperone protein DnaK | 0.00e+00 | 2.74e-59 | 0.0 | 0.9411 |
1. PBF | Q8CWT3 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.881 |
1. PBF | Q97BG8 | Chaperone protein DnaK | 0.00e+00 | 1.74e-57 | 1.07e-178 | 0.9544 |
1. PBF | Q8DF66 | Chaperone protein DnaK | 0.00e+00 | 1.29e-58 | 0.0 | 0.9411 |
1. PBF | A7ZEB5 | Chaperone protein DnaK | 0.00e+00 | 9.25e-61 | 0.0 | 0.9582 |
1. PBF | Q5NVM9 | Heat shock cognate 71 kDa protein | 0.00e+00 | 2.19e-36 | 3.61e-176 | 0.9057 |
1. PBF | Q73GL7 | Chaperone protein DnaK | 0.00e+00 | 2.31e-47 | 0.0 | 0.9452 |
1. PBF | Q5X3M7 | Chaperone protein DnaK | 0.00e+00 | 2.01e-51 | 0.0 | 0.927 |
1. PBF | Q6CQ83 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 3.63e-42 | 1.11e-147 | 0.9217 |
1. PBF | A6V0V2 | Chaperone protein HscA homolog | 0.00e+00 | 2.16e-33 | 8.80e-123 | 0.7528 |
1. PBF | Q6KIH7 | Chaperone protein DnaK | 0.00e+00 | 3.37e-68 | 0.0 | 0.9636 |
1. PBF | B6JPL0 | Chaperone protein DnaK | 0.00e+00 | 3.02e-61 | 0.0 | 0.9463 |
1. PBF | A5UGH6 | Chaperone protein HscA homolog | 0.00e+00 | 1.56e-34 | 2.50e-125 | 0.7534 |
1. PBF | Q27965 | Heat shock 70 kDa protein 1B | 0.00e+00 | 4.52e-35 | 4.34e-176 | 0.9194 |
1. PBF | Q72DW8 | Chaperone protein DnaK | 0.00e+00 | 4.59e-55 | 0.0 | 0.9504 |
1. PBF | A4J7F3 | Chaperone protein DnaK | 0.00e+00 | 2.95e-53 | 0.0 | 0.9197 |
1. PBF | Q1Q7X0 | Chaperone protein DnaK | 0.00e+00 | 1.66e-53 | 0.0 | 0.9468 |
1. PBF | Q6S4N2 | Heat shock 70 kDa protein 1B | 0.00e+00 | 5.41e-36 | 2.89e-174 | 0.913 |
1. PBF | B4EDS3 | Chaperone protein HscA homolog | 0.00e+00 | 4.58e-36 | 3.01e-123 | 0.7636 |
1. PBF | A6T226 | Chaperone protein DnaK | 0.00e+00 | 6.08e-53 | 0.0 | 0.9371 |
1. PBF | A5GDC8 | Chaperone protein DnaK | 0.00e+00 | 2.38e-51 | 0.0 | 0.9596 |
1. PBF | A6Q421 | Chaperone protein DnaK | 0.00e+00 | 2.90e-49 | 0.0 | 0.9558 |
1. PBF | Q875P5 | Heat shock protein homolog SSE1 | 0.00e+00 | 9.34e-14 | 9.60e-42 | 0.7665 |
1. PBF | P0CS91 | Import motor subunit, mitochondrial | 0.00e+00 | 1.35e-27 | 0.0 | 0.9321 |
1. PBF | Q7VIE3 | Chaperone protein DnaK | 0.00e+00 | 2.37e-55 | 0.0 | 0.9368 |
1. PBF | A0K4S8 | Chaperone protein DnaK | 0.00e+00 | 4.49e-50 | 0.0 | 0.9196 |
1. PBF | Q4L6T0 | Chaperone protein DnaK | 0.00e+00 | 8.14e-60 | 0.0 | 0.9153 |
1. PBF | P22358 | Chaperone protein DnaK2 | 0.00e+00 | 3.00e-47 | 0.0 | 0.9585 |
1. PBF | B5XHZ0 | Chaperone protein DnaK | 0.00e+00 | 1.90e-62 | 0.0 | 0.8896 |
1. PBF | Q9TUG3 | Heat shock-related 70 kDa protein 2 | 0.00e+00 | 5.57e-37 | 2.12e-169 | 0.9092 |
1. PBF | A4QHJ0 | Chaperone protein DnaK | 0.00e+00 | 1.91e-51 | 0.0 | 0.9161 |
1. PBF | Q05944 | Heat shock 70 kDa protein | 0.00e+00 | 3.53e-34 | 5.29e-172 | 0.9 |
1. PBF | P87222 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 2.38e-41 | 5.91e-137 | 0.9243 |
1. PBF | Q72IK5 | Chaperone protein DnaK | 0.00e+00 | 3.89e-57 | 0.0 | 0.9402 |
1. PBF | C5BQ33 | Chaperone protein DnaK | 0.00e+00 | 3.10e-53 | 0.0 | 0.9429 |
1. PBF | P11144 | Heat shock 70 kDa protein | 0.00e+00 | 2.83e-27 | 5.05e-164 | 0.9202 |
1. PBF | C1F2D2 | Chaperone protein DnaK | 0.00e+00 | 1.00e-52 | 0.0 | 0.9463 |
1. PBF | P40918 | Heat shock 70 kDa protein | 0.00e+00 | 2.99e-38 | 9.14e-159 | 0.9178 |
1. PBF | Q8CP17 | Chaperone protein DnaK | 0.00e+00 | 4.27e-62 | 0.0 | 0.9271 |
1. PBF | A6U252 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9224 |
1. PBF | P56836 | Chaperone protein DnaK | 0.00e+00 | 1.22e-51 | 0.0 | 0.9469 |
1. PBF | A4TQF9 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | 0.94 |
1. PBF | Q9N1U2 | Heat shock 70 kDa protein 6 | 0.00e+00 | 1.03e-36 | 3.32e-178 | 0.9261 |
1. PBF | Q89A16 | Chaperone protein HscA | 0.00e+00 | 5.55e-04 | 7.35e-94 | 0.8892 |
1. PBF | B3QMB2 | Chaperone protein DnaK | 0.00e+00 | 2.38e-50 | 0.0 | 0.9535 |
1. PBF | Q2RNE6 | Chaperone protein DnaK | 0.00e+00 | 2.05e-54 | 0.0 | 0.9362 |
1. PBF | Q0AIY1 | Chaperone protein DnaK | 0.00e+00 | 1.97e-49 | 0.0 | 0.9559 |
1. PBF | Q826F6 | Chaperone protein dnaK2 | 0.00e+00 | 1.71e-54 | 0.0 | 0.9061 |
1. PBF | Q3YRR6 | Chaperone protein DnaK | 0.00e+00 | 2.97e-50 | 0.0 | 0.9632 |
1. PBF | Q0K757 | Chaperone protein DnaK | 0.00e+00 | 1.43e-50 | 0.0 | 0.9261 |
1. PBF | Q707X3 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 1.06e-41 | 1.10e-142 | 0.9107 |
1. PBF | E1C2P3 | Heat shock 70 kDa protein 14 | 0.00e+00 | 1.25e-03 | 3.29e-54 | 0.6363 |
1. PBF | Q88DU2 | Chaperone protein DnaK | 0.00e+00 | 1.00e-52 | 0.0 | 0.9489 |
1. PBF | B5ZBE9 | Chaperone protein DnaK | 0.00e+00 | 4.62e-74 | 0.0 | 0.9772 |
1. PBF | Q8YW74 | Chaperone protein dnaK2 | 0.00e+00 | 6.01e-50 | 0.0 | 0.7255 |
1. PBF | Q5B2V1 | Heat shock 70 kDa protein | 0.00e+00 | 2.29e-36 | 7.77e-167 | 0.9077 |
1. PBF | A6LDG8 | Chaperone protein DnaK | 0.00e+00 | 5.69e-48 | 0.0 | 0.9549 |
1. PBF | Q7N228 | Chaperone protein HscA | 0.00e+00 | 9.79e-34 | 1.34e-127 | 0.7517 |
1. PBF | Q5GSE1 | Chaperone protein DnaK | 0.00e+00 | 7.89e-46 | 0.0 | 0.9118 |
1. PBF | Q15WH0 | Chaperone protein HscA homolog | 0.00e+00 | 6.38e-34 | 3.85e-113 | 0.7663 |
1. PBF | C1DD88 | Chaperone protein DnaK | 0.00e+00 | 5.08e-55 | 0.0 | 0.9345 |
1. PBF | Q0KCG7 | Chaperone protein HscA homolog | 0.00e+00 | 2.65e-36 | 5.26e-135 | 0.7613 |
1. PBF | A2RCW6 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.8926 |
1. PBF | P05456 | Heat shock 70 kDa protein | 0.00e+00 | 1.37e-21 | 2.01e-161 | 0.9244 |
1. PBF | A9A135 | Chaperone protein DnaK | 0.00e+00 | 2.54e-36 | 0.0 | 0.9132 |
1. PBF | A0T0X1 | Chaperone protein dnaK | 0.00e+00 | 2.76e-50 | 0.0 | 0.9262 |
1. PBF | Q5ZLK7 | Hypoxia up-regulated protein 1 | 0.00e+00 | 1.51e-02 | 1.51e-35 | 0.7712 |
1. PBF | Q886Z7 | Chaperone protein HscA homolog | 0.00e+00 | 3.00e-34 | 2.80e-134 | 0.7109 |
1. PBF | Q13E60 | Chaperone protein DnaK | 0.00e+00 | 3.19e-50 | 0.0 | 0.9243 |
1. PBF | A2SI25 | Chaperone protein HscA homolog | 0.00e+00 | 6.65e-34 | 1.66e-112 | 0.764 |
1. PBF | A9M296 | Chaperone protein DnaK | 0.00e+00 | 1.76e-58 | 0.0 | 0.9291 |
1. PBF | Q01233 | Heat shock 70 kDa protein | 0.00e+00 | 1.84e-37 | 5.91e-169 | 0.9095 |
1. PBF | O85282 | Chaperone protein DnaK | 0.00e+00 | 7.94e-48 | 0.0 | 0.9288 |
1. PBF | Q1CV46 | Chaperone protein DnaK | 0.00e+00 | 8.13e-62 | 0.0 | 0.9414 |
1. PBF | Q5FVX7 | Heat shock 70 kDa protein 14 | 0.00e+00 | 5.32e-03 | 2.68e-56 | 0.6353 |
1. PBF | A8FFD2 | Chaperone protein DnaK | 0.00e+00 | 8.97e-56 | 0.0 | 0.9453 |
1. PBF | A1VMG2 | Chaperone protein DnaK | 0.00e+00 | 1.44e-49 | 0.0 | 0.9536 |
1. PBF | A2SAS9 | Chaperone protein HscA homolog | 0.00e+00 | 4.33e-35 | 1.05e-121 | 0.7566 |
1. PBF | A3M8W9 | Chaperone protein DnaK | 0.00e+00 | 3.57e-54 | 0.0 | 0.948 |
1. PBF | A3NBA0 | Chaperone protein HscA homolog | 0.00e+00 | 7.12e-35 | 7.13e-120 | 0.7618 |
1. PBF | P99110 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9187 |
1. PBF | C0R3W7 | Chaperone protein DnaK | 0.00e+00 | 5.17e-48 | 0.0 | 0.9434 |
1. PBF | B0BPK8 | Chaperone protein HscA homolog | 0.00e+00 | 7.40e-36 | 9.89e-128 | 0.7436 |
1. PBF | B0S1F8 | Chaperone protein DnaK | 0.00e+00 | 5.79e-63 | 0.0 | 0.9573 |
1. PBF | A4T112 | Chaperone protein DnaK | 0.00e+00 | 4.19e-51 | 0.0 | 0.9466 |
1. PBF | B1LNI1 | Chaperone protein HscA | 0.00e+00 | 5.56e-32 | 1.40e-119 | 0.756 |
1. PBF | P0DJM2 | Chaperone protein DnaK | 0.00e+00 | 1.05e-55 | 0.0 | 0.9242 |
1. PBF | B2V2I5 | Chaperone protein DnaK | 0.00e+00 | 1.39e-53 | 0.0 | 0.9464 |
1. PBF | Q2LUH6 | Chaperone protein DnaK | 0.00e+00 | 1.25e-52 | 0.0 | 0.9519 |
1. PBF | C3L5R7 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9351 |
1. PBF | P83617 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.71e-17 | 3.90e-170 | 0.8959 |
1. PBF | P17821 | Chaperone protein DnaK | 0.00e+00 | 5.30e-46 | 0.0 | 0.8899 |
1. PBF | P02827 | Heat shock 70 kDa protein | 0.00e+00 | 5.25e-33 | 9.12e-169 | 0.9183 |
1. PBF | B0UVL9 | Chaperone protein HscA homolog | 0.00e+00 | 1.27e-34 | 2.72e-125 | 0.684 |
1. PBF | Q0BDQ8 | Chaperone protein HscA homolog | 0.00e+00 | 1.14e-34 | 3.35e-121 | 0.764 |
1. PBF | P37899 | Heat shock 70 kDa protein | 0.00e+00 | 8.39e-36 | 8.97e-163 | 0.9098 |
1. PBF | Q1IF59 | Chaperone protein DnaK | 0.00e+00 | 9.53e-53 | 0.0 | 0.9486 |
1. PBF | B0TYF2 | Chaperone protein DnaK | 0.00e+00 | 4.49e-56 | 0.0 | 0.9376 |
1. PBF | O69268 | Chaperone protein DnaK | 0.00e+00 | 8.81e-60 | 0.0 | 0.9287 |
1. PBF | Q7W519 | Chaperone protein DnaK | 0.00e+00 | 5.72e-59 | 0.0 | 0.922 |
1. PBF | Q3K3T2 | Chaperone protein DnaK | 0.00e+00 | 6.38e-62 | 0.0 | 0.8936 |
1. PBF | Q17VY4 | Chaperone protein DnaK | 0.00e+00 | 1.24e-60 | 0.0 | 0.9406 |
1. PBF | Q493S7 | Chaperone protein DnaK | 0.00e+00 | 1.93e-55 | 0.0 | 0.9333 |
1. PBF | Q81LS2 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9321 |
1. PBF | B8DRD6 | Chaperone protein DnaK | 0.00e+00 | 9.16e-48 | 0.0 | 0.9562 |
1. PBF | Q9WYK6 | Chaperone protein DnaK | 0.00e+00 | 2.71e-57 | 0.0 | 0.9432 |
1. PBF | Q8KML6 | Chaperone protein DnaK | 0.00e+00 | 5.08e-54 | 0.0 | 0.9259 |
1. PBF | Q566I3 | Hypoxia up-regulated protein 1 (Fragment) | 0.00e+00 | 6.78e-11 | 9.21e-38 | 0.7376 |
1. PBF | A1UUC3 | Chaperone protein DnaK | 0.00e+00 | 4.91e-52 | 0.0 | 0.9166 |
1. PBF | Q7VXG7 | Chaperone protein HscA homolog | 0.00e+00 | 3.99e-34 | 8.32e-116 | 0.7558 |
1. PBF | A4SZR8 | Chaperone protein DnaK | 0.00e+00 | 7.43e-55 | 0.0 | 0.9414 |
1. PBF | Q6F6N3 | Chaperone protein DnaK | 0.00e+00 | 1.28e-52 | 0.0 | 0.9499 |
1. PBF | B2RJ90 | Chaperone protein DnaK | 0.00e+00 | 2.03e-48 | 0.0 | 0.9549 |
1. PBF | P43736 | Chaperone protein DnaK | 0.00e+00 | 3.75e-59 | 0.0 | 0.9352 |
1. PBF | A8LWM4 | Chaperone protein DnaK | 0.00e+00 | 4.07e-58 | 0.0 | 0.9476 |
1. PBF | A9ILH7 | Chaperone protein DnaK | 0.00e+00 | 9.29e-54 | 0.0 | 0.937 |
1. PBF | Q5E4T4 | Chaperone protein DnaK 1 | 0.00e+00 | 1.07e-58 | 0.0 | 0.9509 |
1. PBF | A3QFD1 | Chaperone protein HscA homolog | 0.00e+00 | 2.01e-35 | 5.47e-121 | 0.7587 |
1. PBF | B0RBI1 | Chaperone protein DnaK | 0.00e+00 | 4.14e-55 | 0.0 | 0.9195 |
1. PBF | Q4K6U2 | Chaperone protein HscA homolog | 0.00e+00 | 3.05e-35 | 4.32e-133 | 0.7494 |
1. PBF | Q4G366 | Chaperone protein dnaK | 0.00e+00 | 6.67e-58 | 0.0 | 0.7275 |
1. PBF | A4VNX8 | Chaperone protein HscA homolog | 0.00e+00 | 2.39e-36 | 5.49e-130 | 0.7583 |
1. PBF | P47773 | Heat shock cognate 71 kDa protein | 0.00e+00 | 1.85e-36 | 1.19e-168 | 0.9089 |
1. PBF | Q2SXE0 | Chaperone protein HscA homolog | 0.00e+00 | 1.14e-34 | 5.00e-120 | 0.7594 |
1. PBF | A9N8H2 | Chaperone protein DnaK | 0.00e+00 | 2.08e-46 | 0.0 | 0.9411 |
1. PBF | Q04LY0 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.8787 |
1. PBF | A8GR22 | Chaperone protein DnaK | 0.00e+00 | 1.29e-51 | 0.0 | 0.9245 |
1. PBF | B4TRB1 | Chaperone protein HscA | 0.00e+00 | 3.73e-32 | 3.20e-126 | 0.7506 |
1. PBF | A8A332 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7564 |
1. PBF | B4F2V5 | Chaperone protein DnaK | 0.00e+00 | 9.35e-58 | 0.0 | 0.9433 |
1. PBF | Q5KWZ7 | Chaperone protein DnaK | 0.00e+00 | 5.76e-54 | 0.0 | 0.957 |
1. PBF | A0Q7F0 | Chaperone protein DnaK | 0.00e+00 | 1.50e-55 | 0.0 | 0.9444 |
1. PBF | Q14GW9 | Chaperone protein DnaK | 0.00e+00 | 2.43e-56 | 0.0 | 0.9443 |
1. PBF | A5F361 | Chaperone protein DnaK | 0.00e+00 | 6.42e-60 | 0.0 | 0.9361 |
1. PBF | Q6B8V2 | Chaperone protein dnaK | 0.00e+00 | 1.84e-59 | 0.0 | 0.9623 |
1. PBF | A5F3G8 | Chaperone protein HscA homolog | 0.00e+00 | 2.64e-35 | 1.14e-129 | 0.7546 |
1. PBF | Q8EPW4 | Chaperone protein DnaK | 0.00e+00 | 3.94e-55 | 0.0 | 0.9432 |
1. PBF | C4K110 | Chaperone protein DnaK | 0.00e+00 | 9.06e-54 | 0.0 | 0.9279 |
1. PBF | Q0VCX2 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 3.77e-26 | 4.57e-177 | 0.915 |
1. PBF | B3WEQ7 | Chaperone protein DnaK | 0.00e+00 | 1.96e-45 | 0.0 | 0.9576 |
1. PBF | A5FZ19 | Chaperone protein DnaK | 0.00e+00 | 2.71e-52 | 0.0 | 0.9597 |
1. PBF | B0TQC2 | Chaperone protein DnaK | 0.00e+00 | 1.88e-56 | 0.0 | 0.9518 |
1. PBF | Q5R4P0 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 1.99e-26 | 8.56e-176 | 0.9128 |
1. PBF | A7GT08 | Chaperone protein DnaK | 0.00e+00 | 1.57e-56 | 0.0 | 0.9299 |
1. PBF | A1B4E9 | Chaperone protein DnaK | 0.00e+00 | 4.13e-52 | 0.0 | 0.953 |
1. PBF | A8YVQ3 | Chaperone protein DnaK | 0.00e+00 | 1.08e-53 | 0.0 | 0.9633 |
1. PBF | P69376 | Chaperone protein dnaK | 0.00e+00 | 5.29e-62 | 0.0 | 0.9532 |
1. PBF | Q1LST3 | Chaperone protein DnaK | 0.00e+00 | 3.05e-55 | 0.0 | 0.9264 |
1. PBF | Q03MR6 | Chaperone protein DnaK | 0.00e+00 | 9.43e-63 | 0.0 | 0.8861 |
1. PBF | Q49Y22 | Chaperone protein DnaK | 0.00e+00 | 1.09e-57 | 0.0 | 0.9281 |
1. PBF | Q3IYM7 | Chaperone protein DnaK | 0.00e+00 | 1.24e-49 | 0.0 | 0.9582 |
1. PBF | Q08276 | Heat shock 70 kDa protein, mitochondrial | 0.00e+00 | 6.55e-17 | 0.0 | 0.9503 |
1. PBF | B3DZP7 | Chaperone protein DnaK | 0.00e+00 | 8.49e-47 | 0.0 | 0.9372 |
1. PBF | Q62IZ5 | Chaperone protein HscA homolog | 0.00e+00 | 4.33e-35 | 1.05e-121 | 0.7611 |
1. PBF | A8FLH2 | Chaperone protein DnaK | 0.00e+00 | 5.69e-52 | 0.0 | 0.9519 |
1. PBF | P09189 | Heat shock cognate 70 kDa protein | 0.00e+00 | 2.36e-32 | 4.97e-164 | 0.9192 |
1. PBF | Q60446 | Heat shock protein 105 kDa | 0.00e+00 | 3.36e-03 | 1.09e-48 | 0.8176 |
1. PBF | B9DVF3 | Chaperone protein DnaK | 0.00e+00 | 2.01e-62 | 0.0 | 0.8808 |
1. PBF | B5ENY5 | Chaperone protein HscA homolog | 0.00e+00 | 3.53e-34 | 5.33e-113 | 0.7616 |
1. PBF | B2GGP0 | Chaperone protein DnaK | 0.00e+00 | 2.92e-54 | 0.0 | 0.9366 |
1. PBF | Q27975 | Heat shock 70 kDa protein 1A | 0.00e+00 | 1.15e-35 | 4.89e-176 | 0.9133 |
1. PBF | A4XKA4 | Chaperone protein DnaK | 0.00e+00 | 2.24e-53 | 0.0 | 0.9578 |
1. PBF | Q7WGI4 | Chaperone protein DnaK | 0.00e+00 | 6.69e-59 | 0.0 | 0.9221 |
1. PBF | C5B7L7 | Chaperone protein DnaK | 0.00e+00 | 7.93e-60 | 0.0 | 0.9248 |
1. PBF | A4JBS1 | Chaperone protein DnaK | 0.00e+00 | 2.56e-50 | 0.0 | 0.9052 |
1. PBF | B8E9D6 | Chaperone protein HscA homolog | 0.00e+00 | 2.43e-35 | 1.28e-123 | 0.7573 |
1. PBF | A6VCL8 | Chaperone protein DnaK | 0.00e+00 | 2.10e-54 | 0.0 | 0.9454 |
1. PBF | Q51382 | Chaperone protein HscA homolog | 0.00e+00 | 2.07e-33 | 5.37e-123 | 0.7548 |
1. PBF | Q0HVP0 | Chaperone protein HscA homolog | 0.00e+00 | 1.11e-38 | 5.96e-126 | 0.7461 |
1. PBF | Q45551 | Chaperone protein DnaK | 0.00e+00 | 1.16e-58 | 0.0 | 0.9436 |
1. PBF | Q313S2 | Chaperone protein DnaK | 0.00e+00 | 9.57e-52 | 0.0 | 0.9309 |
1. PBF | Q65H54 | Chaperone protein DnaK | 0.00e+00 | 5.42e-59 | 0.0 | 0.9401 |
1. PBF | P27541 | Heat shock 70 kDa protein | 0.00e+00 | 6.53e-36 | 1.42e-168 | 0.9064 |
1. PBF | A8GMI8 | Chaperone protein HscA homolog | 0.00e+00 | 9.66e-30 | 4.35e-97 | 0.8344 |
1. PBF | Q49539 | Chaperone protein DnaK | 0.00e+00 | 2.06e-69 | 0.0 | 0.9484 |
1. PBF | P50019 | Chaperone protein DnaK | 0.00e+00 | 4.83e-55 | 0.0 | 0.9393 |
1. PBF | Q71U34 | Heat shock cognate 71 kDa protein | 0.00e+00 | 4.03e-36 | 2.78e-176 | 0.9222 |
1. PBF | A5VJE7 | Chaperone protein DnaK | 0.00e+00 | 1.56e-48 | 0.0 | 0.9642 |
1. PBF | C1DE64 | Chaperone protein HscA homolog | 0.00e+00 | 1.65e-31 | 1.11e-120 | 0.7051 |
1. PBF | Q6L0S7 | Chaperone protein DnaK | 0.00e+00 | 1.32e-58 | 0.0 | 0.9494 |
1. PBF | B2IMB5 | Chaperone protein DnaK | 0.00e+00 | 3.74e-61 | 0.0 | 0.8863 |
1. PBF | A4XY39 | Chaperone protein HscA homolog | 0.00e+00 | 3.39e-34 | 2.40e-134 | 0.7576 |
1. PBF | B4T0R8 | Chaperone protein HscA | 0.00e+00 | 2.88e-32 | 6.03e-126 | 0.756 |
1. PBF | A1W7T4 | Chaperone protein HscA homolog | 0.00e+00 | 5.67e-35 | 1.85e-112 | 0.7514 |
1. PBF | Q01899 | Heat shock 70 kDa protein, mitochondrial | 0.00e+00 | 3.92e-19 | 0.0 | 0.9294 |
1. PBF | Q3KIA0 | Chaperone protein DnaK | 0.00e+00 | 1.35e-51 | 0.0 | 0.9533 |
1. PBF | Q465Y6 | Chaperone protein DnaK | 0.00e+00 | 6.71e-55 | 0.0 | 0.9255 |
1. PBF | Q21H36 | Chaperone protein DnaK | 0.00e+00 | 3.30e-52 | 0.0 | 0.9475 |
1. PBF | Q3S4T7 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 4.12e-26 | 1.57e-175 | 0.9166 |
1. PBF | B0BWJ7 | Chaperone protein HscA homolog | 0.00e+00 | 1.50e-29 | 1.07e-96 | 0.7037 |
1. PBF | A0QLZ6 | Chaperone protein DnaK | 0.00e+00 | 6.39e-53 | 0.0 | 0.9204 |
1. PBF | P68837 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.9077 |
1. PBF | A9IGC3 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9197 |
1. PBF | B4SSQ6 | Chaperone protein DnaK | 0.00e+00 | 1.57e-51 | 0.0 | 0.9423 |
1. PBF | J9VZ70 | Transcriptional coregulator SSA1 | 0.00e+00 | 3.31e-40 | 3.99e-170 | 0.9091 |
1. PBF | Q39PT7 | Chaperone protein DnaK | 0.00e+00 | 1.66e-47 | 0.0 | 0.9443 |
1. PBF | B5YAR3 | Chaperone protein DnaK | 0.00e+00 | 4.25e-55 | 0.0 | 0.9502 |
1. PBF | P64407 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9258 |
1. PBF | Q5N1J4 | Chaperone protein DnaK 2 | 0.00e+00 | 4.51e-53 | 0.0 | 0.9441 |
1. PBF | A9N1X9 | Chaperone protein HscA | 0.00e+00 | 2.82e-32 | 7.32e-126 | 0.7557 |
1. PBF | P44669 | Chaperone protein HscA homolog | 0.00e+00 | 2.55e-34 | 1.99e-125 | 0.7553 |
1. PBF | C1ESK8 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9347 |
1. PBF | A7MU49 | Chaperone protein HscA homolog | 0.00e+00 | 9.31e-36 | 4.48e-122 | 0.7517 |
1. PBF | B7H3H4 | Chaperone protein HscA homolog | 0.00e+00 | 9.50e-35 | 1.10e-124 | 0.6979 |
1. PBF | Q04VC8 | Chaperone protein DnaK | 0.00e+00 | 1.28e-52 | 0.0 | 0.952 |
1. PBF | B7UWI1 | Chaperone protein HscA homolog | 0.00e+00 | 1.20e-33 | 6.95e-123 | 0.7499 |
1. PBF | B7MIL6 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7582 |
1. PBF | A7NCM9 | Chaperone protein DnaK | 0.00e+00 | 1.50e-55 | 0.0 | 0.9433 |
1. PBF | P0A3J0 | Chaperone protein DnaK | 0.00e+00 | 3.73e-62 | 0.0 | 0.9128 |
1. PBF | Q3SEX4 | Chaperone protein HscA homolog | 0.00e+00 | 5.92e-33 | 1.44e-127 | 0.7643 |
1. PBF | P42373 | Chaperone protein DnaK | 0.00e+00 | 1.37e-47 | 0.0 | 0.8935 |
1. PBF | A0L4Z2 | Chaperone protein DnaK | 0.00e+00 | 7.34e-45 | 0.0 | 0.9312 |
1. PBF | A1RGN1 | Chaperone protein DnaK | 0.00e+00 | 1.14e-53 | 0.0 | 0.9458 |
1. PBF | B8DE38 | Chaperone protein DnaK | 0.00e+00 | 4.37e-54 | 0.0 | 0.9297 |
1. PBF | B2GBQ5 | Chaperone protein DnaK | 0.00e+00 | 2.51e-54 | 0.0 | 0.9523 |
1. PBF | C1AK26 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | 0.9176 |
1. PBF | A9KKU0 | Chaperone protein DnaK | 0.00e+00 | 5.63e-51 | 0.0 | 0.9267 |
1. PBF | Q818E9 | Chaperone protein DnaK | 0.00e+00 | 2.20e-57 | 0.0 | 0.9339 |
1. PBF | P94695 | Chaperone protein DnaK | 0.00e+00 | 2.13e-56 | 0.0 | 0.9285 |
1. PBF | B5FA11 | Chaperone protein DnaK | 0.00e+00 | 2.01e-58 | 0.0 | 0.9476 |
1. PBF | P41827 | Heat shock protein 70 B2 | 0.00e+00 | 5.34e-38 | 3.50e-176 | 0.9147 |
1. PBF | P0A3J2 | Chaperone protein DnaK | 0.00e+00 | 6.38e-62 | 0.0 | 0.8915 |
1. PBF | P41753 | Heat shock 70 kDa protein | 0.00e+00 | 4.76e-39 | 6.11e-166 | 0.907 |
1. PBF | B7UGX2 | Chaperone protein HscA | 0.00e+00 | 6.38e-32 | 1.12e-119 | 0.7557 |
1. PBF | B6YRF7 | Chaperone protein DnaK | 0.00e+00 | 2.92e-54 | 0.0 | 0.9494 |
1. PBF | Q12P79 | Chaperone protein HscA homolog | 0.00e+00 | 1.33e-35 | 5.12e-122 | 0.7607 |
1. PBF | Q48E62 | Chaperone protein DnaK | 0.00e+00 | 6.53e-54 | 0.0 | 0.9511 |
1. PBF | Q9CNV2 | Chaperone protein HscA homolog | 0.00e+00 | 3.99e-35 | 3.33e-126 | 0.7461 |
1. PBF | A1BET8 | Chaperone protein DnaK | 0.00e+00 | 3.53e-48 | 0.0 | 0.9458 |
1. PBF | Q5RE21 | Heat shock 70 kDa protein 14 | 0.00e+00 | 1.02e-03 | 6.61e-56 | 0.6346 |
1. PBF | P49118 | Luminal-binding protein | 0.00e+00 | 1.80e-23 | 1.01e-173 | 0.9152 |
1. PBF | Q02ZQ7 | Chaperone protein DnaK | 0.00e+00 | 2.42e-62 | 0.0 | 0.9193 |
1. PBF | B1JV00 | Chaperone protein HscA homolog | 0.00e+00 | 1.29e-34 | 4.36e-122 | 0.7625 |
1. PBF | Q5WV15 | Chaperone protein DnaK | 0.00e+00 | 9.57e-52 | 0.0 | 0.9232 |
1. PBF | B2SQU4 | Chaperone protein DnaK | 0.00e+00 | 3.14e-56 | 0.0 | 0.9322 |
1. PBF | B6JCI3 | Chaperone protein DnaK | 0.00e+00 | 2.17e-52 | 0.0 | 0.9155 |
1. PBF | Q9ZDX9 | Chaperone protein DnaK | 0.00e+00 | 4.51e-51 | 0.0 | 0.9279 |
1. PBF | B7H317 | Chaperone protein DnaK | 0.00e+00 | 2.21e-54 | 0.0 | 0.9386 |
1. PBF | A1K4C5 | Chaperone protein DnaK | 0.00e+00 | 1.17e-54 | 0.0 | 0.9452 |
1. PBF | Q04EE1 | Chaperone protein DnaK | 0.00e+00 | 2.07e-49 | 0.0 | 0.9597 |
1. PBF | P41770 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 2.84e-41 | 4.41e-145 | 0.9261 |
1. PBF | Q3IC08 | Chaperone protein DnaK | 0.00e+00 | 2.04e-57 | 0.0 | 0.9443 |
1. PBF | A4SYY9 | Chaperone protein HscA homolog | 0.00e+00 | 7.05e-38 | 1.23e-118 | 0.7626 |
1. PBF | Q6GGC0 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9207 |
1. PBF | Q1JA83 | Chaperone protein DnaK | 0.00e+00 | 1.20e-62 | 0.0 | 0.8953 |
1. PBF | O87777 | Chaperone protein DnaK | 0.00e+00 | 9.29e-54 | 0.0 | 0.928 |
1. PBF | B3Q972 | Chaperone protein DnaK | 0.00e+00 | 2.27e-50 | 0.0 | 0.9523 |
1. PBF | B8CXL1 | Chaperone protein DnaK | 0.00e+00 | 2.83e-49 | 0.0 | 0.9 |
1. PBF | B7ID00 | Chaperone protein DnaK | 0.00e+00 | 3.56e-63 | 0.0 | 0.9479 |
1. PBF | Q7MN85 | Chaperone protein DnaK | 0.00e+00 | 1.29e-58 | 0.0 | 0.9373 |
1. PBF | P48209 | Chaperone protein DnaK | 0.00e+00 | 2.61e-60 | 0.0 | 0.9489 |
1. PBF | P22010 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 5.69e-20 | 2.90e-171 | 0.9052 |
1. PBF | P18694 | Heat shock 70 kDa protein 2 | 0.00e+00 | 2.97e-40 | 8.78e-161 | 0.9014 |
1. PBF | A1V5M2 | Chaperone protein HscA homolog | 0.00e+00 | 4.33e-35 | 1.05e-121 | 0.763 |
1. PBF | A0B747 | Chaperone protein DnaK | 0.00e+00 | 5.37e-53 | 0.0 | 0.9343 |
1. PBF | C3PJM6 | Chaperone protein DnaK | 0.00e+00 | 4.06e-59 | 0.0 | 0.916 |
1. PBF | B7IYG7 | Chaperone protein DnaK | 0.00e+00 | 4.55e-57 | 0.0 | 0.934 |
1. PBF | B9MIT4 | Chaperone protein HscA homolog | 0.00e+00 | 3.06e-34 | 2.70e-113 | 0.7484 |
1. PBF | B8F7S6 | Chaperone protein DnaK | 0.00e+00 | 2.22e-60 | 0.0 | 0.9278 |
1. PBF | Q5ZTY3 | Chaperone protein DnaK | 0.00e+00 | 1.77e-51 | 0.0 | 0.924 |
1. PBF | B5Z9P0 | Chaperone protein DnaK | 0.00e+00 | 6.74e-62 | 0.0 | 0.9378 |
1. PBF | Q38W93 | Chaperone protein DnaK | 0.00e+00 | 7.82e-55 | 0.0 | 0.9311 |
1. PBF | Q4A8U5 | Chaperone protein DnaK | 0.00e+00 | 1.31e-69 | 0.0 | 0.9557 |
1. PBF | Q27031 | Heat shock 70 kDa protein | 0.00e+00 | 2.44e-36 | 1.99e-160 | 0.9155 |
1. PBF | P41826 | Heat shock protein 70 A2 | 0.00e+00 | 2.10e-36 | 1.60e-175 | 0.9167 |
1. PBF | Q75C78 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.92e-18 | 1.33e-176 | 0.915 |
1. PBF | B7HPL3 | Chaperone protein DnaK | 0.00e+00 | 1.12e-57 | 0.0 | 0.9331 |
1. PBF | A3N3K0 | Chaperone protein DnaK | 0.00e+00 | 1.00e-60 | 0.0 | 0.943 |
1. PBF | B2S0M0 | Chaperone protein DnaK | 0.00e+00 | 6.53e-57 | 0.0 | 0.9393 |
1. PBF | Q0BWZ9 | Chaperone protein DnaK | 0.00e+00 | 9.36e-57 | 0.0 | 0.9601 |
1. PBF | Q46XI7 | Chaperone protein DnaK | 0.00e+00 | 2.11e-52 | 0.0 | 0.9344 |
1. PBF | Q8EUH7 | Chaperone protein DnaK | 0.00e+00 | 2.11e-42 | 0.0 | 0.9784 |
1. PBF | Q8SQR8 | Heat shock protein homolog SSE1 | 6.44e-15 | 4.72e-07 | 8.64e-05 | 0.7158 |
1. PBF | Q37106 | Chaperone protein dnaK | 0.00e+00 | 1.12e-61 | 0.0 | 0.9552 |
1. PBF | Q7V7N7 | Chaperone protein dnaK1 | 0.00e+00 | 3.31e-40 | 2.17e-169 | 0.9282 |
1. PBF | P27542 | Chaperone protein DnaK | 0.00e+00 | 1.38e-45 | 0.0 | 0.9198 |
1. PBF | Q5LG30 | Chaperone protein DnaK | 0.00e+00 | 6.89e-53 | 0.0 | 0.958 |
1. PBF | A1TPY4 | Chaperone protein HscA homolog | 0.00e+00 | 4.70e-34 | 1.14e-117 | 0.761 |
1. PBF | Q0IIM3 | Heat shock protein 105 kDa | 0.00e+00 | 6.58e-03 | 5.42e-50 | 0.8047 |
1. PBF | C6BSF2 | Chaperone protein DnaK | 0.00e+00 | 3.53e-51 | 0.0 | 0.9595 |
1. PBF | B3CNB5 | Chaperone protein DnaK | 0.00e+00 | 9.16e-48 | 0.0 | 0.9469 |
1. PBF | Q5E3A7 | Chaperone protein DnaK 2 | 0.00e+00 | 2.82e-58 | 0.0 | 0.9432 |
1. PBF | B7JN39 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9319 |
1. PBF | P0A5C0 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | 0.9169 |
1. PBF | Q9I8F9 | Heat shock 70 kDa protein 1 | 0.00e+00 | 6.54e-40 | 5.06e-176 | 0.9229 |
1. PBF | O86103 | Chaperone protein DnaK (Fragment) | 0.00e+00 | 2.47e-42 | 0.0 | 0.8831 |
1. PBF | Q9KTX8 | Chaperone protein HscA homolog | 0.00e+00 | 2.64e-35 | 1.14e-129 | 0.7477 |
1. PBF | Q87BS8 | Chaperone protein DnaK | 0.00e+00 | 8.19e-54 | 0.0 | 0.9384 |
1. PBF | B5Z0Z9 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7589 |
1. PBF | Q0HLN0 | Chaperone protein DnaK | 0.00e+00 | 5.48e-54 | 0.0 | 0.943 |
1. PBF | Q74IT6 | Chaperone protein DnaK | 0.00e+00 | 1.67e-43 | 0.0 | 0.9598 |
1. PBF | A8H760 | Chaperone protein DnaK | 0.00e+00 | 8.74e-56 | 0.0 | 0.9491 |
1. PBF | Q7VQL4 | Chaperone protein DnaK | 0.00e+00 | 3.20e-49 | 0.0 | 0.9373 |
1. PBF | Q8YUA6 | Chaperone protein dnaK3 | 0.00e+00 | 7.73e-35 | 0.0 | 0.9239 |
1. PBF | Q0SRE3 | Chaperone protein DnaK | 0.00e+00 | 5.77e-51 | 0.0 | 0.9541 |
1. PBF | A9L0R8 | Chaperone protein DnaK | 0.00e+00 | 2.29e-53 | 0.0 | 0.9463 |
1. PBF | P19378 | Heat shock cognate 71 kDa protein | 0.00e+00 | 1.67e-36 | 2.80e-175 | 0.9086 |
1. PBF | Q080Q0 | Chaperone protein HscA homolog | 0.00e+00 | 8.02e-38 | 1.18e-121 | 0.7614 |
1. PBF | Q28222 | Heat shock 70 kDa protein 1 | 0.00e+00 | 1.57e-35 | 8.50e-163 | 0.8897 |
1. PBF | B7LKB3 | Chaperone protein HscA | 0.00e+00 | 1.05e-31 | 6.00e-120 | 0.7507 |
1. PBF | Q30Q10 | Chaperone protein DnaK | 0.00e+00 | 1.91e-52 | 0.0 | 0.9536 |
1. PBF | Q0BLK4 | Chaperone protein DnaK | 0.00e+00 | 1.50e-55 | 0.0 | 0.9418 |
1. PBF | B5RPM1 | Chaperone protein DnaK | 0.00e+00 | 1.37e-54 | 0.0 | 0.9564 |
1. PBF | Q08080 | Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) | 0.00e+00 | 4.90e-22 | 0.0 | 0.8904 |
1. PBF | Q9L7Z1 | Chaperone protein DnaK | 0.00e+00 | 1.74e-56 | 0.0 | 0.9366 |
1. PBF | Q01PM8 | Chaperone protein DnaK | 0.00e+00 | 1.13e-47 | 0.0 | 0.952 |
1. PBF | Q1RJ70 | Chaperone protein HscA homolog | 0.00e+00 | 5.47e-31 | 4.56e-96 | 0.7051 |
1. PBF | Q4UT11 | Chaperone protein DnaK | 0.00e+00 | 2.26e-54 | 0.0 | 0.9325 |
1. PBF | B8ZTB7 | Chaperone protein DnaK | 0.00e+00 | 4.85e-56 | 0.0 | 0.9135 |
1. PBF | Q8FF44 | Chaperone protein HscA | 0.00e+00 | 2.18e-32 | 1.70e-115 | 0.7589 |
1. PBF | B0TAD7 | Chaperone protein DnaK | 0.00e+00 | 1.06e-48 | 0.0 | 0.9584 |
1. PBF | O96772 | Mitochondrial-type heat shock protein 70 | 0.00e+00 | 9.48e-30 | 2.83e-177 | 0.8796 |
1. PBF | A4WW89 | Chaperone protein DnaK | 0.00e+00 | 2.06e-50 | 0.0 | 0.9626 |
1. PBF | Q5N1V0 | Chaperone protein DnaK 1 | 0.00e+00 | 1.89e-14 | 0.0 | 0.9378 |
1. PBF | B6IVA4 | Chaperone protein DnaK | 0.00e+00 | 2.64e-54 | 0.0 | 0.9521 |
1. PBF | B8DT62 | Chaperone protein DnaK | 0.00e+00 | 7.24e-57 | 0.0 | 0.9429 |
1. PBF | Q82EX9 | Chaperone protein dnaK1 | 0.00e+00 | 3.28e-48 | 0.0 | 0.9251 |
1. PBF | A7ZHA4 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | 0.9268 |
1. PBF | Q486Y6 | Chaperone protein HscA homolog | 0.00e+00 | 3.18e-35 | 1.42e-125 | 0.7638 |
1. PBF | P73098 | Chaperone protein dnaK3 | 0.00e+00 | 1.50e-11 | 0.0 | 0.8781 |
1. PBF | P08106 | Heat shock 70 kDa protein | 0.00e+00 | 3.97e-37 | 9.96e-170 | 0.9309 |
1. PBF | Q7VMA4 | Chaperone protein HscA homolog | 0.00e+00 | 5.79e-35 | 2.93e-119 | 0.7569 |
1. PBF | Q5NPS6 | Chaperone protein DnaK | 0.00e+00 | 9.44e-56 | 0.0 | 0.9007 |
1. PBF | P49463 | Chaperone protein dnaK | 0.00e+00 | 1.04e-56 | 0.0 | 0.9488 |
1. PBF | P0C0C6 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.9087 |
1. PBF | Q2NVZ1 | Chaperone protein DnaK | 0.00e+00 | 4.36e-55 | 0.0 | 0.9342 |
1. PBF | B7J5X3 | Chaperone protein HscA homolog | 0.00e+00 | 3.53e-34 | 5.33e-113 | 0.7117 |
1. PBF | B6IZJ0 | Chaperone protein DnaK | 0.00e+00 | 2.23e-46 | 0.0 | 0.9414 |
1. PBF | B4SDA0 | Chaperone protein DnaK | 0.00e+00 | 7.08e-49 | 0.0 | 0.9574 |
1. PBF | Q71ZJ7 | Chaperone protein DnaK | 0.00e+00 | 1.19e-55 | 0.0 | 0.9263 |
1. PBF | A0RZ01 | Chaperone protein DnaK | 0.00e+00 | 3.62e-29 | 0.0 | 0.9099 |
1. PBF | A8GHX9 | Chaperone protein HscA | 0.00e+00 | 1.91e-33 | 5.49e-127 | 0.7543 |
1. PBF | C1KVC0 | Chaperone protein DnaK | 0.00e+00 | 1.19e-55 | 0.0 | 0.9496 |
1. PBF | Q6G1F9 | Chaperone protein DnaK | 0.00e+00 | 4.27e-56 | 0.0 | 0.9396 |
1. PBF | B2UBP3 | Chaperone protein DnaK | 0.00e+00 | 1.91e-50 | 0.0 | 0.9155 |
1. PBF | Q1BEV1 | Chaperone protein DnaK | 0.00e+00 | 3.60e-53 | 0.0 | 0.9479 |
1. PBF | Q7VVY2 | Chaperone protein DnaK | 0.00e+00 | 8.25e-59 | 0.0 | 0.9219 |
1. PBF | Q1LPL1 | Chaperone protein HscA homolog | 0.00e+00 | 2.44e-36 | 4.76e-130 | 0.7655 |
1. PBF | B3GXS0 | Chaperone protein HscA homolog | 0.00e+00 | 3.56e-36 | 1.30e-128 | 0.7563 |
1. PBF | Q9UXR0 | Chaperone protein DnaK | 0.00e+00 | 1.42e-55 | 0.0 | 0.9238 |
1. PBF | Q7VC04 | Chaperone protein dnaK1 | 0.00e+00 | 2.31e-38 | 0.0 | 0.9316 |
1. PBF | P16394 | Heat shock 70 kDa protein | 0.00e+00 | 5.04e-25 | 1.14e-152 | 0.8866 |
1. PBF | Q824B2 | Chaperone protein DnaK | 0.00e+00 | 5.70e-44 | 0.0 | 0.9254 |
1. PBF | B0RVU2 | Chaperone protein DnaK | 0.00e+00 | 2.26e-54 | 0.0 | 0.9316 |
1. PBF | Q87WP0 | Chaperone protein DnaK | 0.00e+00 | 2.66e-53 | 0.0 | 0.9184 |
1. PBF | P29357 | Chloroplast envelope membrane 70 kDa heat shock-related protein | 0.00e+00 | 4.93e-32 | 6.18e-159 | 0.9273 |
1. PBF | Q4JXX6 | Chaperone protein DnaK | 0.00e+00 | 1.96e-51 | 0.0 | 0.9412 |
1. PBF | Q9GSU7 | Major heat shock 70 kDa protein Ab | 0.00e+00 | 9.59e-34 | 2.43e-169 | 0.9128 |
1. PBF | P57870 | Chaperone protein DnaK | 0.00e+00 | 1.99e-57 | 0.0 | 0.9304 |
1. PBF | B2SGV8 | Chaperone protein DnaK | 0.00e+00 | 6.22e-55 | 0.0 | 0.9429 |
1. PBF | Q42434 | Luminal-binding protein | 0.00e+00 | 1.52e-25 | 8.78e-176 | 0.9079 |
1. PBF | Q92BN8 | Chaperone protein DnaK | 0.00e+00 | 7.50e-56 | 0.0 | 0.9139 |
1. PBF | A3QGW2 | Chaperone protein DnaK | 0.00e+00 | 8.67e-57 | 0.0 | 0.9381 |
1. PBF | Q9HG01 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.19e-21 | 5.28e-176 | 0.9106 |
1. PBF | A1WKG6 | Chaperone protein HscA homolog | 0.00e+00 | 1.55e-32 | 2.79e-113 | 0.7589 |
1. PBF | B2TXV1 | Chaperone protein HscA | 0.00e+00 | 1.65e-31 | 1.08e-119 | 0.759 |
1. PBF | B9MDJ7 | Chaperone protein DnaK | 0.00e+00 | 2.86e-47 | 0.0 | 0.9303 |
1. PBF | A0KMI6 | Chaperone protein DnaK | 0.00e+00 | 7.79e-54 | 0.0 | 0.94 |
1. PBF | B8I305 | Chaperone protein DnaK | 0.00e+00 | 1.02e-46 | 0.0 | 0.9552 |
1. PBF | A0KJ36 | Chaperone protein HscA homolog | 0.00e+00 | 4.07e-35 | 4.19e-125 | 0.7475 |
1. PBF | A5W9A3 | Chaperone protein DnaK | 0.00e+00 | 2.54e-47 | 0.0 | 0.9455 |
1. PBF | C6DF10 | Chaperone protein DnaK | 0.00e+00 | 6.21e-54 | 0.0 | 0.9285 |
1. PBF | O27351 | Chaperone protein DnaK | 0.00e+00 | 3.28e-63 | 0.0 | 0.9434 |
1. PBF | Q5R511 | Stress-70 protein, mitochondrial | 0.00e+00 | 3.26e-15 | 0.0 | 0.9342 |
1. PBF | B8H6Q1 | Chaperone protein DnaK | 0.00e+00 | 2.55e-55 | 0.0 | 0.9248 |
1. PBF | A8G9K8 | Chaperone protein DnaK | 0.00e+00 | 2.07e-53 | 0.0 | 0.9407 |
1. PBF | Q4R888 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 3.81e-32 | 1.86e-171 | 0.9105 |
1. PBF | Q5HV33 | Chaperone protein DnaK | 0.00e+00 | 5.69e-52 | 0.0 | 0.9302 |
1. PBF | A0T0H7 | Chaperone protein dnaK | 0.00e+00 | 3.76e-58 | 0.0 | 0.7436 |
1. PBF | B1MZG6 | Chaperone protein DnaK | 0.00e+00 | 4.07e-67 | 0.0 | 0.9107 |
1. PBF | Q6D0B7 | Chaperone protein DnaK | 0.00e+00 | 1.05e-53 | 0.0 | 0.9329 |
1. PBF | P9WMJ8 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | 0.9174 |
1. PBF | Q1J578 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.9051 |
1. PBF | Q99170 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 1.79e-21 | 0.0 | 0.9189 |
1. PBF | P25840 | Heat shock 70 kDa protein | 0.00e+00 | 3.10e-31 | 2.96e-164 | 0.8714 |
1. PBF | Q47TI0 | Chaperone protein DnaK | 0.00e+00 | 1.35e-55 | 0.0 | 0.9471 |
1. PBF | A1A766 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | 0.9264 |
1. PBF | Q7WK59 | Chaperone protein HscA homolog | 0.00e+00 | 3.61e-34 | 2.56e-116 | 0.7561 |
1. PBF | Q1H365 | Chaperone protein HscA homolog | 0.00e+00 | 1.32e-38 | 1.14e-133 | 0.7648 |
1. PBF | P20583 | Heat shock 70 kDa protein, mitochondrial | 0.00e+00 | 2.55e-28 | 0.0 | 0.9315 |
1. PBF | Q3YZ26 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7594 |
1. PBF | P0A6Y9 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | 0.928 |
1. PBF | B0UWR4 | Chaperone protein DnaK | 0.00e+00 | 3.16e-57 | 0.0 | 0.9264 |
1. PBF | Q7U6R7 | Chaperone protein dnaK1 | 0.00e+00 | 1.56e-43 | 0.0 | 0.9362 |
1. PBF | Q4QNG9 | Chaperone protein HscA homolog | 0.00e+00 | 8.22e-35 | 1.83e-125 | 0.7433 |
1. PBF | Q6G554 | Chaperone protein DnaK | 0.00e+00 | 5.62e-55 | 0.0 | 0.9376 |
1. PBF | G2K046 | Chaperone protein DnaK | 0.00e+00 | 1.05e-55 | 0.0 | 0.9542 |
1. PBF | B0T138 | Chaperone protein DnaK | 0.00e+00 | 2.60e-53 | 0.0 | 0.9258 |
1. PBF | Q06068 | 97 kDa heat shock protein | 0.00e+00 | 1.45e-03 | 4.82e-57 | 0.8266 |
1. PBF | C0PYL1 | Chaperone protein HscA | 0.00e+00 | 2.01e-32 | 3.03e-126 | 0.7517 |
1. PBF | P0CY99 | Chaperone protein DnaK | 0.00e+00 | 3.00e-57 | 0.0 | 0.9353 |
1. PBF | Q4ZNP7 | Chaperone protein DnaK | 0.00e+00 | 2.13e-53 | 0.0 | 0.9422 |
1. PBF | Q4AAR4 | Chaperone protein DnaK | 0.00e+00 | 2.98e-69 | 0.0 | 0.947 |
1. PBF | Q5FFM4 | Chaperone protein DnaK | 0.00e+00 | 2.51e-43 | 0.0 | 0.9445 |
1. PBF | Q8EEU5 | Chaperone protein HscA homolog | 0.00e+00 | 1.49e-37 | 5.68e-122 | 0.7508 |
1. PBF | Q9U639 | Heat shock 70 kDa protein cognate 4 | 0.00e+00 | 4.94e-33 | 1.28e-179 | 0.911 |
1. PBF | A6WFV7 | Chaperone protein DnaK | 0.00e+00 | 4.79e-57 | 0.0 | 0.9529 |
1. PBF | Q1QRU1 | Chaperone protein DnaK | 0.00e+00 | 2.01e-52 | 0.0 | 0.9261 |
1. PBF | Q3B577 | Chaperone protein DnaK | 0.00e+00 | 2.76e-49 | 0.0 | 0.9518 |
1. PBF | Q5YNI0 | Chaperone protein DnaK | 0.00e+00 | 2.17e-60 | 0.0 | 0.9437 |
1. PBF | Q1AXX6 | Chaperone protein DnaK | 0.00e+00 | 6.26e-48 | 0.0 | 0.9076 |
1. PBF | Q54215 | Chaperone protein DnaK | 0.00e+00 | 3.53e-48 | 0.0 | 0.9279 |
1. PBF | P95334 | Chaperone protein DnaK | 0.00e+00 | 1.07e-46 | 0.0 | 0.918 |
1. PBF | C1C5N7 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.8797 |
1. PBF | Q9ZIV1 | Chaperone protein DnaK (Fragment) | 0.00e+00 | 7.66e-04 | 0.0 | 0.9855 |
1. PBF | B7GT47 | Chaperone protein DnaK | 0.00e+00 | 5.19e-50 | 0.0 | 0.9514 |
1. PBF | B7I5P9 | Chaperone protein HscA homolog | 0.00e+00 | 9.50e-35 | 1.10e-124 | 0.753 |
1. PBF | B1VMF3 | Chaperone protein DnaK | 0.00e+00 | 3.05e-51 | 0.0 | 0.9478 |
1. PBF | A0AIS4 | Chaperone protein DnaK | 0.00e+00 | 6.77e-56 | 0.0 | 0.9513 |
1. PBF | B8DYH6 | Chaperone protein DnaK | 0.00e+00 | 6.07e-55 | 0.0 | 0.9502 |
1. PBF | B4S6P7 | Chaperone protein DnaK | 0.00e+00 | 4.71e-50 | 0.0 | 0.9591 |
1. PBF | A8GMF9 | Chaperone protein DnaK | 0.00e+00 | 3.18e-53 | 0.0 | 0.9246 |
1. PBF | A0RIT3 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9325 |
1. PBF | Q2RKX4 | Chaperone protein DnaK | 0.00e+00 | 3.05e-51 | 0.0 | 0.9479 |
1. PBF | Q086J3 | Chaperone protein DnaK | 0.00e+00 | 3.75e-54 | 0.0 | 0.9454 |
1. PBF | O67118 | Chaperone protein DnaK | 0.00e+00 | 2.49e-55 | 0.0 | 0.9268 |
1. PBF | A7X2Y1 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9207 |
1. PBF | Q4ZX30 | Chaperone protein HscA homolog | 0.00e+00 | 3.75e-35 | 1.47e-133 | 0.7552 |
1. PBF | Q4UKL3 | Chaperone protein HscA homolog | 0.00e+00 | 1.20e-31 | 3.34e-92 | 0.5418 |
1. PBF | A3NX33 | Chaperone protein HscA homolog | 0.00e+00 | 7.12e-35 | 7.13e-120 | 0.7618 |
1. PBF | Q5RDM4 | Heat shock 70 kDa protein 4 | 0.00e+00 | 3.79e-04 | 2.83e-54 | 0.8196 |
1. PBF | Q473J2 | Chaperone protein HscA homolog | 0.00e+00 | 1.93e-36 | 2.87e-132 | 0.7582 |
1. PBF | Q5R606 | Heat shock protein 105 kDa | 0.00e+00 | 6.70e-03 | 1.83e-51 | 0.8098 |
1. PBF | B2TLZ7 | Chaperone protein DnaK | 0.00e+00 | 1.08e-53 | 0.0 | 0.9504 |
1. PBF | B2SXC6 | Chaperone protein DnaK | 0.00e+00 | 1.06e-47 | 0.0 | 0.901 |
1. PBF | Q0TEV9 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7591 |
1. PBF | B8D8G2 | Chaperone protein HscA | 0.00e+00 | 2.03e-34 | 4.95e-103 | 0.7467 |
1. PBF | Q9ZDW5 | Chaperone protein HscA homolog | 0.00e+00 | 5.36e-31 | 1.73e-98 | 0.7074 |
1. PBF | O32464 | Chaperone protein DnaK | 0.00e+00 | 1.21e-56 | 0.0 | 0.9247 |
1. PBF | C4LGV8 | Chaperone protein DnaK | 0.00e+00 | 2.56e-50 | 0.0 | 0.9455 |
1. PBF | Q0HJF0 | Chaperone protein HscA homolog | 0.00e+00 | 2.46e-38 | 1.58e-125 | 0.7564 |
1. PBF | C0ME86 | Chaperone protein DnaK | 0.00e+00 | 1.80e-60 | 0.0 | 0.8888 |
1. PBF | A0QQC8 | Chaperone protein DnaK | 0.00e+00 | 8.00e-53 | 0.0 | 0.9465 |
1. PBF | A8Z4B9 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9342 |
1. PBF | Q6G8Y7 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9215 |
1. PBF | Q3ZCH0 | Stress-70 protein, mitochondrial | 0.00e+00 | 5.27e-13 | 0.0 | 0.9363 |
1. PBF | P24629 | Heat shock cognate 70 kDa protein 1 | 0.00e+00 | 2.43e-29 | 8.60e-158 | 0.9227 |
1. PBF | B1ZGR1 | Chaperone protein DnaK | 0.00e+00 | 1.20e-48 | 0.0 | 0.9474 |
1. PBF | Q91883 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.17e-25 | 1.83e-175 | 0.9075 |
1. PBF | C5D4U1 | Chaperone protein DnaK | 0.00e+00 | 2.83e-55 | 0.0 | 0.9332 |
1. PBF | Q2J320 | Chaperone protein DnaK | 0.00e+00 | 7.19e-51 | 0.0 | 0.9255 |
1. PBF | Q2KDW6 | Chaperone protein DnaK | 0.00e+00 | 2.27e-50 | 0.0 | 0.9361 |
1. PBF | B8CKF3 | Chaperone protein DnaK | 0.00e+00 | 2.64e-54 | 0.0 | 0.9448 |
1. PBF | B4EZU4 | Chaperone protein HscA | 0.00e+00 | 2.54e-36 | 5.61e-127 | 0.754 |
1. PBF | Q96W30 | Heat shock 70 kDa protein 2 | 0.00e+00 | 2.28e-35 | 7.95e-165 | 0.8984 |
1. PBF | Q7MNF8 | Chaperone protein HscA homolog | 0.00e+00 | 4.87e-36 | 1.17e-121 | 0.7515 |
1. PBF | C1CCQ8 | Chaperone protein DnaK | 0.00e+00 | 1.39e-61 | 0.0 | 0.8805 |
1. PBF | A6QHC3 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9217 |
1. PBF | Q038N3 | Chaperone protein DnaK | 0.00e+00 | 1.96e-45 | 0.0 | 0.9533 |
1. PBF | Q1RGI8 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | 0.9256 |
1. PBF | B2HZI1 | Chaperone protein HscA homolog | 0.00e+00 | 1.56e-34 | 1.15e-121 | 0.6942 |
1. PBF | O74225 | Heat shock protein hsp88 | 0.00e+00 | 4.79e-11 | 2.00e-42 | 0.7916 |
1. PBF | Q9ZEJ6 | Chaperone protein dnaK1 | 0.00e+00 | 7.53e-30 | 0.0 | 0.9408 |
1. PBF | A8GR49 | Chaperone protein HscA homolog | 0.00e+00 | 1.50e-29 | 1.07e-96 | 0.6546 |
1. PBF | A7I2D4 | Chaperone protein DnaK | 0.00e+00 | 2.32e-57 | 0.0 | 0.9333 |
1. PBF | A1S548 | Chaperone protein HscA homolog | 0.00e+00 | 1.30e-36 | 3.17e-123 | 0.7603 |
1. PBF | B2KAX0 | Chaperone protein DnaK | 0.00e+00 | 2.90e-55 | 0.0 | 0.9133 |
1. PBF | Q3AF08 | Chaperone protein DnaK | 0.00e+00 | 2.68e-58 | 0.0 | 0.9379 |
1. PBF | Q7UZG3 | Chaperone protein dnaK2 | 0.00e+00 | 1.11e-51 | 0.0 | 0.9509 |
1. PBF | Q6MB26 | Chaperone protein DnaK | 0.00e+00 | 4.30e-51 | 0.0 | 0.9632 |
1. PBF | O33522 | Chaperone protein DnaK | 0.00e+00 | 1.20e-51 | 0.0 | 0.932 |
1. PBF | Q2TFN9 | Heat shock 70 kDa protein 4 | 0.00e+00 | 6.40e-04 | 1.01e-55 | 0.8216 |
1. PBF | B8IHL3 | Chaperone protein DnaK | 0.00e+00 | 1.08e-49 | 0.0 | 0.9245 |
1. PBF | C1FVU0 | Chaperone protein DnaK | 0.00e+00 | 2.45e-49 | 0.0 | 0.9526 |
1. PBF | Q68XI2 | Chaperone protein DnaK | 0.00e+00 | 8.33e-51 | 0.0 | 0.9573 |
1. PBF | Q5HAY1 | Chaperone protein DnaK | 0.00e+00 | 4.05e-43 | 0.0 | 0.9492 |
1. PBF | B0KIS5 | Chaperone protein DnaK | 0.00e+00 | 2.06e-51 | 0.0 | 0.9539 |
1. PBF | Q47XI6 | Chaperone protein DnaK 2 | 0.00e+00 | 6.55e-53 | 0.0 | 0.9533 |
1. PBF | Q88PK4 | Chaperone protein HscA homolog | 0.00e+00 | 1.95e-33 | 2.02e-128 | 0.7539 |
1. PBF | P50020 | Chaperone protein dnaK1 | 0.00e+00 | 8.29e-47 | 0.0 | 0.9051 |
1. PBF | P20442 | Chaperone protein DnaK | 0.00e+00 | 1.10e-55 | 0.0 | 0.929 |
1. PBF | B8FUN4 | Chaperone protein DnaK | 0.00e+00 | 1.60e-48 | 0.0 | 0.9453 |
1. PBF | A6TCE7 | Chaperone protein HscA | 0.00e+00 | 1.20e-32 | 2.44e-120 | 0.751 |
1. PBF | C3PMM7 | Chaperone protein DnaK | 0.00e+00 | 6.11e-56 | 0.0 | 0.9537 |
1. PBF | Q05746 | Heat shock 70 kDa protein | 0.00e+00 | 2.79e-25 | 2.16e-164 | 0.8995 |
1. PBF | Q94738 | 97 kDa heat shock protein | 0.00e+00 | 1.43e-03 | 1.67e-57 | 0.8179 |
1. PBF | A5IDK8 | Chaperone protein DnaK | 0.00e+00 | 1.20e-51 | 0.0 | 0.9251 |
1. PBF | Q8DKR6 | Chaperone protein dnaK1 | 0.00e+00 | 1.20e-42 | 0.0 | 0.9338 |
1. PBF | P0A6Z2 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7592 |
1. PBF | A1AW22 | Chaperone protein DnaK | 0.00e+00 | 5.41e-58 | 0.0 | 0.9465 |
1. PBF | A5CWM2 | Chaperone protein HscA homolog | 0.00e+00 | 8.22e-35 | 3.30e-101 | 0.7122 |
1. PBF | Q7NAU6 | Chaperone protein DnaK | 0.00e+00 | 5.32e-65 | 0.0 | 0.952 |
1. PBF | Q03684 | Luminal-binding protein 4 | 0.00e+00 | 8.41e-22 | 6.14e-176 | 0.9115 |
1. PBF | Q4UJK7 | Chaperone protein DnaK | 0.00e+00 | 8.33e-51 | 0.0 | 0.9181 |
1. PBF | P45554 | Chaperone protein DnaK | 0.00e+00 | 7.24e-59 | 0.0 | 0.9207 |
1. PBF | B3QZ38 | Chaperone protein DnaK | 0.00e+00 | 2.15e-47 | 0.0 | 0.9462 |
1. PBF | C3L3G7 | Chaperone protein DnaK | 0.00e+00 | 8.18e-49 | 0.0 | 0.9521 |
1. PBF | A5UF68 | Chaperone protein DnaK | 0.00e+00 | 3.06e-60 | 0.0 | 0.937 |
1. PBF | B2UKV6 | Chaperone protein DnaK | 0.00e+00 | 1.05e-53 | 0.0 | 0.9561 |
1. PBF | Q06248 | Heat shock 70 kDa protein IV | 0.00e+00 | 5.37e-40 | 5.54e-166 | 0.9181 |
1. PBF | Q875V0 | Heat shock protein homolog SSE1 | 0.00e+00 | 1.84e-14 | 1.93e-44 | 0.7705 |
1. PBF | Q6FCE6 | Chaperone protein HscA homolog | 0.00e+00 | 1.66e-37 | 5.92e-120 | 0.7488 |
1. PBF | Q65U55 | Chaperone protein DnaK | 0.00e+00 | 8.36e-60 | 0.0 | 0.9281 |
1. PBF | B5ZWQ2 | Chaperone protein DnaK | 0.00e+00 | 6.01e-50 | 0.0 | 0.9329 |
1. PBF | Q876N3 | Ribosome-associated molecular chaperone SSB | 0.00e+00 | 1.16e-43 | 1.55e-147 | 0.924 |
1. PBF | O35501 | Stress-70 protein, mitochondrial | 0.00e+00 | 9.39e-16 | 0.0 | 0.9415 |
1. PBF | C0M7T9 | Chaperone protein DnaK | 0.00e+00 | 1.92e-61 | 0.0 | 0.9115 |
1. PBF | A4Y9Q3 | Chaperone protein DnaK | 0.00e+00 | 1.14e-53 | 0.0 | 0.9468 |
1. PBF | P69377 | Chaperone protein dnaK | 0.00e+00 | 5.29e-62 | 0.0 | 0.7225 |
1. PBF | B9E6X1 | Chaperone protein DnaK | 0.00e+00 | 3.86e-63 | 0.0 | 0.9525 |
1. PBF | Q6YPM1 | Chaperone protein DnaK | 0.00e+00 | 1.28e-49 | 0.0 | 0.9196 |
1. PBF | A8ZRW3 | Chaperone protein DnaK | 0.00e+00 | 1.43e-50 | 0.0 | 0.9515 |
1. PBF | Q9FSY7 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.71e-22 | 1.21e-169 | 0.9048 |
1. PBF | A4G782 | Chaperone protein HscA homolog | 0.00e+00 | 8.32e-34 | 2.11e-116 | 0.7697 |
1. PBF | A7H484 | Chaperone protein DnaK | 0.00e+00 | 7.19e-51 | 0.0 | 0.9115 |
1. PBF | B0U3J8 | Chaperone protein DnaK | 0.00e+00 | 5.77e-55 | 0.0 | 0.9378 |
1. PBF | Q2G6N0 | Chaperone protein DnaK | 0.00e+00 | 1.28e-57 | 0.0 | 0.9318 |
1. PBF | Q8NLY6 | Chaperone protein DnaK | 0.00e+00 | 2.57e-51 | 0.0 | 0.9213 |
1. PBF | Q8FM78 | Chaperone protein DnaK | 0.00e+00 | 4.51e-53 | 0.0 | 0.9439 |
1. PBF | Q2GF34 | Chaperone protein DnaK | 0.00e+00 | 1.51e-47 | 0.0 | 0.9373 |
1. PBF | Q91233 | Heat shock 70 kDa protein | 0.00e+00 | 2.19e-35 | 7.81e-177 | 0.8907 |
1. PBF | B7MY19 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7581 |
1. PBF | A9W6R7 | Chaperone protein DnaK | 0.00e+00 | 4.81e-49 | 0.0 | 0.9238 |
1. PBF | P17804 | Heat shock 70 kDa protein | 0.00e+00 | 3.25e-34 | 1.80e-163 | 0.9205 |
1. PBF | A1T2S3 | Chaperone protein DnaK | 0.00e+00 | 2.02e-53 | 0.0 | 0.9468 |
1. PBF | A7IC65 | Chaperone protein DnaK | 0.00e+00 | 6.39e-53 | 0.0 | 0.9487 |
1. PBF | A4SP09 | Chaperone protein HscA homolog | 0.00e+00 | 1.66e-33 | 5.90e-120 | 0.7498 |
1. PBF | P27322 | Heat shock cognate 70 kDa protein 2 | 0.00e+00 | 2.71e-34 | 3.66e-161 | 0.917 |
1. PBF | A7MWW0 | Chaperone protein DnaK | 0.00e+00 | 2.20e-57 | 0.0 | 0.9457 |
1. PBF | Q03QU1 | Chaperone protein DnaK | 0.00e+00 | 2.00e-54 | 0.0 | 0.9398 |
1. PBF | Q6LU58 | Chaperone protein HscA homolog | 0.00e+00 | 1.15e-35 | 1.50e-131 | 0.7498 |
1. PBF | Q2SSB0 | Chaperone protein DnaK | 0.00e+00 | 6.37e-106 | 0.0 | 0.9781 |
1. PBF | B0B7W6 | Chaperone protein DnaK | 0.00e+00 | 1.32e-45 | 0.0 | 0.92 |
1. PBF | B0BC31 | Chaperone protein DnaK | 0.00e+00 | 1.32e-45 | 0.0 | 0.892 |
1. PBF | B1KNI7 | Chaperone protein HscA homolog | 0.00e+00 | 1.44e-38 | 6.58e-109 | 0.7633 |
1. PBF | Q0W874 | Chaperone protein DnaK | 0.00e+00 | 1.74e-41 | 0.0 | 0.9311 |
1. PBF | P34933 | Heat shock-related 70 kDa protein 2 | 0.00e+00 | 4.05e-37 | 9.69e-169 | 0.9121 |
1. PBF | Q5M1T8 | Chaperone protein DnaK | 0.00e+00 | 9.43e-63 | 0.0 | 0.8962 |
1. PBF | C3LTA5 | Chaperone protein DnaK | 0.00e+00 | 6.42e-60 | 0.0 | 0.9381 |
1. PBF | Q9KD72 | Chaperone protein DnaK | 0.00e+00 | 2.70e-54 | 0.0 | 0.9444 |
1. PBF | A0PLQ1 | Chaperone protein DnaK | 0.00e+00 | 3.30e-55 | 0.0 | 0.936 |
1. PBF | P19208 | Heat shock 70 kDa protein C | 0.00e+00 | 2.03e-23 | 2.24e-175 | 0.9171 |
1. PBF | B0V5U4 | Chaperone protein DnaK | 0.00e+00 | 2.21e-54 | 0.0 | 0.9445 |
1. PBF | B1I699 | Chaperone protein DnaK | 0.00e+00 | 3.86e-58 | 0.0 | 0.9477 |
1. PBF | A3CQC2 | Chaperone protein DnaK | 0.00e+00 | 3.18e-61 | 0.0 | 0.8849 |
1. PBF | C1CZH9 | Chaperone protein DnaK | 0.00e+00 | 3.31e-60 | 0.0 | 0.9288 |
1. PBF | P91902 | Heat shock protein 70 | 0.00e+00 | 2.65e-34 | 1.38e-162 | 0.8963 |
1. PBF | A9MHJ8 | Chaperone protein HscA | 0.00e+00 | 1.13e-31 | 1.31e-125 | 0.7485 |
1. PBF | Q83QK4 | Chaperone protein HscA homolog | 0.00e+00 | 1.82e-31 | 5.53e-119 | 0.7582 |
1. PBF | B1XTR3 | Chaperone protein HscA homolog | 0.00e+00 | 2.43e-37 | 8.77e-120 | 0.7583 |
1. PBF | Q3APD2 | Chaperone protein DnaK | 0.00e+00 | 2.38e-51 | 0.0 | 0.943 |
1. PBF | A5N6M2 | Chaperone protein DnaK | 0.00e+00 | 2.76e-50 | 0.0 | 0.9644 |
1. PBF | O52960 | Chaperone protein DnaK | 0.00e+00 | 1.02e-18 | 0.0 | 0.9215 |
1. PBF | A5ITA8 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9242 |
1. PBF | B0SHT1 | Chaperone protein DnaK | 0.00e+00 | 9.89e-51 | 0.0 | 0.9635 |
1. PBF | A4XYF6 | Chaperone protein DnaK | 0.00e+00 | 1.38e-52 | 0.0 | 0.9409 |
1. PBF | A1AWL7 | Chaperone protein HscA homolog | 0.00e+00 | 6.42e-35 | 3.65e-105 | 0.7399 |
1. PBF | A4IR31 | Chaperone protein DnaK | 0.00e+00 | 7.89e-61 | 0.0 | 0.9418 |
1. PBF | A5A8V7 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 1.63e-30 | 2.96e-171 | 0.9122 |
1. PBF | Q7NDH1 | Chaperone protein DnaK | 0.00e+00 | 7.79e-54 | 0.0 | 0.9639 |
1. PBF | A8EWT6 | Chaperone protein DnaK | 0.00e+00 | 2.20e-57 | 0.0 | 0.8982 |
1. PBF | P48205 | Chaperone protein DnaK | 0.00e+00 | 6.89e-55 | 0.0 | 0.9418 |
1. PBF | B3DNP9 | Chaperone protein DnaK | 0.00e+00 | 3.65e-52 | 0.0 | 0.9418 |
1. PBF | Q01100 | Chaperone protein DnaK | 0.00e+00 | 4.05e-37 | 0.0 | 0.9468 |
1. PBF | B7HCU0 | Chaperone protein DnaK | 0.00e+00 | 2.20e-57 | 0.0 | 0.9312 |
1. PBF | A1WAR6 | Chaperone protein DnaK | 0.00e+00 | 7.75e-48 | 0.0 | 0.9325 |
1. PBF | B1KRT2 | Chaperone protein DnaK | 0.00e+00 | 3.85e-56 | 0.0 | 0.9443 |
1. PBF | C1CJ06 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.8805 |
1. PBF | O05700 | Chaperone protein DnaK | 0.00e+00 | 7.24e-53 | 0.0 | 0.952 |
1. PBF | A4Y7D3 | Chaperone protein HscA homolog | 0.00e+00 | 3.88e-37 | 4.09e-126 | 0.7565 |
1. PBF | Q3A8C2 | Chaperone protein DnaK | 0.00e+00 | 2.67e-47 | 0.0 | 0.9438 |
1. PBF | A1TLH9 | Chaperone protein DnaK | 0.00e+00 | 1.46e-46 | 0.0 | 0.9298 |
1. PBF | A3M561 | Chaperone protein HscA homolog | 0.00e+00 | 1.99e-34 | 1.98e-121 | 0.6979 |
1. PBF | P26823 | Chaperone protein DnaK | 0.00e+00 | 3.19e-50 | 0.0 | 0.9532 |
1. PBF | Q85FW4 | Chaperone protein dnaK | 0.00e+00 | 7.22e-54 | 0.0 | 0.9167 |
1. PBF | Q9JUF4 | Chaperone protein HscA homolog | 0.00e+00 | 1.97e-35 | 3.10e-129 | 0.7563 |
1. PBF | B1LZ51 | Chaperone protein DnaK | 0.00e+00 | 6.06e-51 | 0.0 | 0.9443 |
1. PBF | Q04Y47 | Chaperone protein DnaK | 0.00e+00 | 1.28e-52 | 0.0 | 0.951 |
1. PBF | Q16D45 | Chaperone protein DnaK | 0.00e+00 | 2.39e-52 | 0.0 | 0.9414 |
1. PBF | Q28VY3 | Chaperone protein DnaK | 0.00e+00 | 5.78e-53 | 0.0 | 0.9209 |
1. PBF | A1U614 | Chaperone protein DnaK | 0.00e+00 | 3.33e-57 | 0.0 | 0.935 |
1. PBF | Q56235 | Chaperone protein DnaK | 0.00e+00 | 5.59e-57 | 0.0 | 0.937 |
1. PBF | P08108 | Heat shock cognate 70 kDa protein | 0.00e+00 | 1.10e-34 | 1.21e-174 | 0.914 |
1. PBF | Q8GLE4 | Chaperone protein HscA | 0.00e+00 | 3.88e-33 | 1.13e-134 | 0.7552 |
1. PBF | Q7YQC6 | Heat shock 70 kDa protein 1 | 0.00e+00 | 9.12e-36 | 4.99e-175 | 0.9169 |
1. PBF | A5EYG3 | Chaperone protein DnaK | 0.00e+00 | 5.21e-55 | 0.0 | 0.9403 |
1. PBF | B7N6B3 | Chaperone protein HscA | 0.00e+00 | 9.87e-32 | 1.29e-119 | 0.7587 |
1. PBF | Q2YT47 | Chaperone protein DnaK | 0.00e+00 | 1.12e-59 | 0.0 | 0.9222 |
1. PBF | B0R3H4 | Chaperone protein DnaK | 0.00e+00 | 2.72e-40 | 0.0 | 0.9469 |
1. PBF | Q1IEI8 | Chaperone protein HscA homolog | 0.00e+00 | 1.13e-33 | 3.37e-126 | 0.7506 |
1. PBF | A4G8D2 | Chaperone protein DnaK | 0.00e+00 | 5.50e-53 | 0.0 | 0.9394 |
1. PBF | Q0BI18 | Chaperone protein DnaK | 0.00e+00 | 5.32e-50 | 0.0 | 0.9241 |
1. PBF | A2S565 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | 0.9228 |
1. PBF | P16019 | Heat shock 70 kDa protein | 0.00e+00 | 8.39e-36 | 3.44e-159 | 0.92 |
1. PBF | P48720 | Heat shock 70 kDa protein | 0.00e+00 | 6.67e-36 | 2.42e-163 | 0.9019 |
1. PBF | Q32D38 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7547 |
1. PBF | Q05558 | Chaperone protein DnaK | 0.00e+00 | 4.07e-50 | 0.0 | 0.9269 |
1. PBF | Q8ZIM7 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | 0.9403 |
1. PBF | B9DNK0 | Chaperone protein DnaK | 0.00e+00 | 2.42e-62 | 0.0 | 0.9264 |
1. PBF | A0Q1R4 | Chaperone protein DnaK | 0.00e+00 | 8.05e-52 | 0.0 | 0.9422 |
1. PBF | B9M357 | Chaperone protein DnaK | 0.00e+00 | 1.14e-51 | 0.0 | 0.9605 |
1. PBF | P07823 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 3.70e-26 | 7.22e-177 | 0.9166 |
1. PBF | A1JKQ7 | Chaperone protein HscA | 0.00e+00 | 7.07e-34 | 1.29e-122 | 0.7519 |
1. PBF | Q0RBC4 | Chaperone protein DnaK | 0.00e+00 | 4.27e-62 | 0.0 | 0.9482 |
1. PBF | B7VJT0 | Chaperone protein HscA homolog | 0.00e+00 | 3.75e-35 | 3.72e-126 | 0.755 |
1. PBF | Q8SWH2 | Heat shock protein ECU02_0100 | 0.00e+00 | 6.03e-21 | 6.88e-59 | 0.5926 |
1. PBF | Q8Z4N2 | Chaperone protein HscA | 0.00e+00 | 2.71e-32 | 5.97e-126 | 0.7553 |
1. PBF | A8AD56 | Chaperone protein HscA | 0.00e+00 | 1.60e-30 | 1.84e-120 | 0.7517 |
1. PBF | A1WGJ9 | Chaperone protein DnaK | 0.00e+00 | 1.68e-48 | 0.0 | 0.9144 |
1. PBF | A8AVA8 | Chaperone protein DnaK | 0.00e+00 | 2.10e-59 | 0.0 | 0.8815 |
1. PBF | Q02028 | Stromal 70 kDa heat shock-related protein, chloroplastic | 0.00e+00 | 1.10e-12 | 0.0 | 0.9441 |
1. PBF | A6WNY1 | Chaperone protein HscA homolog | 0.00e+00 | 2.58e-35 | 4.65e-123 | 0.7577 |
1. PBF | Q24789 | Heat shock cognate 70 kDa protein | 0.00e+00 | 1.69e-29 | 1.85e-164 | 0.9081 |
1. PBF | Q87RX3 | Chaperone protein DnaK | 0.00e+00 | 1.45e-56 | 0.0 | 0.9397 |
1. PBF | Q04967 | Heat shock 70 kDa protein 6 | 0.00e+00 | 8.15e-37 | 7.19e-179 | 0.9292 |
1. PBF | A6VMP1 | Chaperone protein HscA homolog | 0.00e+00 | 8.93e-38 | 2.03e-119 | 0.7443 |
1. PBF | Q9PQF2 | Chaperone protein DnaK | 0.00e+00 | 3.54e-70 | 0.0 | 0.9786 |
1. PBF | B1HUD1 | Chaperone protein DnaK | 0.00e+00 | 2.16e-59 | 0.0 | 0.9306 |
1. PBF | Q64X01 | Chaperone protein DnaK | 0.00e+00 | 6.89e-53 | 0.0 | 0.9575 |
1. PBF | Q2P459 | Chaperone protein DnaK | 0.00e+00 | 3.14e-56 | 0.0 | 0.9328 |
1. PBF | Q6D263 | Chaperone protein HscA | 0.00e+00 | 6.26e-34 | 2.94e-126 | 0.7574 |
1. PBF | B9MJZ1 | Chaperone protein DnaK | 0.00e+00 | 3.06e-52 | 0.0 | 0.9568 |
1. PBF | A5CX56 | Chaperone protein DnaK | 0.00e+00 | 4.40e-58 | 0.0 | 0.9511 |
1. PBF | Q2SMM8 | Chaperone protein DnaK | 0.00e+00 | 1.03e-52 | 0.0 | 0.9607 |
1. PBF | Q1WUE8 | Chaperone protein DnaK | 0.00e+00 | 2.77e-54 | 0.0 | 0.9407 |
1. PBF | P0C922 | Chaperone protein DnaK | 0.00e+00 | 1.98e-55 | 0.0 | 0.9474 |
1. PBF | B8EIP9 | Chaperone protein DnaK | 0.00e+00 | 1.87e-47 | 0.0 | 0.9459 |
1. PBF | Q7NZ33 | Chaperone protein HscA homolog | 0.00e+00 | 1.97e-37 | 1.71e-120 | 0.7575 |
1. PBF | Q3JQN9 | Chaperone protein HscA homolog | 0.00e+00 | 2.21e-34 | 1.37e-119 | 0.755 |
1. PBF | C1CQ18 | Chaperone protein DnaK | 0.00e+00 | 2.44e-61 | 0.0 | 0.8762 |
1. PBF | B1KZN7 | Chaperone protein DnaK | 0.00e+00 | 2.63e-49 | 0.0 | 0.952 |
1. PBF | B7KSZ4 | Chaperone protein DnaK | 0.00e+00 | 9.00e-49 | 0.0 | 0.9471 |
1. PBF | A6WRU9 | Chaperone protein DnaK | 0.00e+00 | 2.41e-53 | 0.0 | 0.9449 |
1. PBF | Q9KWS7 | Chaperone protein DnaK | 0.00e+00 | 8.84e-53 | 0.0 | 0.9232 |
1. PBF | A4VPQ5 | Chaperone protein DnaK | 0.00e+00 | 7.42e-57 | 0.0 | 0.9504 |
1. PBF | B5XNK1 | Chaperone protein HscA | 0.00e+00 | 4.12e-33 | 7.05e-120 | 0.7569 |
1. PBF | Q486F9 | Chaperone protein DnaK 1 | 0.00e+00 | 4.71e-54 | 0.0 | 0.9342 |
1. PBF | Q1GKS3 | Chaperone protein DnaK | 0.00e+00 | 4.40e-53 | 0.0 | 0.948 |
1. PBF | A4SFB1 | Chaperone protein DnaK | 0.00e+00 | 1.99e-48 | 0.0 | 0.9524 |
1. PBF | Q5N0G0 | Chaperone protein DnaK 3 | 0.00e+00 | 8.13e-48 | 0.0 | 0.9306 |
1. PBF | P34930 | Heat shock 70 kDa protein 1A | 0.00e+00 | 1.06e-37 | 2.05e-172 | 0.918 |
1. PBF | Q5E780 | Chaperone protein HscA homolog | 0.00e+00 | 1.31e-37 | 1.66e-119 | 0.7572 |
1. PBF | A8Z5V5 | Chaperone protein DnaK | 0.00e+00 | 8.29e-47 | 0.0 | 0.9477 |
1. PBF | Q8XW40 | Chaperone protein DnaK | 0.00e+00 | 2.90e-50 | 0.0 | 0.9263 |
1. PBF | O34241 | Chaperone protein DnaK | 0.00e+00 | 6.42e-60 | 0.0 | 0.9388 |
1. PBF | Q9K0N4 | Chaperone protein DnaK | 0.00e+00 | 2.41e-58 | 0.0 | 0.9126 |
1. PBF | Q68XG8 | Chaperone protein HscA homolog | 0.00e+00 | 1.18e-28 | 6.66e-96 | 0.6606 |
1. PBF | B2FMY5 | Chaperone protein DnaK | 0.00e+00 | 9.06e-53 | 0.0 | 0.9441 |
1. PBF | Q48M01 | Chaperone protein HscA homolog | 0.00e+00 | 3.91e-35 | 1.77e-132 | 0.7423 |
1. PBF | A9BWU9 | Chaperone protein HscA homolog | 0.00e+00 | 9.50e-35 | 1.95e-120 | 0.751 |
1. PBF | Q0I1K8 | Chaperone protein HscA homolog | 0.00e+00 | 3.11e-35 | 4.42e-127 | 0.7494 |
1. PBF | B1H009 | Chaperone protein DnaK | 0.00e+00 | 3.57e-54 | 0.0 | 0.9124 |
1. PBF | Q2S307 | Chaperone protein DnaK | 0.00e+00 | 2.88e-34 | 0.0 | 0.891 |
1. PBF | Q05647 | Chaperone protein DnaK | 0.00e+00 | 6.02e-67 | 0.0 | 0.9678 |
1. PBF | Q1QSX0 | Chaperone protein DnaK | 0.00e+00 | 1.77e-52 | 0.0 | 0.9567 |
1. PBF | Q8DH10 | Chaperone protein dnaK3 | 0.00e+00 | 1.06e-37 | 0.0 | 0.9226 |
1. PBF | P50021 | Chaperone protein dnaK2 | 0.00e+00 | 5.52e-56 | 0.0 | 0.9436 |
1. PBF | Q93R27 | Chaperone protein DnaK | 0.00e+00 | 8.24e-50 | 0.0 | 0.9463 |
1. PBF | G4NAY4 | Heat shock protein SSB1 | 0.00e+00 | 1.60e-39 | 1.42e-125 | 0.9087 |
1. PBF | A4X148 | Chaperone protein DnaK | 0.00e+00 | 1.88e-55 | 0.0 | 0.9527 |
1. PBF | B1XRU1 | Chaperone protein DnaK | 0.00e+00 | 2.90e-56 | 0.0 | 0.9456 |
1. PBF | B6I598 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7589 |
1. PBF | Q5KKP4 | Transcriptional coregulator SSA1 | 0.00e+00 | 6.46e-41 | 7.85e-171 | 0.8904 |
1. PBF | B0VNV8 | Chaperone protein HscA homolog | 0.00e+00 | 3.18e-35 | 5.26e-120 | 0.7488 |
1. PBF | C4K3I6 | Chaperone protein DnaK | 0.00e+00 | 1.05e-55 | 0.0 | 0.9508 |
1. PBF | Q4R6J2 | Heat shock 70 kDa protein 14 | 0.00e+00 | 7.80e-04 | 1.31e-55 | 0.6361 |
1. PBF | Q1G9R2 | Chaperone protein DnaK | 0.00e+00 | 5.50e-53 | 0.0 | 0.9252 |
1. PBF | B3EKT9 | Chaperone protein DnaK | 0.00e+00 | 1.29e-45 | 0.0 | 0.9519 |
1. PBF | Q47HK2 | Chaperone protein DnaK | 0.00e+00 | 5.11e-53 | 0.0 | 0.9197 |
1. PBF | B1YT24 | Chaperone protein HscA homolog | 0.00e+00 | 1.69e-34 | 1.16e-121 | 0.7641 |
1. PBF | C3PMP2 | Chaperone protein HscA homolog | 0.00e+00 | 3.98e-30 | 1.45e-96 | 0.6723 |
1. PBF | B5RM75 | Chaperone protein DnaK | 0.00e+00 | 4.36e-55 | 0.0 | 0.9565 |
1. PBF | Q2FGE3 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.92 |
1. PBF | P12076 | Heat shock 70-related protein 1, mitochondrial | 0.00e+00 | 6.04e-26 | 2.86e-179 | 0.8988 |
1. PBF | Q8ZCS5 | Chaperone protein HscA | 0.00e+00 | 5.94e-16 | 2.56e-116 | 0.7557 |
1. PBF | Q182E8 | Chaperone protein DnaK | 0.00e+00 | 7.24e-59 | 0.0 | 0.9234 |
1. PBF | Q11QH3 | Chaperone protein DnaK | 0.00e+00 | 6.95e-56 | 0.0 | 0.947 |
1. PBF | B7V1H3 | Chaperone protein DnaK | 0.00e+00 | 1.32e-55 | 0.0 | 0.9548 |
1. PBF | Q16956 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 6.98e-26 | 8.02e-175 | 0.9107 |
1. PBF | C5CXC5 | Chaperone protein HscA homolog | 0.00e+00 | 1.36e-35 | 4.51e-115 | 0.7614 |
1. PBF | Q02RW4 | Chaperone protein HscA homolog | 0.00e+00 | 1.95e-33 | 9.39e-123 | 0.706 |
1. PBF | C5C3P2 | Chaperone protein DnaK | 0.00e+00 | 1.90e-54 | 0.0 | 0.9379 |
1. PBF | A7GHH6 | Chaperone protein DnaK | 0.00e+00 | 2.45e-49 | 0.0 | 0.9519 |
1. PBF | A7FXL5 | Chaperone protein DnaK | 0.00e+00 | 2.45e-49 | 0.0 | 0.9522 |
1. PBF | B7J282 | Chaperone protein DnaK | 0.00e+00 | 1.98e-55 | 0.0 | 0.9347 |
1. PBF | Q5HFI0 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9207 |
1. PBF | Q8FXX2 | Chaperone protein DnaK | 0.00e+00 | 3.52e-50 | 0.0 | 0.9025 |
1. PBF | P0DB70 | Chaperone protein DnaK | 0.00e+00 | 3.63e-62 | 0.0 | 0.8836 |
1. PBF | O33528 | Chaperone protein DnaK | 0.00e+00 | 6.56e-48 | 0.0 | 0.9316 |
1. PBF | B7VJW9 | Chaperone protein DnaK | 0.00e+00 | 3.60e-57 | 0.0 | 0.9514 |
1. PBF | Q90593 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 1.53e-28 | 4.73e-177 | 0.9148 |
1. PBF | Q8ZN42 | Chaperone protein HscA | 0.00e+00 | 3.31e-32 | 5.84e-126 | 0.7517 |
1. PBF | Q667Y5 | Chaperone protein HscA | 0.00e+00 | 6.59e-20 | 8.56e-118 | 0.7535 |
1. PBF | Q9JS04 | Chaperone protein HscA homolog | 0.00e+00 | 1.17e-35 | 6.24e-128 | 0.7591 |
1. PBF | A0RPW7 | Chaperone protein DnaK | 0.00e+00 | 6.18e-59 | 0.0 | 0.9572 |
1. PBF | O69221 | Chaperone protein HscA homolog | 0.00e+00 | 6.51e-32 | 1.13e-118 | 0.6953 |
1. PBF | Q9HV43 | Chaperone protein DnaK | 0.00e+00 | 3.66e-54 | 0.0 | 0.9564 |
1. PBF | A1RJ56 | Chaperone protein HscA homolog | 0.00e+00 | 2.65e-37 | 5.45e-125 | 0.7562 |
1. PBF | Q5NYT1 | Chaperone protein HscA homolog | 0.00e+00 | 7.98e-37 | 1.16e-127 | 0.7513 |
1. PBF | Q3SIN4 | Chaperone protein DnaK | 0.00e+00 | 2.55e-56 | 0.0 | 0.9492 |
1. PBF | Q6NCY4 | Chaperone protein DnaK | 0.00e+00 | 2.27e-50 | 0.0 | 0.9293 |
1. PBF | Q5M6D1 | Chaperone protein DnaK | 0.00e+00 | 1.71e-62 | 0.0 | 0.8981 |
1. PBF | Q92260 | Heat shock 70 kDa protein (Fragment) | 0.00e+00 | 1.72e-07 | 3.12e-145 | 0.8719 |
1. PBF | Q6AMQ3 | Chaperone protein DnaK | 0.00e+00 | 5.21e-54 | 0.0 | 0.9571 |
1. PBF | Q03685 | Luminal-binding protein 5 | 0.00e+00 | 7.40e-23 | 4.08e-177 | 0.9092 |
1. PBF | B8ZLY9 | Chaperone protein DnaK | 0.00e+00 | 1.39e-61 | 0.0 | 0.8798 |
1. PBF | Q6LUA7 | Chaperone protein DnaK 1 | 0.00e+00 | 2.70e-54 | 0.0 | 0.9482 |
1. PBF | Q12Q08 | Chaperone protein DnaK | 0.00e+00 | 8.02e-57 | 0.0 | 0.9356 |
1. PBF | Q7V1H4 | Chaperone protein dnaK1 | 0.00e+00 | 3.95e-38 | 1.37e-179 | 0.9244 |
1. PBF | A4IX28 | Chaperone protein DnaK | 0.00e+00 | 5.96e-56 | 0.0 | 0.9256 |
1. PBF | Q8KEP3 | Chaperone protein DnaK | 0.00e+00 | 4.49e-50 | 0.0 | 0.949 |
1. PBF | G0SCU5 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 5.20e-39 | 4.55e-129 | 0.9069 |
1. PBF | Q6AC76 | Chaperone protein DnaK | 0.00e+00 | 5.21e-55 | 0.0 | 0.9241 |
1. PBF | Q9LCQ5 | Chaperone protein DnaK | 0.00e+00 | 7.50e-56 | 0.0 | 0.9514 |
1. PBF | P0DB71 | Chaperone protein DnaK | 0.00e+00 | 3.63e-62 | 0.0 | 0.8886 |
1. PBF | P30721 | Chaperone protein DnaK | 0.00e+00 | 1.08e-53 | 0.0 | 0.9509 |
1. PBF | Q044A9 | Chaperone protein DnaK | 0.00e+00 | 4.43e-44 | 0.0 | 0.9592 |
1. PBF | B5EC42 | Chaperone protein DnaK | 0.00e+00 | 2.11e-51 | 0.0 | 0.9521 |
1. PBF | Q00488 | Chaperone protein DnaK | 0.00e+00 | 1.42e-52 | 0.0 | 0.9209 |
1. PBF | P61442 | Chaperone protein DnaK | 0.00e+00 | 3.83e-52 | 0.0 | 0.9597 |
1. PBF | A6VNB1 | Chaperone protein DnaK | 0.00e+00 | 2.68e-60 | 0.0 | 0.9472 |
1. PBF | A3ML96 | Chaperone protein HscA homolog | 0.00e+00 | 4.33e-35 | 1.05e-121 | 0.7612 |
1. PBF | Q9JVQ9 | Chaperone protein DnaK | 0.00e+00 | 3.12e-59 | 0.0 | 0.9373 |
1. PBF | P19993 | Chaperone protein DnaK | 0.00e+00 | 4.85e-56 | 0.0 | 0.9156 |
1. PBF | Q2YDD0 | Heat shock 70 kDa protein 14 | 0.00e+00 | 1.48e-04 | 4.19e-57 | 0.633 |
1. PBF | Q6MT06 | Chaperone protein DnaK | 0.00e+00 | 5.19e-110 | 0.0 | 0.9944 |
1. PBF | B7GKC8 | Chaperone protein DnaK | 0.00e+00 | 3.27e-61 | 0.0 | 0.9048 |
1. PBF | Q9W6Y1 | Heat shock cognate 71 kDa protein | 0.00e+00 | 3.92e-20 | 3.19e-163 | 0.9083 |
1. PBF | Q6LS31 | Chaperone protein DnaK 2 | 0.00e+00 | 5.52e-56 | 0.0 | 0.9429 |
1. PBF | B0UR84 | Chaperone protein DnaK | 0.00e+00 | 5.56e-49 | 0.0 | 0.9419 |
1. PBF | Q8D2Q5 | Chaperone protein DnaK | 0.00e+00 | 4.49e-50 | 0.0 | 0.9366 |
1. PBF | Q634M7 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.9204 |
1. PBF | A9VHU1 | Chaperone protein DnaK | 0.00e+00 | 1.61e-57 | 0.0 | 0.9329 |
1. PBF | B0SRF1 | Chaperone protein DnaK | 0.00e+00 | 9.89e-51 | 0.0 | 0.9659 |
1. PBF | P19120 | Heat shock cognate 71 kDa protein | 0.00e+00 | 2.49e-34 | 3.16e-176 | 0.9204 |
1. PBF | P61443 | Chaperone protein DnaK | 0.00e+00 | 5.77e-51 | 0.0 | 0.9592 |
1. PBF | Q1JKD6 | Chaperone protein DnaK | 0.00e+00 | 1.20e-62 | 0.0 | 0.8887 |
1. PBF | Q5NFG7 | Chaperone protein DnaK | 0.00e+00 | 2.43e-56 | 0.0 | 0.9254 |
1. PBF | Q65RT2 | Chaperone protein HscA homolog | 0.00e+00 | 1.44e-35 | 6.65e-126 | 0.7424 |
1. PBF | O05714 | Chaperone protein DnaK | 0.00e+00 | 1.59e-29 | 0.0 | 0.9354 |
1. PBF | A9IQZ6 | Chaperone protein HscA homolog | 0.00e+00 | 7.18e-37 | 2.43e-122 | 0.7623 |
1. PBF | B3PXH3 | Chaperone protein DnaK | 0.00e+00 | 5.32e-50 | 0.0 | 0.9336 |
1. PBF | B9L8Z0 | Chaperone protein DnaK | 0.00e+00 | 9.53e-54 | 0.0 | 0.9223 |
1. PBF | Q1BHT5 | Chaperone protein HscA homolog | 0.00e+00 | 1.72e-34 | 4.18e-119 | 0.7603 |
1. PBF | Q3KLV7 | Chaperone protein DnaK | 0.00e+00 | 1.32e-45 | 0.0 | 0.9272 |
1. PBF | B1L9B4 | Chaperone protein DnaK | 0.00e+00 | 2.71e-57 | 0.0 | 0.9434 |
1. PBF | C0ZT86 | Chaperone protein DnaK | 0.00e+00 | 5.15e-59 | 0.0 | 0.9489 |
1. PBF | P47547 | Chaperone protein DnaK | 0.00e+00 | 1.63e-61 | 0.0 | 0.9577 |
1. PBF | C4XQ63 | Chaperone protein DnaK | 0.00e+00 | 1.70e-49 | 0.0 | 0.9481 |
1. PBF | C4K0Z7 | Chaperone protein HscA homolog | 0.00e+00 | 9.30e-30 | 4.57e-95 | 0.6583 |
1. PBF | Q145F1 | Chaperone protein DnaK | 0.00e+00 | 1.91e-47 | 0.0 | 0.9309 |
1. PBF | A8FYU0 | Chaperone protein DnaK | 0.00e+00 | 1.50e-55 | 0.0 | 0.9445 |
1. PBF | Q00043 | Heat shock 70 kDa protein | 0.00e+00 | 1.82e-20 | 1.49e-158 | 0.895 |
1. PBF | Q74H59 | Chaperone protein DnaK | 0.00e+00 | 1.99e-48 | 0.0 | 0.9398 |
1. PBF | B2HZZ7 | Chaperone protein DnaK | 0.00e+00 | 3.57e-54 | 0.0 | 0.9366 |
1. PBF | Q9TLT1 | Chaperone protein dnaK | 0.00e+00 | 2.35e-58 | 0.0 | 0.9631 |
1. PBF | B5F1B6 | Chaperone protein HscA | 0.00e+00 | 3.31e-32 | 8.06e-126 | 0.7585 |
1. PBF | B1AIX8 | Chaperone protein DnaK | 0.00e+00 | 3.54e-70 | 0.0 | 0.9829 |
1. PBF | B1ILM3 | Chaperone protein DnaK | 0.00e+00 | 3.69e-49 | 0.0 | 0.9508 |
1. PBF | Q1JFC8 | Chaperone protein DnaK | 0.00e+00 | 4.15e-62 | 0.0 | 0.9109 |
1. PBF | A6LM32 | Chaperone protein DnaK | 0.00e+00 | 1.18e-60 | 0.0 | 0.9509 |
1. PBF | Q892R0 | Chaperone protein DnaK | 0.00e+00 | 1.45e-48 | 0.0 | 0.9538 |
1. PBF | Q18GZ4 | Chaperone protein DnaK | 0.00e+00 | 3.61e-34 | 0.0 | 0.9414 |
1. PBF | A6LRN4 | Chaperone protein DnaK | 0.00e+00 | 8.83e-54 | 0.0 | 0.9514 |
1. PBF | Q0SMZ0 | Chaperone protein DnaK | 0.00e+00 | 1.95e-54 | 0.0 | 0.9371 |
1. PBF | A0K8P6 | Chaperone protein HscA homolog | 0.00e+00 | 1.72e-34 | 4.18e-119 | 0.7553 |
1. PBF | Q6HDK7 | Chaperone protein DnaK | 0.00e+00 | 1.31e-57 | 0.0 | 0.921 |
1. PBF | Q73Q16 | Chaperone protein DnaK | 0.00e+00 | 7.79e-49 | 0.0 | 0.9419 |
1. PBF | Q9GSU4 | Major heat shock 70 kDa protein Ba | 0.00e+00 | 8.49e-34 | 5.14e-171 | 0.9093 |
1. PBF | Q9RY23 | Chaperone protein DnaK | 0.00e+00 | 3.73e-62 | 0.0 | 0.9372 |
1. PBF | Q52701 | Chaperone protein DnaK | 0.00e+00 | 1.23e-50 | 0.0 | 0.9584 |
1. PBF | A7HZ39 | Chaperone protein DnaK | 0.00e+00 | 1.85e-54 | 0.0 | 0.9133 |
1. PBF | Q707W3 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 2.07e-42 | 3.26e-146 | 0.9155 |
1. PBF | A5FPU4 | Chaperone protein DnaK | 0.00e+00 | 1.91e-52 | 0.0 | 0.9505 |
1. PBF | B2VGR9 | Chaperone protein DnaK | 0.00e+00 | 3.48e-54 | 0.0 | 0.9396 |
1. PBF | Q9ZFC6 | Chaperone protein DnaK | 0.00e+00 | 1.42e-52 | 0.0 | 0.9574 |
1. PBF | C4L7J8 | Chaperone protein HscA homolog | 0.00e+00 | 5.31e-39 | 1.29e-128 | 0.7481 |
1. PBF | Q128K2 | Chaperone protein DnaK | 0.00e+00 | 7.79e-54 | 0.0 | 0.9478 |
1. PBF | Q9HHB9 | Chaperone protein DnaK | 0.00e+00 | 1.17e-45 | 0.0 | 0.9384 |
1. PBF | A0KXI6 | Chaperone protein HscA homolog | 0.00e+00 | 4.31e-38 | 1.54e-126 | 0.7486 |
1. PBF | P0A3J3 | Chaperone protein DnaK | 0.00e+00 | 6.38e-62 | 0.0 | 0.8914 |
1. PBF | Q661A3 | Chaperone protein DnaK | 0.00e+00 | 1.51e-54 | 0.0 | 0.9397 |
1. PBF | Q3ZYV1 | Chaperone protein DnaK | 0.00e+00 | 1.49e-52 | 0.0 | 0.9479 |
1. PBF | B1J254 | Chaperone protein DnaK | 0.00e+00 | 8.46e-52 | 0.0 | 0.9505 |
1. PBF | B8D8V4 | Chaperone protein DnaK | 0.00e+00 | 1.21e-56 | 0.0 | 0.9258 |
1. PBF | A1ANV0 | Chaperone protein DnaK | 0.00e+00 | 7.56e-51 | 0.0 | 0.9596 |
1. PBF | Q7V3T5 | Chaperone protein dnaK2 | 0.00e+00 | 2.03e-48 | 0.0 | 0.9444 |
1. PBF | A5D8N7 | Heat shock 70 kDa protein 14-A | 0.00e+00 | 1.37e-03 | 1.90e-54 | 0.6341 |
1. PBF | O93866 | Heat shock 70 kDa protein | 0.00e+00 | 1.75e-32 | 8.27e-163 | 0.9089 |
1. PBF | Q57AD7 | Chaperone protein DnaK | 0.00e+00 | 2.76e-50 | 0.0 | 0.9309 |
1. PBF | Q5H186 | Chaperone protein DnaK | 0.00e+00 | 4.38e-56 | 0.0 | 0.9319 |
1. PBF | B1VHX4 | Chaperone protein DnaK | 0.00e+00 | 6.87e-57 | 0.0 | 0.9391 |
1. PBF | P50022 | Chaperone protein dnaK3 | 0.00e+00 | 1.79e-14 | 0.0 | 0.9339 |
1. PBF | Q24895 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 6.77e-24 | 2.45e-167 | 0.9126 |
1. PBF | B2U8U5 | Chaperone protein HscA homolog | 0.00e+00 | 3.87e-36 | 1.01e-126 | 0.7557 |
1. PBF | A3D573 | Chaperone protein HscA homolog | 0.00e+00 | 3.52e-35 | 5.96e-123 | 0.7579 |
1. PBF | P17820 | Chaperone protein DnaK | 0.00e+00 | 5.14e-58 | 0.0 | 0.9462 |
1. PBF | B1MIX5 | Chaperone protein DnaK | 0.00e+00 | 5.38e-56 | 0.0 | 0.9203 |
1. PBF | A7GXU4 | Chaperone protein DnaK | 0.00e+00 | 9.69e-56 | 0.0 | 0.9374 |
1. PBF | Q02FR1 | Chaperone protein DnaK | 0.00e+00 | 3.66e-54 | 0.0 | 0.9544 |
1. PBF | Q60C59 | Chaperone protein HscA homolog | 0.00e+00 | 2.10e-36 | 1.82e-124 | 0.765 |
1. PBF | Q049W6 | Chaperone protein DnaK | 0.00e+00 | 5.50e-53 | 0.0 | 0.947 |
1. PBF | B7M7M9 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7522 |
1. PBF | A2VD93 | Heat shock 70 kDa protein 14-B | 0.00e+00 | 9.42e-04 | 3.19e-61 | 0.6382 |
1. PBF | A5WI20 | Chaperone protein DnaK | 0.00e+00 | 2.58e-52 | 0.0 | 0.9485 |
1. PBF | A6SXE9 | Chaperone protein HscA homolog | 0.00e+00 | 7.42e-35 | 1.35e-120 | 0.7662 |
1. PBF | Q5LWJ6 | Chaperone protein DnaK | 0.00e+00 | 2.21e-54 | 0.0 | 0.9389 |
1. PBF | Q9WWG9 | Chaperone protein DnaK | 0.00e+00 | 2.24e-53 | 0.0 | 0.9446 |
1. PBF | Q55154 | Chaperone protein dnaK1 | 0.00e+00 | 3.07e-24 | 0.0 | 0.9022 |
1. PBF | F5HB71 | Transcriptional coregulator SSA1 | 0.00e+00 | 6.46e-41 | 7.85e-171 | 0.9067 |
1. PBF | P94317 | Chaperone protein DnaK | 0.00e+00 | 1.98e-55 | 0.0 | 0.9335 |
1. PBF | P41825 | Heat shock protein 70 A1 | 0.00e+00 | 2.19e-36 | 2.07e-175 | 0.915 |
1. PBF | Q46I76 | Chaperone protein DnaK | 0.00e+00 | 4.83e-55 | 0.0 | 0.9321 |
1. PBF | Q5F6W5 | Chaperone protein DnaK | 0.00e+00 | 2.89e-59 | 0.0 | 0.9328 |
1. PBF | C1D4P9 | Chaperone protein HscA homolog | 0.00e+00 | 3.24e-35 | 1.42e-130 | 0.7583 |
1. PBF | Q1XDH2 | Chaperone protein dnaK | 0.00e+00 | 5.64e-63 | 0.0 | 0.9574 |
1. PBF | Q8RH05 | Chaperone protein DnaK | 0.00e+00 | 2.15e-64 | 0.0 | 0.9402 |
1. PBF | A4VT29 | Chaperone protein DnaK | 0.00e+00 | 4.50e-62 | 0.0 | 0.8968 |
1. PBF | Q8GH79 | Chaperone protein DnaK | 0.00e+00 | 6.56e-48 | 0.0 | 0.9338 |
1. PBF | P0A3J1 | Chaperone protein DnaK | 0.00e+00 | 1.20e-62 | 0.0 | 0.8881 |
1. PBF | P78695 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 5.16e-20 | 3.25e-176 | 0.9143 |
1. PBF | A5IK42 | Chaperone protein DnaK | 0.00e+00 | 2.71e-57 | 0.0 | 0.9464 |
1. PBF | P59565 | Chaperone protein DnaK | 0.00e+00 | 9.20e-56 | 0.0 | 0.938 |
1. PBF | Q8Y0L9 | Chaperone protein HscA homolog | 0.00e+00 | 4.42e-34 | 6.35e-127 | 0.7524 |
1. PBF | P64408 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | 0.9199 |
1. PBF | B6EGX9 | Chaperone protein HscA homolog | 0.00e+00 | 1.17e-35 | 6.33e-125 | 0.7583 |
1. PBF | A1SPX5 | Chaperone protein DnaK | 0.00e+00 | 5.96e-48 | 0.0 | 0.9371 |
1. PBF | P0A3J4 | Chaperone protein DnaK | 0.00e+00 | 6.38e-62 | 0.0 | 0.8926 |
1. PBF | Q7MA35 | Chaperone protein DnaK | 0.00e+00 | 1.07e-55 | 0.0 | 0.9476 |
1. PBF | Q98DD1 | Chaperone protein DnaK | 0.00e+00 | 5.66e-56 | 0.0 | 0.9296 |
1. PBF | Q1IWL4 | Chaperone protein DnaK | 0.00e+00 | 2.98e-60 | 0.0 | 0.9356 |
1. PBF | C4ZXA1 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | 0.7583 |
1. PBF | P0CW13 | Chaperone protein DnaK | 0.00e+00 | 1.20e-54 | 0.0 | 0.8992 |
1. PBF | Q1RHH0 | Chaperone protein DnaK | 0.00e+00 | 7.37e-51 | 0.0 | 0.9583 |
1. PBF | Q2VYT1 | Chaperone protein DnaK | 0.00e+00 | 5.11e-53 | 0.0 | 0.9439 |
1. PBF | A1K724 | Chaperone protein HscA homolog | 0.00e+00 | 2.15e-36 | 1.87e-134 | 0.7534 |
1. PBF | Q8DEZ1 | Chaperone protein HscA homolog | 0.00e+00 | 3.41e-36 | 3.85e-120 | 0.7521 |
1. PBF | P0C0C5 | Chaperone protein DnaK | 0.00e+00 | 2.77e-62 | 0.0 | 0.889 |
1. PBF | A5UAB3 | Chaperone protein HscA homolog | 0.00e+00 | 5.91e-35 | 4.23e-125 | 0.6943 |
3. BF | P22623 | Heat shock 70 kDa protein II (Fragment) | 0.00e+00 | NA | 1.11e-85 | 0.8551 |
3. BF | Q2TBX4 | Heat shock 70 kDa protein 13 | 0.00e+00 | NA | 8.02e-60 | 0.7227 |
3. BF | Q5R8D9 | Heat shock 70 kDa protein 13 | 0.00e+00 | NA | 1.48e-60 | 0.7106 |
3. BF | Q60432 | Hypoxia up-regulated protein 1 | 5.51e-14 | NA | 4.36e-36 | 0.7692 |
4. PB | Q96VB9 | Heat shock protein homolog SSE1 | 0.00e+00 | 5.40e-14 | 1.78e-39 | NA |
4. PB | Q2FXZ2 | Chaperone protein DnaK | 0.00e+00 | 2.81e-59 | 0.0 | NA |
4. PB | B5YH59 | Chaperone protein DnaK | 0.00e+00 | 3.78e-53 | 0.0 | NA |
4. PB | Q9SKY8 | Heat shock 70 kDa protein 8 | 0.00e+00 | 1.25e-02 | 1.18e-50 | NA |
4. PB | P9WMJ9 | Chaperone protein DnaK | 0.00e+00 | 1.16e-52 | 0.0 | NA |
4. PB | P34931 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 9.21e-34 | 1.45e-169 | NA |
4. PB | A6T4F4 | Chaperone protein DnaK | 0.00e+00 | 6.70e-57 | 0.0 | NA |
4. PB | B4TIB4 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | Q5B0C0 | Iron-sulfur cluster biogenesis chaperone, mitochondrial | 0.00e+00 | 1.26e-19 | 0.0 | NA |
4. PB | Q5UQ49 | Heat shock 70 kDa protein homolog | NA | 2.83e-42 | 2.50e-169 | NA |
4. PB | Q9VG58 | Major heat shock 70 kDa protein Bbb | 0.00e+00 | 9.99e-34 | 5.23e-170 | NA |
4. PB | P17156 | Heat shock-related 70 kDa protein 2 | 0.00e+00 | 6.46e-37 | 4.75e-169 | NA |
4. PB | P40150 | Ribosome-associated molecular chaperone SSB2 | 0.00e+00 | 3.55e-42 | 6.10e-146 | NA |
4. PB | P38788 | Ribosome-associated complex subunit SSZ1 | 0.00e+00 | 6.83e-08 | 8.07e-33 | NA |
4. PB | Q3IFG5 | Chaperone protein HscA homolog | 0.00e+00 | 1.59e-34 | 8.42e-109 | NA |
4. PB | Q3Z601 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | O71192 | Movement protein Hsp70h | NA | 2.90e-15 | 1.43e-11 | NA |
4. PB | A1JJD5 | Chaperone protein DnaK | 0.00e+00 | 1.25e-55 | 0.0 | NA |
4. PB | P83784 | Heat shock protein SSC1, mitochondrial | 0.00e+00 | 3.70e-26 | 0.0 | NA |
4. PB | Q57TP3 | Chaperone protein DnaK | 0.00e+00 | 9.60e-58 | 0.0 | NA |
4. PB | O59838 | Heat shock protein homolog pss1 | 0.00e+00 | 3.11e-14 | 8.82e-43 | NA |
4. PB | Q8GUM2 | Heat shock 70 kDa protein 9, mitochondrial | 0.00e+00 | 5.44e-18 | 0.0 | NA |
4. PB | Q6NEY9 | Chaperone protein DnaK | 0.00e+00 | 2.94e-61 | 0.0 | NA |
4. PB | B7J7X9 | Chaperone protein DnaK | 0.00e+00 | 1.39e-53 | 0.0 | NA |
4. PB | P77319 | Chaperone protein HscC | 0.00e+00 | 3.87e-36 | 1.01e-75 | NA |
4. PB | A7MGW6 | Chaperone protein HscA | 0.00e+00 | 1.99e-33 | 2.79e-123 | NA |
4. PB | Q8DI58 | Chaperone protein dnaK2 | 0.00e+00 | 4.15e-42 | 0.0 | NA |
4. PB | O51883 | Chaperone protein HscA | 0.00e+00 | 3.11e-35 | 1.87e-105 | NA |
4. PB | Q1C0J9 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | Q92598 | Heat shock protein 105 kDa | 0.00e+00 | 4.33e-03 | 1.96e-51 | NA |
4. PB | Q9LHA8 | Heat shock 70 kDa protein 4 | 0.00e+00 | 2.71e-32 | 1.15e-165 | NA |
4. PB | Q54BD8 | Heat shock cognate 70 kDa protein 4 | 0.00e+00 | 3.49e-22 | 8.96e-138 | NA |
4. PB | C0Q4F3 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | P02825 | Major heat shock 70 kDa protein Ab | 0.00e+00 | 1.29e-34 | 1.36e-169 | NA |
4. PB | Q93GF1 | Chaperone protein DnaK | 0.00e+00 | 2.90e-51 | 0.0 | NA |
4. PB | Q54MR6 | Heat shock 70-related protein 5 | 0.00e+00 | 1.29e-04 | 3.82e-69 | NA |
4. PB | A0LWS7 | Chaperone protein DnaK | 0.00e+00 | 2.21e-51 | 0.0 | NA |
4. PB | Q7N8Y4 | Chaperone protein DnaK | 0.00e+00 | 2.16e-59 | 0.0 | NA |
4. PB | B1YTK0 | Chaperone protein DnaK | 0.00e+00 | 4.38e-50 | 0.0 | NA |
4. PB | Q61696 | Heat shock 70 kDa protein 1A | 0.00e+00 | 4.05e-37 | 1.32e-173 | NA |
4. PB | B4S0U1 | Chaperone protein DnaK | 0.00e+00 | 7.60e-54 | 0.0 | NA |
4. PB | P11147 | Heat shock 70 kDa protein cognate 4 | 0.00e+00 | 7.63e-31 | 1.61e-172 | NA |
4. PB | Q61316 | Heat shock 70 kDa protein 4 | 0.00e+00 | 3.94e-04 | 2.41e-54 | NA |
4. PB | Q9LTX9 | Heat shock 70 kDa protein 7, chloroplastic | 0.00e+00 | 3.04e-13 | 0.0 | NA |
4. PB | Q557E0 | Heat shock cognate 70 kDa protein 2 | 0.00e+00 | 1.83e-40 | 1.05e-166 | NA |
4. PB | Q07US6 | Chaperone protein DnaK | 0.00e+00 | 8.62e-53 | 0.0 | NA |
4. PB | Q730M1 | Chaperone protein DnaK | NA | 4.55e-57 | 0.0 | NA |
4. PB | B8CMW9 | Chaperone protein HscA homolog | 0.00e+00 | 7.18e-37 | 4.40e-119 | NA |
4. PB | P27420 | Heat shock 70 kDa protein C | 0.00e+00 | 1.56e-23 | 1.69e-173 | NA |
4. PB | P41797 | Heat shock protein SSA1 | 0.00e+00 | 1.06e-33 | 2.51e-163 | NA |
4. PB | A9BNG5 | Chaperone protein DnaK | 0.00e+00 | 1.89e-48 | 0.0 | NA |
4. PB | O68191 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | NA |
4. PB | Q61699 | Heat shock protein 105 kDa | 0.00e+00 | 2.23e-03 | 1.12e-52 | NA |
4. PB | P39987 | Heat shock protein SSC3, mitochondrial | 0.00e+00 | 5.67e-35 | 0.0 | NA |
4. PB | B3ERN8 | Chaperone protein DnaK | 0.00e+00 | 2.31e-55 | 0.0 | NA |
4. PB | Q6AYB4 | Heat shock 70 kDa protein 14 | 0.00e+00 | 3.40e-05 | 3.73e-49 | NA |
4. PB | B4EDZ2 | Chaperone protein DnaK | 0.00e+00 | 1.74e-50 | 0.0 | NA |
4. PB | Q9S7C0 | Heat shock 70 kDa protein 14 | 0.00e+00 | 2.50e-05 | 4.41e-48 | NA |
4. PB | C5CU12 | Chaperone protein DnaK | 0.00e+00 | 8.02e-55 | 0.0 | NA |
4. PB | A6GXZ1 | Chaperone protein DnaK | 0.00e+00 | 4.88e-59 | 0.0 | NA |
4. PB | Q0VDF9 | Heat shock 70 kDa protein 14 | 0.00e+00 | 5.24e-04 | 1.44e-55 | NA |
4. PB | Q9BIR7 | Major heat shock 70 kDa protein Bc | 0.00e+00 | 6.38e-34 | 9.50e-170 | NA |
4. PB | P0A6Y8 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | Q9STW6 | Heat shock 70 kDa protein 6, chloroplastic | 0.00e+00 | 2.32e-11 | 0.0 | NA |
4. PB | Q8RB68 | Chaperone protein DnaK | 0.00e+00 | 1.12e-50 | 0.0 | NA |
4. PB | P0CW12 | Chaperone protein DnaK | 0.00e+00 | 1.20e-54 | 0.0 | NA |
4. PB | A9MR77 | Chaperone protein DnaK | 0.00e+00 | 2.41e-58 | 0.0 | NA |
4. PB | B4TDB2 | Chaperone protein HscA | 0.00e+00 | 3.73e-32 | 3.20e-126 | NA |
4. PB | P87142 | Heat shock protein 70 homolog C57A7.12 | 0.00e+00 | 1.05e-05 | 6.29e-32 | NA |
4. PB | Q21CI2 | Chaperone protein DnaK | 0.00e+00 | 4.18e-53 | 0.0 | NA |
4. PB | Q0TLX5 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | Q4FNP9 | Chaperone protein DnaK | 0.00e+00 | 1.05e-46 | 0.0 | NA |
4. PB | P22954 | Heat shock 70 kDa protein 2 | 0.00e+00 | 3.37e-33 | 2.53e-164 | NA |
4. PB | B1IRG0 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | P29843 | Heat shock 70 kDa protein cognate 1 | 0.00e+00 | 1.47e-38 | 5.29e-170 | NA |
4. PB | P29845 | Heat shock 70 kDa protein cognate 5 | 0.00e+00 | 1.01e-14 | 0.0 | NA |
4. PB | Q8K9Y8 | Chaperone protein DnaK | 0.00e+00 | 1.93e-55 | 0.0 | NA |
4. PB | O83246 | Chaperone protein DnaK | 0.00e+00 | 1.12e-50 | 0.0 | NA |
4. PB | B5RF08 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | P09435 | Heat shock protein SSA3 | 0.00e+00 | 3.48e-38 | 1.26e-166 | NA |
4. PB | Q9LDZ0 | Heat shock 70 kDa protein 10, mitochondrial | 0.00e+00 | 2.66e-16 | 0.0 | NA |
4. PB | P11021 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.92e-26 | 5.50e-177 | NA |
4. PB | P54652 | Heat shock-related 70 kDa protein 2 | 0.00e+00 | 1.57e-36 | 8.05e-169 | NA |
4. PB | A8ALU3 | Chaperone protein DnaK | 0.00e+00 | 1.45e-57 | 0.0 | NA |
4. PB | B0KA81 | Chaperone protein DnaK | 0.00e+00 | 3.44e-48 | 0.0 | NA |
4. PB | Q9S9N1 | Heat shock 70 kDa protein 5 | 0.00e+00 | 3.05e-35 | 1.06e-162 | NA |
4. PB | A5CM86 | Chaperone protein DnaK | 0.00e+00 | 2.37e-55 | 0.0 | NA |
4. PB | Q3JP10 | Chaperone protein DnaK | 0.00e+00 | 1.36e-50 | 0.0 | NA |
4. PB | P38646 | Stress-70 protein, mitochondrial | 0.00e+00 | 3.33e-16 | 0.0 | NA |
4. PB | P0A6Z1 | Chaperone protein HscA | 0.00e+00 | 7.05e-32 | 1.91e-119 | NA |
4. PB | Q66HA8 | Heat shock protein 105 kDa | 0.00e+00 | 4.14e-03 | 2.56e-52 | NA |
4. PB | B2IBR4 | Chaperone protein DnaK | 0.00e+00 | 7.79e-49 | 0.0 | NA |
4. PB | P0DMV8 | Heat shock 70 kDa protein 1A | 0.00e+00 | 1.03e-34 | 1.55e-175 | NA |
4. PB | Q05931 | Iron-sulfur cluster biogenesis chaperone, mitochondrial | 0.00e+00 | 4.37e-25 | 1.68e-163 | NA |
4. PB | P17879 | Heat shock 70 kDa protein 1B | 0.00e+00 | 1.32e-36 | 1.45e-173 | NA |
4. PB | Q05036 | Heat shock protein 110 | 0.00e+00 | 2.76e-08 | 7.87e-44 | NA |
4. PB | Q3J7D8 | Chaperone protein DnaK | 0.00e+00 | 7.80e-53 | 0.0 | NA |
4. PB | Q8I0H7 | Heat shock 70 kDa protein, mitochondrial | 0.00e+00 | 6.51e-32 | 0.0 | NA |
4. PB | Q9LKR3 | Heat shock 70 kDa protein BIP1 | 0.00e+00 | 1.87e-24 | 7.54e-176 | NA |
4. PB | P11143 | Heat shock 70 kDa protein | NA | 9.99e-33 | 4.45e-160 | NA |
4. PB | Q5PDJ5 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | O06430 | Chaperone protein DnaK | 0.00e+00 | 1.71e-54 | 0.0 | NA |
4. PB | P09446 | Heat shock protein hsp-1 | 0.00e+00 | 1.38e-38 | 1.99e-173 | NA |
4. PB | Q5P1H5 | Chaperone protein DnaK | 0.00e+00 | 7.05e-57 | 0.0 | NA |
4. PB | A7FME3 | Chaperone protein DnaK | 0.00e+00 | 3.95e-54 | 0.0 | NA |
4. PB | Q556U6 | Luminal-binding protein 1 | 1.32e-14 | 3.50e-05 | 4.54e-31 | NA |
4. PB | Q8SSB1 | Heat shock protein homolog ECU03_0520 | 0.00e+00 | 1.27e-33 | 7.24e-108 | NA |
4. PB | O97125 | Heat shock protein 68 | 0.00e+00 | 6.88e-37 | 5.04e-168 | NA |
4. PB | F4HQD4 | Heat shock 70 kDa protein 15 | 0.00e+00 | 6.48e-05 | 7.88e-47 | NA |
4. PB | Q3BVB8 | Chaperone protein DnaK | 0.00e+00 | 1.57e-55 | 0.0 | NA |
4. PB | B1JW19 | Chaperone protein DnaK | 0.00e+00 | 4.49e-50 | 0.0 | NA |
4. PB | P55994 | Chaperone protein DnaK | 0.00e+00 | 1.63e-61 | 0.0 | NA |
4. PB | A7MIK5 | Chaperone protein DnaK | 0.00e+00 | 2.09e-57 | 0.0 | NA |
4. PB | A6UEY0 | Chaperone protein DnaK | 0.00e+00 | 4.70e-48 | 0.0 | NA |
4. PB | B1Y786 | Chaperone protein DnaK | 0.00e+00 | 6.87e-54 | 0.0 | NA |
4. PB | P86233 | Stress-70 protein, mitochondrial (Fragments) | 1.04e-07 | 1.40e-08 | 2.03e-33 | NA |
4. PB | Q10265 | Probable heat shock protein ssa1 | 0.00e+00 | 1.16e-38 | 1.06e-166 | NA |
4. PB | Q24798 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.97e-24 | 3.69e-165 | NA |
4. PB | Q54BE0 | Heat shock cognate 70 kDa protein 3 | 0.00e+00 | 9.33e-39 | 1.07e-160 | NA |
4. PB | P11142 | Heat shock cognate 71 kDa protein | 0.00e+00 | 4.03e-36 | 2.78e-176 | NA |
4. PB | Q8T869 | Luminal-binding protein 2 | 0.00e+00 | 2.08e-24 | 2.58e-163 | NA |
4. PB | P10591 | Heat shock protein SSA1 | 0.00e+00 | 3.88e-41 | 8.43e-170 | NA |
4. PB | P63018 | Heat shock cognate 71 kDa protein | 0.00e+00 | 3.48e-36 | 2.78e-176 | NA |
4. PB | P20163 | Endoplasmic reticulum chaperone BiP homolog | 0.00e+00 | 2.21e-22 | 3.17e-172 | NA |
4. PB | P11145 | Heat shock 70 kDa protein 4 | NA | 6.26e-32 | 1.79e-162 | NA |
4. PB | Q87S24 | Chaperone protein HscA homolog | 0.00e+00 | 3.20e-36 | 3.64e-121 | NA |
4. PB | O95757 | Heat shock 70 kDa protein 4L | 0.00e+00 | 1.81e-03 | 7.62e-52 | NA |
4. PB | P0DMW1 | Heat shock 70 kDa protein 1B | 0.00e+00 | 2.43e-37 | 6.45e-174 | NA |
4. PB | Q5PNH1 | Chaperone protein HscA | 0.00e+00 | 2.51e-32 | 4.37e-126 | NA |
4. PB | B3R6G7 | Chaperone protein DnaK | 0.00e+00 | 4.26e-54 | 0.0 | NA |
4. PB | Q1CMV7 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | Q3K7A9 | Chaperone protein HscA homolog | 0.00e+00 | 2.81e-35 | 1.62e-129 | NA |
4. PB | Q56073 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | P26413 | Heat shock 70 kDa protein | 0.00e+00 | 9.79e-33 | 1.70e-165 | NA |
4. PB | P36604 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 9.27e-24 | 1.05e-176 | NA |
4. PB | B5R5I2 | Chaperone protein DnaK | 0.00e+00 | 3.21e-58 | 0.0 | NA |
4. PB | Q31XW4 | Chaperone protein HscA | 0.00e+00 | 1.65e-31 | 1.08e-119 | NA |
4. PB | Q9ZMW4 | Chaperone protein DnaK | 0.00e+00 | 1.01e-59 | 0.0 | NA |
4. PB | A5FGL1 | Chaperone protein DnaK | 0.00e+00 | 9.61e-57 | 0.0 | NA |
4. PB | A9L3Q6 | Chaperone protein HscA homolog | 0.00e+00 | 7.10e-36 | 6.05e-124 | NA |
4. PB | Q6L590 | Heat shock 70 kDa protein BIP3 | 0.00e+00 | 4.27e-23 | 5.78e-155 | NA |
4. PB | B4T6D6 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | Q8INI8 | Major heat shock 70 kDa protein Ba | 0.00e+00 | 6.38e-34 | 9.50e-170 | NA |
4. PB | A4W6D5 | Chaperone protein DnaK | 0.00e+00 | 1.17e-54 | 0.0 | NA |
4. PB | Q2SYZ4 | Chaperone protein DnaK | 0.00e+00 | 3.36e-51 | 0.0 | NA |
4. PB | P82910 | Major heat shock 70 kDa protein Aa | 0.00e+00 | 1.29e-34 | 1.36e-169 | NA |
4. PB | P96133 | Chaperone protein DnaK | 0.00e+00 | 1.11e-52 | 0.0 | NA |
4. PB | Q0T8H6 | Chaperone protein DnaK | 0.00e+00 | 1.12e-57 | 0.0 | NA |
4. PB | A2BZ91 | Chaperone protein DnaK | 0.00e+00 | 7.74e-51 | 0.0 | NA |
4. PB | B5ENA3 | Chaperone protein DnaK | 0.00e+00 | 1.39e-53 | 0.0 | NA |
4. PB | Q9SAB1 | Heat shock 70 kDa protein 16 | 0.00e+00 | 4.99e-05 | 3.25e-46 | NA |
4. PB | O65719 | Heat shock 70 kDa protein 3 | 0.00e+00 | 2.14e-32 | 1.05e-163 | NA |
4. PB | Q8Z9R1 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | Q7ZUW2 | Hypoxia up-regulated protein 1 | 2.95e-14 | 5.04e-03 | 6.62e-44 | NA |
4. PB | Q62HD5 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | NA |
4. PB | Q10061 | Heat shock protein 70 homolog lhs1 | 0.00e+00 | 4.56e-08 | 2.47e-29 | NA |
4. PB | Q10284 | Ribosome-associated molecular chaperone sks2 | 0.00e+00 | 5.99e-40 | 3.64e-137 | NA |
4. PB | C6E643 | Chaperone protein DnaK | 0.00e+00 | 2.32e-51 | 0.0 | NA |
4. PB | Q90473 | Heat shock cognate 71 kDa protein | 0.00e+00 | 3.61e-34 | 1.77e-171 | NA |
4. PB | A1A3P5 | Chaperone protein DnaK | 0.00e+00 | 8.05e-52 | 0.0 | NA |
4. PB | O88600 | Heat shock 70 kDa protein 4 | 0.00e+00 | 5.14e-04 | 7.95e-55 | NA |
4. PB | Q6FU50 | Heat shock protein 70 homolog LHS1 | 0.00e+00 | 2.07e-02 | 4.13e-16 | NA |
4. PB | F4JMJ1 | Heat shock 70 kDa protein 17 | 0.00e+00 | 6.22e-07 | 5.71e-30 | NA |
4. PB | A7ZPW9 | Chaperone protein HscA | 0.00e+00 | 6.26e-32 | 2.22e-119 | NA |
4. PB | P30722 | Chaperone protein dnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | A6W2D2 | Chaperone protein DnaK | 0.00e+00 | 1.39e-55 | 0.0 | NA |
4. PB | P0DMW0 | Heat shock 70 kDa protein 1A | 0.00e+00 | 2.43e-37 | 6.45e-174 | NA |
4. PB | B3E7W9 | Chaperone protein DnaK | 0.00e+00 | 3.47e-52 | 0.0 | NA |
4. PB | P32589 | Heat shock protein homolog SSE1 | 0.00e+00 | 5.98e-12 | 9.04e-41 | NA |
4. PB | Q66ET0 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | Q8H1B3 | Heat shock 70 kDa protein BIP3 | 0.00e+00 | 3.52e-18 | 3.64e-170 | NA |
4. PB | Q39JC8 | Chaperone protein DnaK | 0.00e+00 | 1.05e-49 | 0.0 | NA |
4. PB | P10592 | Heat shock protein SSA2 | 0.00e+00 | 1.12e-42 | 2.92e-168 | NA |
4. PB | B0K3Y0 | Chaperone protein DnaK | 0.00e+00 | 3.12e-49 | 0.0 | NA |
4. PB | B2JGE2 | Chaperone protein DnaK | 0.00e+00 | 1.82e-47 | 0.0 | NA |
4. PB | P36016 | Heat shock protein 70 homolog LHS1 | 0.00e+00 | 6.29e-07 | 5.01e-18 | NA |
4. PB | Q6Z058 | Heat shock 70 kDa protein BIP5 | 0.00e+00 | 5.61e-22 | 1.94e-168 | NA |
4. PB | P0CS90 | Import motor subunit, mitochondrial | 0.00e+00 | 2.54e-27 | 0.0 | NA |
4. PB | P22953 | Heat shock 70 kDa protein 1 | 0.00e+00 | 8.75e-35 | 9.13e-166 | NA |
4. PB | P34932 | Heat shock 70 kDa protein 4 | 0.00e+00 | 1.14e-03 | 2.30e-54 | NA |
4. PB | Q75HQ0 | Heat shock 70 kDa protein BIP4 | 0.00e+00 | 1.53e-15 | 1.49e-164 | NA |
4. PB | Q9C7X7 | Heat shock 70 kDa protein 18 | 0.00e+00 | 6.79e-29 | 1.78e-166 | NA |
4. PB | A8FXA1 | Chaperone protein HscA homolog | 0.00e+00 | 4.40e-38 | 2.29e-109 | NA |
4. PB | P48722 | Heat shock 70 kDa protein 4L | 0.00e+00 | 3.09e-04 | 7.30e-54 | NA |
4. PB | B4TVZ5 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | O24581 | Luminal-binding protein 3 | 0.00e+00 | 8.91e-25 | 2.21e-175 | NA |
4. PB | A9MXI2 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | Q9BIS2 | Major heat shock 70 kDa protein Bb | 0.00e+00 | 6.38e-34 | 9.50e-170 | NA |
4. PB | P20029 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.46e-25 | 9.06e-177 | NA |
4. PB | Q5RGE6 | Heat shock 70 kDa protein 14 | 0.00e+00 | 1.98e-02 | 4.72e-58 | NA |
4. PB | P42374 | Chaperone protein DnaK | 0.00e+00 | 1.19e-47 | 0.0 | NA |
4. PB | B2S2G4 | Chaperone protein DnaK | 0.00e+00 | 1.12e-50 | 0.0 | NA |
4. PB | B5Y242 | Chaperone protein DnaK | 0.00e+00 | 7.24e-57 | 0.0 | NA |
4. PB | Q6MNF8 | Chaperone protein DnaK | 0.00e+00 | 8.18e-49 | 0.0 | NA |
4. PB | P17066 | Heat shock 70 kDa protein 6 | 0.00e+00 | 7.65e-37 | 2.98e-178 | NA |
4. PB | Q31HA7 | Chaperone protein DnaK | 0.00e+00 | 1.16e-53 | 0.0 | NA |
4. PB | Q67S54 | Chaperone protein DnaK | 0.00e+00 | 2.44e-57 | 0.0 | NA |
4. PB | B5E232 | Chaperone protein DnaK | NA | 6.72e-61 | 0.0 | NA |
4. PB | Q6Z7B0 | Heat shock 70 kDa protein BIP1 | 0.00e+00 | 1.12e-24 | 7.34e-174 | NA |
4. PB | P0A6Z0 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | A3NYX7 | Chaperone protein DnaK | 0.00e+00 | 7.30e-50 | 0.0 | NA |
4. PB | Q0BW82 | Chaperone protein DnaK | 0.00e+00 | 3.02e-53 | 0.0 | NA |
4. PB | C3LT05 | Chaperone protein HscA homolog | 0.00e+00 | 1.63e-35 | 1.13e-130 | NA |
4. PB | Q1BYX3 | Chaperone protein DnaK | 0.00e+00 | 4.49e-50 | 0.0 | NA |
4. PB | Q99M31 | Heat shock 70 kDa protein 14 | 0.00e+00 | 7.23e-05 | 9.66e-48 | NA |
4. PB | P06761 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 2.10e-26 | 2.28e-176 | NA |
4. PB | Q32KA5 | Chaperone protein DnaK | 0.00e+00 | 6.04e-57 | 0.0 | NA |
4. PB | B9JZ87 | Chaperone protein DnaK | 0.00e+00 | 2.51e-52 | 0.0 | NA |
4. PB | P29215 | Chaperone protein dnaK | 0.00e+00 | 1.93e-55 | 0.0 | NA |
4. PB | B2URT8 | Chaperone protein DnaK | 0.00e+00 | 7.48e-61 | 0.0 | NA |
4. PB | B1JL04 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | Q1H3B8 | Chaperone protein DnaK | 0.00e+00 | 1.88e-55 | 0.0 | NA |
4. PB | P11141 | Heat shock protein hsp-6 | 0.00e+00 | 9.30e-30 | 0.0 | NA |
4. PB | B5FHA6 | Chaperone protein DnaK | 0.00e+00 | 1.19e-58 | 0.0 | NA |
4. PB | Q2Y6U0 | Chaperone protein DnaK | 0.00e+00 | 5.77e-55 | 0.0 | NA |
4. PB | Q12WE6 | Chaperone protein DnaK | 0.00e+00 | 4.71e-55 | 0.0 | NA |
4. PB | P22202 | Heat shock protein SSA4 | 0.00e+00 | 1.40e-40 | 3.34e-167 | NA |
4. PB | P55063 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 6.65e-34 | 4.37e-171 | NA |
4. PB | P46587 | Heat shock protein SSA2 | 0.00e+00 | 1.05e-42 | 9.59e-166 | NA |
4. PB | A4SQ25 | Chaperone protein DnaK | 0.00e+00 | 2.55e-56 | 0.0 | NA |
4. PB | B5BLH8 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | Q06W39 | Chaperone protein dnaK | 0.00e+00 | 2.28e-59 | 0.0 | NA |
4. PB | P64410 | Chaperone protein DnaK | 0.00e+00 | 2.24e-63 | 0.0 | NA |
4. PB | B8D758 | Chaperone protein DnaK | 0.00e+00 | 1.21e-56 | 0.0 | NA |
4. PB | B3EHR1 | Chaperone protein DnaK | 0.00e+00 | 2.76e-49 | 0.0 | NA |
4. PB | P29844 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 1.31e-25 | 5.74e-171 | NA |
4. PB | Q0VST6 | Chaperone protein DnaK | 0.00e+00 | 1.93e-55 | 0.0 | NA |
4. PB | Q2KWA2 | Chaperone protein DnaK | 0.00e+00 | 1.53e-57 | 0.0 | NA |
4. PB | P38647 | Stress-70 protein, mitochondrial | 0.00e+00 | 1.44e-16 | 0.0 | NA |
4. PB | Q53RJ5 | Heat shock 70 kDa protein BIP2 | 0.00e+00 | 4.62e-21 | 5.03e-178 | NA |
4. PB | P11484 | Ribosome-associated molecular chaperone SSB1 | 0.00e+00 | 4.15e-42 | 1.61e-145 | NA |
4. PB | Q8PMB0 | Chaperone protein DnaK | 0.00e+00 | 2.76e-55 | 0.0 | NA |
4. PB | A7ZVV7 | Chaperone protein DnaK | 0.00e+00 | 6.87e-57 | 0.0 | NA |
4. PB | A9R015 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | P37092 | Movement protein Hsp70h | NA | 1.94e-20 | 2.93e-20 | NA |
4. PB | P24067 | Luminal-binding protein 2 | 0.00e+00 | 2.10e-25 | 1.37e-175 | NA |
4. PB | P36415 | Heat shock cognate 70 kDa protein 1 | 0.00e+00 | 1.74e-41 | 4.71e-166 | NA |
4. PB | P0DMV9 | Heat shock 70 kDa protein 1B | 0.00e+00 | 1.03e-34 | 1.55e-175 | NA |
4. PB | Q5FSL5 | Chaperone protein DnaK | 0.00e+00 | 4.06e-56 | 0.0 | NA |
4. PB | C4L8Y5 | Chaperone protein DnaK | 0.00e+00 | 1.12e-50 | 0.0 | NA |
4. PB | P63017 | Heat shock cognate 71 kDa protein | 0.00e+00 | 3.48e-36 | 2.78e-176 | NA |
4. PB | B0TNY5 | Chaperone protein HscA homolog | 0.00e+00 | 2.86e-38 | 7.96e-121 | NA |
4. PB | C6DBI7 | Chaperone protein HscA | 0.00e+00 | 4.07e-35 | 1.49e-127 | NA |
4. PB | P16627 | Heat shock 70 kDa protein 1-like | 0.00e+00 | 2.12e-33 | 6.25e-171 | NA |
4. PB | Q83047 | Movement protein Hsp70h | NA | 4.47e-13 | 1.42e-20 | NA |
4. PB | Q7V9G2 | Chaperone protein dnaK2 | 0.00e+00 | 1.19e-52 | 0.0 | NA |
4. PB | P11146 | Heat shock 70 kDa protein cognate 2 | 0.00e+00 | 4.22e-38 | 2.40e-158 | NA |
4. PB | O59855 | Probable heat shock protein ssa2 | 0.00e+00 | 9.52e-38 | 1.26e-166 | NA |
4. PB | A9AGB8 | Chaperone protein DnaK | 0.00e+00 | 9.65e-51 | 0.0 | NA |
4. PB | P16474 | Endoplasmic reticulum chaperone BiP | 0.00e+00 | 7.03e-20 | 1.44e-177 | NA |
4. PB | B2K3M0 | Chaperone protein DnaK | 0.00e+00 | 2.15e-54 | 0.0 | NA |
4. PB | P48721 | Stress-70 protein, mitochondrial | 0.00e+00 | 1.21e-15 | 0.0 | NA |
4. PB | Q15UD3 | Chaperone protein DnaK | 0.00e+00 | 2.76e-55 | 0.0 | NA |
4. PB | Q83MH5 | Chaperone protein DnaK | 0.00e+00 | 1.12e-57 | 0.0 | NA |
4. PB | A0M353 | Chaperone protein DnaK | 0.00e+00 | 9.07e-46 | 0.0 | NA |
4. PB | P22774 | Iron-sulfur cluster biogenesis chaperone, mitochondrial | 0.00e+00 | 2.43e-17 | 0.0 | NA |
4. PB | Q6FJI3 | Heat shock protein homolog SSE1 | 0.00e+00 | 8.89e-12 | 3.08e-37 | NA |
4. PB | B2I6F6 | Chaperone protein DnaK | 0.00e+00 | 8.19e-54 | 0.0 | NA |
4. PB | Q6TMK3 | Heat shock protein 88 | 0.00e+00 | 3.83e-08 | 4.55e-41 | NA |
4. PB | B5F6Y8 | Chaperone protein DnaK | 0.00e+00 | 2.17e-58 | 0.0 | NA |
4. PB | P32590 | Heat shock protein homolog SSE2 | 0.00e+00 | 2.87e-12 | 3.42e-35 | NA |
4. PB | A9HEA3 | Chaperone protein DnaK | 0.00e+00 | 6.06e-51 | 0.0 | NA |
4. PB | P14659 | Heat shock-related 70 kDa protein 2 | 0.00e+00 | 6.46e-37 | 4.75e-169 | NA |
4. PB | Q39043 | Heat shock 70 kDa protein BIP2 | 0.00e+00 | 5.81e-25 | 1.37e-176 | NA |
4. PB | A0K1L3 | Chaperone protein DnaK | 0.00e+00 | 1.05e-55 | 0.0 | NA |
4. PB | Q3SW76 | Chaperone protein DnaK | 0.00e+00 | 2.62e-55 | 0.0 | NA |
7. B | A0A0H3C7V4 | Cell shape-determining protein MreB | 4.79e-13 | NA | 1.12e-12 | NA |
7. B | P12077 | Heat shock 70-related protein 4 (Fragment) | 1.57e-11 | NA | 3.35e-42 | NA |
7. B | P0A9X5 | Cell shape-determining protein MreB | 2.76e-13 | NA | 2.06e-10 | NA |
7. B | Q8BM72 | Heat shock 70 kDa protein 13 | 0.00e+00 | NA | 1.66e-58 | NA |
7. B | P34934 | Heat shock 70 kDa protein (Fragment) | 3.64e-13 | NA | 2.58e-87 | NA |
7. B | P12078 | Heat shock 70 kDa protein PPF203 (Fragment) | 7.99e-08 | NA | 1.84e-48 | NA |
7. B | P11503 | Heat shock 70 kDa protein (Fragment) | 4.33e-15 | NA | 2.13e-95 | NA |
7. B | P16121 | Heat shock 70 kDa protein (Fragment) | 1.67e-08 | NA | 1.97e-53 | NA |
7. B | P44474 | Cell shape-determining protein MreB | 2.43e-13 | NA | 2.02e-10 | NA |
7. B | P86265 | Heat shock 70 kDa protein 4L (Fragments) | 3.42e-03 | NA | 0.002 | NA |
7. B | P12795 | Heat shock 70 kDa protein (Fragment) | 2.33e-05 | NA | 8.44e-28 | NA |
7. B | P39751 | Cell shape-determining protein Mbl | 3.23e-13 | NA | 5.60e-13 | NA |
7. B | Q63617 | Hypoxia up-regulated protein 1 | 0.00e+00 | NA | 1.55e-37 | NA |
7. B | P32444 | Cell shape-determining protein Mbl | 2.85e-13 | NA | 4.00e-11 | NA |
7. B | Q9L6A3 | Cell shape-determining protein MreB | 2.34e-13 | NA | 4.14e-11 | NA |
7. B | Q9JKR6 | Hypoxia up-regulated protein 1 | 0.00e+00 | NA | 1.52e-37 | NA |
7. B | P02826 | Heat shock 70 kDa protein cognate 1 (Fragments) | 1.62e-07 | NA | 1.29e-12 | NA |
7. B | P36928 | Uncharacterized chaperone protein YegD | 0.00e+00 | NA | 5.22e-10 | NA |
7. B | Q03682 | Luminal-binding protein 2 (Fragment) | 3.60e-09 | NA | 2.76e-72 | NA |
7. B | P27894 | Heat shock 70 kDa protein (Fragment) | 3.38e-06 | NA | 4.97e-34 | NA |
7. B | P48723 | Heat shock 70 kDa protein 13 | 0.00e+00 | NA | 3.03e-61 | NA |
7. B | P86175 | Chaperone protein DnaK (Fragments) | 3.32e-01 | NA | 0.003 | NA |
7. B | P31082 | Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) | 1.16e-01 | NA | 4.03e-08 | NA |
7. B | P12794 | Endoplasmic reticulum chaperone BiP (Fragment) | 4.79e-10 | NA | 6.61e-69 | NA |
7. B | O35162 | Heat shock 70 kDa protein 13 | 0.00e+00 | NA | 9.17e-60 | NA |
7. B | P86204 | Heat shock-related 70 kDa protein 2 (Fragments) | 6.75e-03 | NA | 5.16e-27 | NA |
7. B | Q01465 | Cell shape-determining protein MreB | 3.24e-13 | NA | 8.76e-11 | NA |
7. B | P0A9X7 | Cell shape-determining protein MreB | 2.01e-13 | NA | 2.06e-10 | NA |
7. B | P34935 | Endoplasmic reticulum chaperone BiP (Fragment) | 1.11e-16 | NA | 1.45e-82 | NA |
7. B | P0A9X4 | Cell shape-determining protein MreB | 2.29e-13 | NA | 2.06e-10 | NA |
7. B | Q03683 | Luminal-binding protein 3 (Fragment) | 3.03e-04 | NA | 1.68e-20 | NA |
7. B | P48741 | Putative heat shock 70 kDa protein 7 | 0.00e+00 | NA | 1.71e-77 | NA |
7. B | Q03681 | Luminal-binding protein 1 (Fragment) | 4.81e-10 | NA | 3.80e-72 | NA |
7. B | Q9Y4L1 | Hypoxia up-regulated protein 1 | 0.00e+00 | NA | 7.81e-38 | NA |
7. B | Q5UPU0 | Heat shock protein 70 homolog | NA | NA | 2.87e-110 | NA |
7. B | P0A9X6 | Cell shape-determining protein MreB | 1.99e-13 | NA | 2.06e-10 | NA |
7. B | Q05945 | Heat shock 70 kDa protein (Fragment) | 6.15e-06 | NA | 1.31e-41 | NA |
7. B | Q03686 | Luminal-binding protein 8 (Fragment) | 4.41e-10 | NA | 1.87e-74 | NA |
7. B | P0A9X8 | Cell shape-determining protein MreB | 2.40e-13 | NA | 2.06e-10 | NA |
7. B | P39763 | Cell shape-determining protein MreBH | 2.35e-13 | NA | 5.59e-11 | NA |