Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54855.1

JCVISYN3A_0543

Nucleotide exchange factor.
M. mycoides homolog: Q6MT05.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 13
Unique PROST Go: 3
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 598
Unique PROST Homologs: 10
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: grpE; Protein GrpE
Zhang et al. [4]: GO:0000774|adenyl-nucleotide exchange factor activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q0TEM6 (Protein GrpE) with a FATCAT P-Value: 0 and RMSD of 1.83 angstrom. The sequence alignment identity is 23.0%.
Structural alignment shown in left. Query protein AVX54855.1 colored as red in alignment, homolog Q0TEM6 colored as blue. Query protein AVX54855.1 is also shown in right top, homolog Q0TEM6 showed in right bottom. They are colored based on secondary structures.

  AVX54855.1 MTEELKNKKNNKKYYSQNRNKT---KA-E--FQKTH--IK------KNQYLNLKT-KL-NTVLLEVQNLKDLNETLKLKLESEKQLNL-AEISNLTKKYN 83
      Q0TEM6 --------------MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIAN---LEAQ-LAEAQ-T----RERDGILRVKAEMENLRRR-T 76

  AVX54855.1 QKESETK--KYGASNLAK---DLIQP-LEILKKVVN-APNNNEVVQAYVKGFEMIINQINNVLESHHIKAM---NVKVGDMFNPHLHDANEAVESDMYQT 173
      Q0TEM6 ELDIE-KAHKFA---LEKFINELL-PVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPL-D---PNVHQAIAMVESDDVAP 167

  AVX54855.1 NQIVGVLSDGYMIHDKVLVYAIVKVAK--- 200
      Q0TEM6 GNVLGIMQKGYTLNGRTIRAAMVTVAKAKA 197

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0042803	protein homodimerization activity
1. PBF	GO:0000774	adenyl-nucleotide exchange factor activity
1. PBF	GO:0030150	protein import into mitochondrial matrix
1. PBF	GO:0051082	unfolded protein binding
1. PBF	GO:0001405	PAM complex, Tim23 associated import motor
1. PBF	GO:0051087	chaperone binding
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0006457	protein folding
1. PBF	GO:2001065	mannan binding
4. PB	GO:0005524	ATP binding
5. P	GO:0005886	plasma membrane
5. P	GO:0005759	mitochondrial matrix
5. P	GO:0016021	integral component of membrane

Uniprot GO Annotations

GO	Description
GO:0042803	protein homodimerization activity
GO:0000774	adenyl-nucleotide exchange factor activity
GO:0051087	chaperone binding
GO:0005737	cytoplasm
GO:0006457	protein folding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	B8F790	Protein GrpE	6.00e-15	6.47e-41	1.25e-06	0.8669
1. PBF	A2BNE2	Protein GrpE	0.00e+00	3.54e-23	3.20e-05	0.7826
1. PBF	P68892	Protein GrpE	1.21e-13	2.99e-46	0.004	0.8831
1. PBF	C1DFM4	Protein GrpE	2.22e-16	1.98e-26	3.39e-08	0.8369
1. PBF	A8FLH1	Protein GrpE	0.00e+00	5.41e-40	1.07e-09	0.7529
1. PBF	B4TS61	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7256
1. PBF	A4SQ26	Protein GrpE	0.00e+00	1.68e-36	7.95e-05	0.823
1. PBF	P0DJM3	Protein GrpE	0.00e+00	6.28e-42	8.15e-13	0.6511
1. PBF	Q6G8Y6	Protein GrpE	9.99e-16	6.41e-37	5.01e-08	0.8064
1. PBF	Q11B39	Protein GrpE	4.44e-16	1.87e-26	2.00e-13	0.7755
1. PBF	A7Z6W2	Protein GrpE	0.00e+00	4.24e-39	2.85e-10	0.6296
1. PBF	A7FKS2	Protein GrpE	1.78e-15	1.57e-37	2.53e-04	0.7845
1. PBF	P61444	Protein GrpE	0.00e+00	6.07e-39	2.94e-08	0.6939
1. PBF	B7V1H4	Protein GrpE	0.00e+00	2.38e-20	3.78e-08	0.8819
1. PBF	A0RPW8	Protein GrpE	0.00e+00	1.69e-40	7.54e-11	0.8707
1. PBF	B2S0M1	Protein GrpE	3.59e-11	8.31e-39	1.77e-07	0.4604
1. PBF	Q8NWA9	Protein GrpE	0.00e+00	6.41e-37	5.01e-08	0.7953
1. PBF	A4WDH8	Protein GrpE	0.00e+00	5.35e-44	0.011	0.7274
1. PBF	Q0SMY9	Protein GrpE	4.44e-16	1.09e-39	2.54e-08	0.4016
1. PBF	B1J253	Protein GrpE	0.00e+00	2.03e-17	1.26e-04	0.8588
1. PBF	Q87RX5	Protein GrpE	0.00e+00	1.34e-45	1.86e-11	0.6307
1. PBF	Q3J7D7	Protein GrpE	1.94e-13	2.27e-36	3.70e-07	0.4557
1. PBF	Q0T181	Protein GrpE	0.00e+00	7.39e-45	0.001	0.8887
1. PBF	B8GXP4	Protein GrpE	0.00e+00	4.22e-02	8.89e-08	0.8421
1. PBF	Q8PMB1	Protein GrpE	3.85e-14	5.87e-34	0.002	0.7557
1. PBF	P23575	Protein GrpE	0.00e+00	1.02e-20	2.25e-15	0.832
1. PBF	Q0VST7	Protein GrpE	7.77e-16	1.16e-28	6.88e-05	0.7575
1. PBF	Q7NDP1	Protein GrpE	1.11e-15	4.25e-47	5.20e-07	0.7658
1. PBF	Q6HDK6	Protein GrpE	0.00e+00	1.70e-41	5.54e-09	0.8207
1. PBF	Q7VVY0	Protein GrpE	1.23e-13	7.38e-38	6.05e-13	0.5298
1. PBF	A9BNG4	Protein GrpE	1.69e-13	2.96e-33	2.18e-10	0.4514
1. PBF	Q9CGY9	Protein GrpE	1.43e-13	5.31e-36	7.86e-06	0.8584
1. PBF	B5Z9P1	Protein GrpE	0.00e+00	4.48e-50	1.44e-07	0.7922
1. PBF	B2IDD9	Protein GrpE	9.21e-15	7.28e-44	9.60e-07	0.7889
1. PBF	Q1MMC9	Protein GrpE	1.54e-13	3.70e-21	1.22e-09	0.8716
1. PBF	B6JCI1	Protein GrpE	1.11e-16	2.59e-42	1.68e-11	0.8469
1. PBF	A4XYF7	Protein GrpE	0.00e+00	9.83e-21	7.73e-07	0.7964
1. PBF	Q5NFG6	Protein GrpE	1.11e-16	4.53e-48	1.24e-07	0.9038
1. PBF	Q9KD73	Protein GrpE	0.00e+00	2.38e-36	9.45e-14	0.8879
1. PBF	B0UT70	Protein GrpE	0.00e+00	8.85e-43	1.53e-15	0.8196
1. PBF	A1JKI6	Protein GrpE	4.44e-16	1.70e-31	9.75e-06	0.8345
1. PBF	Q9PQ83	Protein GrpE	0.00e+00	4.83e-51	1.48e-08	0.6385
1. PBF	B1JG65	Protein GrpE	1.11e-16	1.57e-37	2.53e-04	0.7968
1. PBF	A0KZB0	Protein GrpE	0.00e+00	7.20e-32	0.001	0.7958
1. PBF	C3LTA4	Protein GrpE	1.24e-14	8.71e-41	1.33e-09	0.8716
1. PBF	Q4ZNP6	Protein GrpE	0.00e+00	2.61e-19	1.66e-04	0.8406
1. PBF	A6U5E2	Protein GrpE	3.89e-13	3.10e-25	1.43e-09	0.8763
1. PBF	B7NSB2	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9079
1. PBF	B5FA13	Protein GrpE	0.00e+00	3.02e-36	8.70e-10	0.6507
1. PBF	Q2Y6T9	Protein GrpE	2.78e-15	4.92e-47	1.68e-10	0.5072
1. PBF	Q21X08	Protein GrpE	1.13e-12	1.29e-40	1.41e-05	0.5053
1. PBF	Q8KML7	Protein GrpE	0.00e+00	1.02e-42	1.89e-14	0.7884
1. PBF	A9ILE9	Protein GrpE	4.22e-15	2.18e-37	1.26e-08	0.8091
1. PBF	Q2YT46	Protein GrpE	1.22e-15	4.31e-40	4.63e-08	0.7919
1. PBF	Q2NK66	Protein GrpE	1.11e-16	2.23e-45	3.12e-15	0.7611
1. PBF	A7HZ43	Protein GrpE	2.49e-14	1.28e-28	1.51e-15	0.9045
1. PBF	Q47XI4	Protein GrpE	0.00e+00	3.87e-39	4.13e-05	0.804
1. PBF	Q03MR7	Protein GrpE	5.02e-13	1.20e-29	1.25e-04	0.7104
1. PBF	A1WX32	Protein GrpE	2.03e-11	6.95e-34	6.36e-11	0.5131
1. PBF	Q6GGB9	Protein GrpE	0.00e+00	6.41e-37	5.01e-08	0.8082
1. PBF	Q6IT00	Protein GrpE	0.00e+00	2.17e-44	4.23e-10	0.6403
1. PBF	Q3IKR2	Protein GrpE	0.00e+00	3.12e-45	1.21e-06	0.838
1. PBF	Q9KJU0	Protein GrpE	0.00e+00	5.54e-27	4.18e-13	0.9396
1. PBF	A8Z4C0	Protein GrpE	2.22e-16	6.41e-37	5.01e-08	0.8132
1. PBF	B4RNG7	Protein GrpE	5.16e-11	1.08e-37	9.12e-14	0.5084
1. PBF	A5ITA9	Protein GrpE	7.77e-16	7.89e-38	5.21e-08	0.7918
1. PBF	A7GT09	Protein GrpE	0.00e+00	2.61e-40	1.54e-10	0.7237
1. PBF	Q0HSW5	Protein GrpE	0.00e+00	1.41e-36	0.002	0.7962
1. PBF	A7X2Y2	Protein GrpE	1.11e-16	7.89e-38	5.21e-08	0.8078
1. PBF	B1XRU2	Protein GrpE	3.25e-14	9.01e-38	1.23e-10	0.5266
1. PBF	Q9ZCT4	Protein GrpE	0.00e+00	3.69e-31	6.14e-14	0.8941
1. PBF	Q04Y46	Protein GrpE	0.00e+00	1.37e-37	1.77e-07	0.6045
1. PBF	A8G203	Protein GrpE	0.00e+00	6.63e-25	1.65e-04	0.7835
1. PBF	B4F059	Protein GrpE	0.00e+00	5.48e-46	3.32e-08	0.8734
1. PBF	Q465Y5	Protein GrpE	7.69e-11	1.51e-40	7.82e-08	0.5055
1. PBF	B8IJD7	Protein GrpE	0.00e+00	1.69e-09	6.63e-10	0.8738
1. PBF	B7LDK2	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9067
1. PBF	Q7VRQ6	Protein GrpE	0.00e+00	3.69e-53	6.65e-07	0.7482
1. PBF	Q31DG8	Protein GrpE	0.00e+00	6.27e-25	1.32e-05	0.7962
1. PBF	Q824B1	Protein GrpE	0.00e+00	2.82e-20	2.91e-13	0.7947
1. PBF	B4T2B9	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7243
1. PBF	Q634M6	Protein GrpE	0.00e+00	1.70e-41	5.54e-09	0.8521
1. PBF	Q8YEV0	Protein GrpE	0.00e+00	1.15e-33	1.11e-08	0.8976
1. PBF	A5VJE6	Protein GrpE	0.00e+00	6.87e-49	1.42e-10	0.8531
1. PBF	B7IYG8	Protein GrpE	0.00e+00	1.78e-41	3.97e-09	0.7791
1. PBF	Q8FEY9	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8941
1. PBF	A9GHU4	Protein GrpE	1.26e-11	3.99e-30	1.09e-06	0.5562
1. PBF	Q182F1	Protein GrpE	4.44e-16	1.23e-37	0.002	0.7724
1. PBF	B5QUG9	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7239
1. PBF	Q68WA8	Protein GrpE	0.00e+00	6.07e-30	1.88e-13	0.8754
1. PBF	A7H485	Protein GrpE	0.00e+00	5.42e-39	1.71e-08	0.7582
1. PBF	Q8PAL0	Protein GrpE	2.89e-14	1.97e-32	0.035	0.7416
1. PBF	Q1QSW9	Protein GrpE	2.04e-14	1.58e-34	8.35e-04	0.8354
1. PBF	A8FFD3	Protein GrpE	0.00e+00	7.77e-39	1.55e-09	0.7485
1. PBF	Q2KD99	Protein GrpE	2.28e-14	3.93e-22	1.09e-09	0.8809
1. PBF	Q73GX9	Protein GrpE	0.00e+00	1.48e-41	9.26e-08	0.7587
1. PBF	B6EKA3	Protein GrpE	0.00e+00	1.35e-41	7.86e-06	0.7097
1. PBF	Q14GW8	Protein GrpE	3.33e-16	4.53e-48	1.24e-07	0.9047
1. PBF	B3PZA4	Protein GrpE	1.65e-13	1.95e-22	1.12e-09	0.8749
1. PBF	Q0TEM6	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8947
1. PBF	Q03WI1	Protein GrpE	1.51e-14	2.21e-43	4.30e-15	0.8326
1. PBF	Q9KWS8	Protein GrpE	0.00e+00	1.32e-29	1.68e-13	0.8744
1. PBF	B7KLH9	Protein GrpE	7.30e-12	9.81e-27	0.026	0.7461
1. PBF	A7MHW7	Protein GrpE	0.00e+00	3.48e-41	2.22e-05	0.7271
1. PBF	Q8E7Q8	Protein GrpE	2.87e-13	2.39e-45	0.004	0.8816
1. PBF	B5ZMX0	Protein GrpE	1.58e-10	3.45e-21	1.45e-08	0.8677
1. PBF	Q8DF59	Protein GrpE	4.53e-12	1.72e-16	8.29e-05	0.7009
1. PBF	B3EPC6	Protein GrpE	1.93e-14	1.97e-49	1.69e-04	0.7476
1. PBF	A5IIT3	Protein GrpE	6.76e-14	1.18e-03	5.52e-09	0.7515
1. PBF	Q07US4	Protein GrpE	3.34e-14	1.18e-19	9.42e-08	0.8949
1. PBF	Q7CPZ4	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7297
1. PBF	B4S9D1	Protein GrpE	2.22e-16	6.38e-49	0.032	0.8137
1. PBF	Q92SK0	Protein GrpE	8.98e-14	3.83e-26	9.48e-10	0.8818
1. PBF	P43732	Protein GrpE	0.00e+00	2.96e-41	1.48e-14	0.7848
1. PBF	A6Q422	Protein GrpE	2.22e-16	2.98e-34	8.92e-08	0.4772
1. PBF	Q74IT5	Protein GrpE	0.00e+00	3.50e-49	8.37e-10	0.8099
1. PBF	A1VMG3	Protein GrpE	6.66e-16	1.07e-39	2.43e-08	0.5223
1. PBF	B3E7X0	Protein GrpE	0.00e+00	2.71e-36	4.49e-09	0.8848
1. PBF	Q7MA34	Protein GrpE	9.99e-15	3.23e-39	4.05e-10	0.7982
1. PBF	Q70WY9	Protein GrpE	7.72e-14	8.54e-36	1.75e-08	0.5031
1. PBF	Q6G1E4	Protein GrpE	2.22e-16	8.25e-43	7.56e-10	0.805
1. PBF	A8GW24	Protein GrpE	0.00e+00	3.99e-30	1.48e-11	0.8819
1. PBF	Q8L399	Protein GrpE	0.00e+00	2.78e-31	1.31e-15	0.8852
1. PBF	Q5PFG9	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7248
1. PBF	B2URT9	Protein GrpE	6.99e-15	5.48e-46	1.77e-07	0.6823
1. PBF	Q8GH80	Protein GrpE	0.00e+00	3.58e-17	2.16e-13	0.8172
1. PBF	P63189	Protein GrpE	0.00e+00	7.89e-38	5.21e-08	0.8082
1. PBF	A1KSH0	Protein GrpE	6.40e-11	1.08e-37	9.12e-14	0.5026
1. PBF	Q5XAD5	Protein GrpE	7.00e-13	2.99e-46	0.004	0.8831
1. PBF	Q5E3A5	Protein GrpE	0.00e+00	3.22e-36	2.18e-09	0.6465
1. PBF	A3NYX9	Protein GrpE	3.87e-13	1.54e-36	2.24e-13	0.4666
1. PBF	B9DNK1	Protein GrpE	0.00e+00	1.51e-40	9.17e-09	0.827
1. PBF	A3MNA1	Protein GrpE	1.19e-12	1.54e-36	2.24e-13	0.4729
1. PBF	B4TE57	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7266
1. PBF	B8ET77	Protein GrpE	0.00e+00	2.36e-34	4.67e-08	0.7676
1. PBF	A1UUC9	Protein GrpE	0.00e+00	5.86e-42	5.94e-06	0.7463
1. PBF	Q1CV45	Protein GrpE	1.78e-15	8.82e-48	6.83e-08	0.7499
1. PBF	A5GDC7	Protein GrpE	2.54e-14	4.64e-44	3.55e-09	0.4957
1. PBF	B0BC30	Protein GrpE	0.00e+00	1.09e-20	2.76e-16	0.8352
1. PBF	A4IX27	Protein GrpE	0.00e+00	4.53e-48	1.24e-07	0.9056
1. PBF	Q8D392	Protein GrpE	0.00e+00	3.05e-42	0.001	0.7149
1. PBF	Q79V15	Protein GrpE	1.52e-14	1.41e-24	2.59e-07	0.8938
1. PBF	P15874	Protein GrpE	0.00e+00	5.26e-37	1.24e-11	0.6425
1. PBF	B7UH62	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9128
1. PBF	A1S8D5	Protein GrpE	0.00e+00	2.97e-37	0.002	0.7829
1. PBF	O69267	Protein GrpE	0.00e+00	1.79e-45	3.43e-06	0.6608
1. PBF	A9KG91	Protein GrpE	0.00e+00	1.24e-52	1.31e-10	0.7788
1. PBF	B4EDZ4	Protein GrpE	2.41e-13	5.55e-35	4.51e-12	0.4785
1. PBF	Q1LPN6	Protein GrpE	6.64e-12	1.10e-37	6.04e-08	0.4943
1. PBF	Q730M0	Protein GrpE	0.00e+00	2.24e-41	5.16e-12	0.711
1. PBF	Q3KIA1	Protein GrpE	0.00e+00	1.82e-21	2.02e-05	0.897
1. PBF	A8F851	Protein GrpE	1.56e-12	2.30e-15	0.002	0.3964
1. PBF	Q8RH07	Protein GrpE	4.08e-10	1.66e-38	3.66e-09	0.5703
1. PBF	Q8DJB3	Protein GrpE	2.44e-15	1.02e-29	6.43e-04	0.7806
1. PBF	B2VEC6	Protein GrpE	0.00e+00	4.82e-37	2.46e-05	0.7526
1. PBF	Q9ZMW3	Protein GrpE	0.00e+00	2.00e-48	5.54e-07	0.7351
1. PBF	B1LPC1	Protein GrpE	0.00e+00	8.33e-45	0.001	0.8837
1. PBF	Q98GQ5	Protein GrpE	2.22e-16	1.05e-17	4.77e-09	0.8196
1. PBF	Q5H187	Protein GrpE	1.63e-14	6.82e-33	0.002	0.7466
1. PBF	Q8CP16	Protein GrpE	0.00e+00	2.52e-30	6.59e-04	0.7951
1. PBF	P57281	Protein GrpE 2	1.33e-15	1.99e-47	0.003	0.5975
1. PBF	Q39JD0	Protein GrpE	3.33e-13	4.58e-35	1.82e-12	0.4913
1. PBF	Q84BU5	Protein GrpE	0.00e+00	1.79e-53	1.07e-11	0.7933
1. PBF	Q12L25	Protein GrpE	0.00e+00	5.74e-37	8.07e-06	0.8279
1. PBF	B1IVM0	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9096
1. PBF	Q8L2F3	Protein GrpE	1.91e-12	4.97e-23	0.045	0.5062
1. PBF	Q2NS02	Protein GrpE	0.00e+00	9.01e-38	1.15e-06	0.7308
1. PBF	B7J283	Protein GrpE	1.39e-11	1.59e-41	1.10e-07	0.4
1. PBF	Q47HK1	Protein GrpE	3.55e-15	1.68e-39	2.04e-08	0.5453
1. PBF	P0CAV1	Protein GrpE	0.00e+00	4.22e-02	8.89e-08	0.8422
1. PBF	Q1IF60	Protein GrpE	0.00e+00	7.89e-18	1.37e-05	0.8658
1. PBF	A0B748	Protein GrpE	0.00e+00	8.33e-40	3.31e-05	0.8182
1. PBF	P63193	Protein GrpE	2.61e-13	2.99e-46	0.004	0.8846
1. PBF	P63187	Protein GrpE	1.49e-13	6.39e-16	2.37e-09	0.7472
1. PBF	A0LH27	Protein GrpE	0.00e+00	9.50e-49	3.38e-06	0.8972
1. PBF	P63188	Protein GrpE	5.87e-14	6.39e-16	2.37e-09	0.7479
1. PBF	A1V0U4	Protein GrpE	1.53e-13	1.54e-36	2.24e-13	0.416
1. PBF	P0DB49	Protein GrpE	2.59e-13	2.99e-46	0.004	0.8826
1. PBF	A2S567	Protein GrpE	2.64e-13	1.54e-36	2.24e-13	0.4464
1. PBF	Q6MT05	Protein GrpE	0.00e+00	3.93e-99	2.55e-121	0.9897
1. PBF	Q9LCQ6	Protein GrpE (Fragment)	4.78e-13	2.03e-40	1.35e-11	0.5321
1. PBF	Q7VIE2	Protein GrpE	0.00e+00	3.57e-44	1.43e-04	0.7074
1. PBF	A4SFR6	Protein GrpE	1.11e-16	1.02e-48	0.002	0.8367
1. PBF	A5EYG2	Protein GrpE	0.00e+00	3.30e-46	3.00e-11	0.7481
1. PBF	Q1CFL2	Protein GrpE	5.55e-16	3.87e-37	2.97e-04	0.7992
1. PBF	B2SQU5	Protein GrpE	6.83e-14	6.82e-33	0.002	0.7509
1. PBF	A4G8D3	Protein GrpE	3.33e-16	3.32e-34	1.58e-07	0.4898
1. PBF	C3PP76	Protein GrpE	0.00e+00	2.63e-32	7.80e-14	0.8474
1. PBF	Q3BVB9	Protein GrpE	1.11e-16	5.87e-34	0.002	0.7437
1. PBF	Q7VMB7	Protein GrpE	0.00e+00	4.70e-43	1.84e-09	0.8796
1. PBF	A3CQC3	Protein GrpE	1.11e-16	1.97e-39	7.81e-05	0.8778
1. PBF	B0TYF1	Protein GrpE	1.11e-16	5.13e-48	6.70e-08	0.8486
1. PBF	B5RD90	Protein GrpE	0.00e+00	3.87e-45	2.19e-04	0.7283
1. PBF	Q6MB27	Protein GrpE	1.33e-15	7.97e-37	9.69e-17	0.885
1. PBF	B2FMY4	Protein GrpE	0.00e+00	3.14e-31	0.003	0.7157
1. PBF	Q3MG83	Protein GrpE	2.89e-15	1.18e-33	0.024	0.792
1. PBF	Q2NE66	Protein GrpE	7.77e-16	6.61e-38	8.05e-07	0.8667
1. PBF	Q6BTP9	GrpE protein homolog, mitochondrial	0.00e+00	1.11e-17	1.34e-04	0.7667
1. PBF	B0CJ30	Protein GrpE	0.00e+00	1.54e-36	1.14e-08	0.8898
1. PBF	Q3B2T4	Protein GrpE	0.00e+00	2.29e-49	6.66e-06	0.8028
1. PBF	Q04VC9	Protein GrpE	0.00e+00	1.37e-37	1.77e-07	0.6015
1. PBF	B1Y785	Protein GrpE	2.10e-13	2.57e-34	5.72e-09	0.5233
1. PBF	Q39PT6	Protein GrpE	0.00e+00	6.68e-43	5.52e-07	0.7821
1. PBF	B0SRF2	Protein GrpE	1.33e-15	2.00e-36	3.88e-06	0.7469
1. PBF	A5IDK9	Protein GrpE	2.98e-14	4.53e-48	2.52e-04	0.9172
1. PBF	Q9PB04	Protein GrpE	2.71e-14	2.07e-33	0.002	0.7535
1. PBF	C1CQ17	Protein GrpE	5.04e-13	8.06e-33	0.004	0.8863
1. PBF	Q9HV42	Protein GrpE	0.00e+00	1.84e-20	4.23e-09	0.8829
1. PBF	C1F924	Protein GrpE	6.32e-12	3.08e-43	1.93e-08	0.4375
1. PBF	O30862	Protein GrpE	6.00e-15	8.71e-41	1.33e-09	0.8812
1. PBF	B2SXC5	Protein GrpE	2.72e-14	1.71e-36	3.06e-11	0.5316
1. PBF	A9B9L4	Protein GrpE	0.00e+00	4.67e-25	9.88e-05	0.8555
1. PBF	A9IGC0	Protein GrpE	5.55e-16	9.07e-35	1.29e-11	0.5073
1. PBF	O08384	Protein GrpE	3.00e-15	9.45e-44	1.94e-11	0.4879
1. PBF	Q7DDM9	Protein GrpE	9.92e-11	1.08e-37	9.12e-14	0.5098
1. PBF	B9JZG5	Protein GrpE	0.00e+00	3.47e-25	9.57e-10	0.7397
1. PBF	Q4L6T1	Protein GrpE	0.00e+00	3.89e-33	1.34e-05	0.8675
1. PBF	Q13E58	Protein GrpE	5.86e-14	1.31e-20	4.50e-09	0.8613
1. PBF	Q9WZV4	Protein GrpE	6.34e-14	1.22e-03	3.72e-09	0.7581
1. PBF	Q88VL9	Protein GrpE	3.33e-16	1.34e-39	8.83e-14	0.8952
1. PBF	Q8XW36	Protein GrpE	2.15e-14	8.90e-37	1.17e-08	0.5362
1. PBF	B2V8C9	Protein GrpE	3.08e-09	4.78e-53	2.99e-06	0.4791
1. PBF	Q5ZTY2	Protein GrpE	1.09e-11	1.16e-47	2.93e-04	0.9076
1. PBF	Q7ABI1	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9098
1. PBF	Q2SYZ6	Protein GrpE	8.99e-15	9.95e-34	1.61e-13	0.4352
1. PBF	Q8CWT4	Protein GrpE	2.58e-13	7.82e-32	0.004	0.8886
1. PBF	Q0A7E2	Protein GrpE	1.63e-12	4.19e-34	1.46e-09	0.4943
1. PBF	Q492C7	Protein GrpE	0.00e+00	6.95e-52	3.83e-08	0.6928
1. PBF	Q63R45	Protein GrpE	2.52e-14	1.54e-36	2.24e-13	0.4161
1. PBF	Q30Q11	Protein GrpE	9.99e-16	3.28e-40	6.92e-08	0.4516
1. PBF	Q8XIT0	Protein GrpE	2.58e-12	3.30e-43	8.82e-09	0.5432
1. PBF	Q4KIH2	Protein GrpE	0.00e+00	1.92e-21	1.53e-05	0.8616
1. PBF	Q2A329	Protein GrpE	0.00e+00	9.98e-49	4.07e-08	0.907
1. PBF	B3H0M9	Protein GrpE	0.00e+00	2.55e-40	4.68e-10	0.8305
1. PBF	B2GBQ4	Protein GrpE	0.00e+00	1.44e-50	1.31e-13	0.8553
1. PBF	Q2KW99	Protein GrpE	1.11e-15	9.60e-32	1.09e-12	0.5424
1. PBF	Q7WGI2	Protein GrpE	5.33e-15	7.38e-38	6.05e-13	0.5095
1. PBF	B9MDJ6	Protein GrpE	5.81e-14	2.74e-32	8.56e-11	0.4938
1. PBF	O32481	Protein GrpE	8.66e-15	5.96e-45	2.99e-04	0.9265
1. PBF	A7GXU2	Protein GrpE	0.00e+00	1.20e-37	2.88e-12	0.8631
1. PBF	A5UM85	Protein GrpE	1.11e-13	6.34e-46	3.30e-04	0.4932
1. PBF	P71499	Protein GrpE	0.00e+00	1.24e-98	4.04e-121	0.8683
1. PBF	B0R3H6	Protein GrpE	2.54e-14	3.29e-33	0.022	0.7599
1. PBF	Q07ZD3	Protein GrpE	0.00e+00	4.27e-36	2.39e-05	0.8834
1. PBF	Q66DA8	Protein GrpE	4.44e-16	1.57e-37	2.53e-04	0.797
1. PBF	P57340	Protein GrpE 1	2.68e-12	4.86e-44	0.049	0.7052
1. PBF	Q5WV14	Protein GrpE	3.53e-12	9.04e-49	2.72e-04	0.9112
1. PBF	B1IA51	Protein GrpE	3.67e-13	8.06e-33	0.004	0.8893
1. PBF	Q3KLV8	Protein GrpE	0.00e+00	8.55e-20	1.80e-13	0.835
1. PBF	A5GHN3	Protein GrpE	5.55e-16	5.17e-20	4.26e-04	0.7826
1. PBF	B2SGV9	Protein GrpE	0.00e+00	6.72e-51	2.21e-08	0.9063
1. PBF	C6D9J8	Protein GrpE	0.00e+00	8.25e-38	5.48e-06	0.9071
1. PBF	O27350	Protein GrpE	6.55e-10	1.83e-37	3.05e-06	0.4155
1. PBF	Q8E299	Protein GrpE	1.82e-13	2.39e-45	0.004	0.8821
1. PBF	C3K276	Protein GrpE	0.00e+00	3.35e-19	3.91e-06	0.8881
1. PBF	B7GKC7	Protein GrpE	0.00e+00	1.62e-41	1.28e-09	0.6639
1. PBF	Q3SW78	Protein GrpE	2.11e-15	1.55e-33	8.16e-12	0.8611
1. PBF	B3CPX8	Protein GrpE	0.00e+00	8.33e-37	2.02e-05	0.7733
1. PBF	Q5F6X1	Protein GrpE	8.14e-11	3.17e-38	4.85e-14	0.5102
1. PBF	C1CJ05	Protein GrpE	0.00e+00	8.06e-33	0.004	0.8846
1. PBF	Q1MPH5	Protein GrpE	2.79e-13	1.78e-29	7.09e-04	0.8127
1. PBF	Q661A2	Protein GrpE	1.93e-13	1.00e-40	1.50e-07	0.3677
1. PBF	A8MG50	Protein GrpE	0.00e+00	2.29e-46	1.04e-04	0.6693
1. PBF	B7M983	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9095
1. PBF	Q2GHU0	Protein GrpE	0.00e+00	3.01e-55	1.84e-07	0.8287
1. PBF	A4VZB4	Protein GrpE	1.11e-16	2.13e-29	1.49e-07	0.8651
1. PBF	A6U253	Protein GrpE	1.11e-16	7.89e-38	5.21e-08	0.7948
1. PBF	A1WAR5	Protein GrpE	6.73e-14	9.41e-32	1.16e-10	0.4714
1. PBF	Q62HD3	Protein GrpE	3.86e-13	1.54e-36	2.24e-13	0.4622
1. PBF	Q8KCD7	Protein GrpE	0.00e+00	8.69e-42	3.46e-04	0.8952
1. PBF	C1C5N6	Protein GrpE	9.87e-14	8.06e-33	0.004	0.8893
1. PBF	B1MZG7	Protein GrpE	4.44e-16	2.27e-44	1.18e-15	0.8995
1. PBF	B0SHT2	Protein GrpE	7.77e-16	2.00e-36	3.88e-06	0.7508
1. PBF	Q89AN1	Protein GrpE 1	5.53e-14	1.79e-51	0.047	0.8824
1. PBF	A2BZB9	Protein GrpE	0.00e+00	6.86e-26	0.016	0.8409
1. PBF	Q04EE0	Protein GrpE	1.22e-11	2.67e-43	2.21e-10	0.9175
1. PBF	P61445	Protein GrpE	5.55e-16	8.50e-39	2.72e-08	0.7131
1. PBF	Q8TQR3	Protein GrpE	5.43e-14	3.25e-47	7.90e-08	0.5761
1. PBF	A8EWT7	Protein GrpE	6.66e-16	4.33e-39	2.09e-11	0.4138
1. PBF	B0KIS6	Protein GrpE	0.00e+00	1.45e-17	2.74e-05	0.8454
1. PBF	Q7W517	Protein GrpE	4.00e-15	7.38e-38	6.05e-13	0.5055
1. PBF	G2K047	Protein GrpE	0.00e+00	6.28e-42	8.15e-13	0.6477
1. PBF	B7J7Y0	Protein GrpE	5.55e-12	6.63e-21	1.89e-09	0.4651
1. PBF	B8CS27	Protein GrpE	0.00e+00	1.12e-41	1.33e-04	0.7929
1. PBF	Q145F3	Protein GrpE	7.93e-13	2.80e-40	3.87e-11	0.4924
1. PBF	Q4UJN5	Protein GrpE	0.00e+00	6.02e-33	1.41e-13	0.838
1. PBF	A0AIS5	Protein GrpE	0.00e+00	2.51e-45	6.98e-13	0.646
1. PBF	B1AJ46	Protein GrpE	0.00e+00	4.83e-51	1.48e-08	0.6279
1. PBF	P78017	Protein GrpE	0.00e+00	1.38e-52	5.69e-10	0.7393
1. PBF	B4SSQ5	Protein GrpE	0.00e+00	1.85e-31	0.027	0.7185
1. PBF	Q7V3Q4	Protein GrpE	0.00e+00	1.42e-25	0.004	0.8133
1. PBF	B1LCI1	Protein GrpE	5.27e-14	4.21e-03	6.97e-09	0.7695
1. PBF	A4Y4W9	Protein GrpE	0.00e+00	6.55e-33	0.011	0.8039
1. PBF	B5BE99	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7248
1. PBF	Q0SRE2	Protein GrpE	1.93e-11	7.57e-45	8.99e-09	0.533
1. PBF	A4SZR9	Protein GrpE	5.84e-11	1.02e-38	1.47e-09	0.5352
1. PBF	Q6YPM0	Protein GrpE	5.55e-16	7.34e-36	1.18e-15	0.8954
1. PBF	Q6LUA8	Protein GrpE	2.55e-15	5.41e-38	9.14e-08	0.8808
1. PBF	A6QBG1	Protein GrpE	8.95e-13	9.92e-33	7.86e-11	0.532
1. PBF	B7MIV1	Protein GrpE	0.00e+00	1.52e-43	0.001	0.9077
1. PBF	A6VMQ9	Protein GrpE	4.77e-15	4.96e-39	1.74e-13	0.9129
1. PBF	A5VNA6	Protein GrpE	0.00e+00	1.70e-35	5.72e-08	0.89
1. PBF	Q72DW7	Protein GrpE	2.69e-13	7.27e-40	5.78e-05	0.9099
1. PBF	Q1BYX5	Protein GrpE	1.39e-13	1.10e-34	1.00e-11	0.4745
1. PBF	B2UBP7	Protein GrpE	4.90e-13	1.58e-33	4.08e-07	0.4594
1. PBF	A8EY32	Protein GrpE	0.00e+00	9.43e-26	3.03e-13	0.8442
1. PBF	B0TQ37	Protein GrpE	0.00e+00	2.16e-43	9.25e-05	0.7916
1. PBF	Q5X3M6	Protein GrpE	1.27e-13	1.44e-50	2.74e-04	0.9112
1. PBF	Q92GZ5	Protein GrpE	0.00e+00	2.63e-32	7.80e-14	0.8497
1. PBF	Q5P1H4	Protein GrpE	1.12e-14	5.80e-39	1.39e-04	0.5031
1. PBF	Q3IYI4	Protein GrpE	5.55e-16	1.62e-25	8.49e-18	0.9117
1. PBF	Q88DU1	Protein GrpE	0.00e+00	4.26e-17	3.17e-05	0.8567
1. PBF	A9AGC0	Protein GrpE	9.92e-13	1.79e-33	7.23e-12	0.4185
1. PBF	B6I635	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8951
1. PBF	Q7UA77	Protein GrpE	1.11e-16	2.28e-30	5.43e-05	0.8372
1. PBF	Q65H53	Protein GrpE	0.00e+00	3.69e-34	7.86e-12	0.6993
1. PBF	Q93R28	Protein GrpE	0.00e+00	3.31e-39	2.00e-10	0.8699
1. PBF	Q7UM95	Protein GrpE	0.00e+00	1.08e-36	3.91e-08	0.8073
1. PBF	P47443	Protein GrpE	0.00e+00	3.97e-49	5.81e-09	0.7841
1. PBF	B5Z231	Protein GrpE	0.00e+00	1.38e-44	0.001	0.8783
1. PBF	Q7NXI4	Protein GrpE	7.21e-12	8.70e-37	4.26e-10	0.5471
1. PBF	B8EAU9	Protein GrpE	0.00e+00	2.18e-32	0.046	0.8134
1. PBF	A4IR32	Protein GrpE	0.00e+00	4.40e-27	2.07e-13	0.877
1. PBF	B2K8E3	Protein GrpE	0.00e+00	1.57e-37	2.53e-04	0.7978
1. PBF	A9M7B6	Protein GrpE	0.00e+00	1.34e-35	1.21e-08	0.8908
1. PBF	Q2G6M5	Protein GrpE	3.22e-15	3.24e-37	2.85e-08	0.8438
1. PBF	Q5NRL4	Protein GrpE	2.30e-14	1.27e-30	5.09e-12	0.7736
1. PBF	A4VPQ6	Protein GrpE	0.00e+00	1.92e-21	4.00e-05	0.8481
1. PBF	A6LRN3	Protein GrpE	5.84e-13	1.72e-33	0.006	0.4578
1. PBF	Q74H60	Protein GrpE	9.92e-13	1.25e-48	4.07e-08	0.5122
1. PBF	A6WVA7	Protein GrpE	0.00e+00	9.33e-40	8.79e-12	0.8427
1. PBF	A2C5L7	Protein GrpE	0.00e+00	7.78e-22	0.002	0.8188
1. PBF	Q6F148	Protein GrpE	0.00e+00	5.46e-57	1.34e-49	0.8433
1. PBF	Q3AF09	Protein GrpE	5.18e-14	7.11e-44	5.38e-09	0.4961
1. PBF	A6VCL9	Protein GrpE	0.00e+00	2.30e-20	3.47e-09	0.8851
1. PBF	Q31HA8	Protein GrpE	0.00e+00	3.67e-36	4.70e-08	0.4295
1. PBF	Q5HV34	Protein GrpE	0.00e+00	8.12e-39	4.48e-10	0.9047
1. PBF	B7HCU1	Protein GrpE	0.00e+00	1.78e-41	3.97e-09	0.8111
1. PBF	Q04LY1	Protein GrpE	0.00e+00	7.82e-32	0.004	0.8841
1. PBF	Q3B0Y4	Protein GrpE	0.00e+00	3.40e-31	0.046	0.8321
1. PBF	Q128K3	Protein GrpE	3.42e-12	3.67e-36	1.73e-08	0.4901
1. PBF	C4ZYN1	Protein GrpE	0.00e+00	7.81e-44	0.001	0.8909
1. PBF	Q46I46	Protein GrpE	1.11e-16	3.22e-25	0.020	0.8383
1. PBF	Q473L4	Protein GrpE	1.35e-11	5.79e-36	4.88e-09	0.4967
1. PBF	P63191	Protein GrpE	0.00e+00	7.89e-38	5.21e-08	0.8031
1. PBF	Q1LSM6	Protein GrpE	0.00e+00	3.13e-48	1.83e-05	0.7067
1. PBF	O69297	Protein GrpE	0.00e+00	2.41e-39	5.69e-10	0.7564
1. PBF	B0BTB9	Protein GrpE	2.44e-15	3.51e-40	3.49e-10	0.7127
1. PBF	B7JN40	Protein GrpE	0.00e+00	1.70e-41	5.54e-09	0.7814
1. PBF	P0CW10	Protein GrpE	8.88e-12	1.52e-42	8.30e-08	0.5063
1. PBF	C0QX60	Protein GrpE	1.89e-15	7.89e-38	2.07e-04	0.6966
1. PBF	Q0HGL4	Protein GrpE	0.00e+00	4.61e-37	0.003	0.7978
1. PBF	Q3YSZ3	Protein GrpE	0.00e+00	2.69e-58	1.18e-08	0.7621
1. PBF	A4JBR9	Protein GrpE	7.95e-13	1.29e-36	2.33e-11	0.4808
1. PBF	Q89AS0	Protein GrpE 2	1.04e-07	3.43e-45	0.002	0.5569
1. PBF	A9KTL2	Protein GrpE	0.00e+00	2.18e-32	0.046	0.8065
1. PBF	Q5GSA3	Protein GrpE	0.00e+00	1.76e-47	3.20e-08	0.7222
1. PBF	B4SG55	Protein GrpE	2.33e-15	7.60e-50	1.13e-04	0.7996
1. PBF	O66745	Protein GrpE	3.33e-15	1.59e-19	1.36e-16	0.4632
1. PBF	B0B7W5	Protein GrpE	0.00e+00	2.11e-20	3.63e-16	0.8395
1. PBF	A8FYL1	Protein GrpE	0.00e+00	2.21e-43	5.41e-04	0.8109
1. PBF	Q607A4	Protein GrpE	4.11e-15	5.55e-39	1.34e-07	0.7449
1. PBF	Q3SZC1	GrpE protein homolog 1, mitochondrial	1.11e-16	1.01e-22	8.54e-07	0.7978
1. PBF	Q9HHC2	Protein GrpE	4.66e-15	6.34e-13	0.004	0.8196
1. PBF	Q6NCY6	Protein GrpE	0.00e+00	1.16e-21	2.64e-10	0.8689
1. PBF	O83245	Protein GrpE	2.46e-10	2.28e-40	5.60e-04	0.5618
1. PBF	Q6G563	Protein GrpE	1.11e-16	1.90e-40	2.94e-09	0.817
1. PBF	P0CW11	Protein GrpE	5.55e-16	1.52e-42	8.30e-08	0.8374
1. PBF	C1CCQ7	Protein GrpE	0.00e+00	8.06e-33	0.004	0.8882
1. PBF	A8GPC0	Protein GrpE	0.00e+00	1.58e-33	7.19e-15	0.7793
1. PBF	Q0BLK5	Protein GrpE	0.00e+00	4.28e-49	1.03e-07	0.9127
1. PBF	B2G6W2	Protein GrpE	0.00e+00	6.87e-49	1.42e-10	0.856
1. PBF	B2TYN5	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8926
1. PBF	P28609	Protein GrpE	1.79e-13	1.59e-41	1.10e-07	0.4042
1. PBF	B5ENA4	Protein GrpE	5.71e-12	6.63e-21	1.89e-09	0.4643
1. PBF	Q49Y23	Protein GrpE	0.00e+00	1.64e-29	1.09e-06	0.8625
1. PBF	B5EC43	Protein GrpE	1.11e-16	2.56e-44	2.87e-11	0.7876
1. PBF	B8FGS4	Protein GrpE	4.55e-15	2.32e-38	3.07e-11	0.4742
1. PBF	Q21H35	Protein GrpE	8.43e-12	1.72e-33	4.43e-07	0.5095
1. PBF	Q0TNS6	Protein GrpE	6.06e-12	4.59e-43	2.38e-08	0.5405
1. PBF	A1ANV1	Protein GrpE	0.00e+00	4.24e-39	4.58e-07	0.7876
1. PBF	B7VJW7	Protein GrpE	0.00e+00	2.23e-45	5.78e-10	0.8359
1. PBF	Q9JR00	Protein GrpE	6.57e-11	1.08e-37	9.12e-14	0.5084
1. PBF	O87776	Protein GrpE	2.55e-15	1.62e-41	8.24e-11	0.7234
1. PBF	Q81LS1	Protein GrpE	0.00e+00	1.70e-41	5.54e-09	0.7903
1. PBF	Q38W92	Protein GrpE	0.00e+00	1.07e-42	2.34e-12	0.7636
1. PBF	B8GNX0	Protein GrpE	4.15e-13	1.33e-34	3.19e-07	0.4748
1. PBF	C1KVC1	Protein GrpE	0.00e+00	4.69e-41	7.66e-13	0.6397
1. PBF	B9KAB8	Protein GrpE	4.18e-12	3.62e-07	3.87e-08	0.5694
1. PBF	P55970	Protein GrpE	4.00e-15	6.99e-46	2.56e-09	0.5059
1. PBF	A5V5Q2	Protein GrpE	0.00e+00	1.98e-30	7.78e-08	0.8942
1. PBF	A5W9A4	Protein GrpE	0.00e+00	5.32e-17	5.90e-05	0.8554
1. PBF	Q02FR0	Protein GrpE	0.00e+00	1.84e-20	4.23e-09	0.8857
1. PBF	Q6KIH8	Protein GrpE	0.00e+00	2.32e-30	8.64e-16	0.8469
1. PBF	P36424	Protein GrpE	0.00e+00	2.11e-20	3.63e-16	0.8371
1. PBF	Q03FR8	Protein GrpE	0.00e+00	6.47e-41	6.76e-09	0.767
1. PBF	Q8XEY8	Protein GrpE	0.00e+00	4.69e-45	1.83e-04	0.7234
1. PBF	P48204	Protein GrpE	0.00e+00	9.98e-49	4.07e-08	0.9074
1. PBF	O06941	Protein GrpE	1.78e-15	7.26e-39	3.52e-05	0.8147
1. PBF	Q3JP08	Protein GrpE	3.86e-13	1.54e-36	2.24e-13	0.4294
1. PBF	Q2J322	Protein GrpE	0.00e+00	3.60e-22	9.06e-10	0.8423
1. PBF	A3ND70	Protein GrpE	4.16e-13	1.54e-36	2.24e-13	0.474
1. PBF	P99086	Protein GrpE	2.00e-15	7.89e-38	5.21e-08	0.8064
1. PBF	Q5WHG2	Protein GrpE	0.00e+00	2.80e-34	1.21e-12	0.7758
1. PBF	Q7MN92	Protein GrpE	0.00e+00	3.63e-43	8.49e-10	0.8635
1. PBF	B2I6F7	Protein GrpE	4.02e-14	3.39e-34	0.003	0.7572
1. PBF	A1WGK0	Protein GrpE	2.66e-13	5.91e-36	5.27e-09	0.5302
1. PBF	Q3ANN0	Protein GrpE	0.00e+00	1.55e-23	0.004	0.8388
1. PBF	Q7CH40	Protein GrpE	4.44e-16	3.87e-37	2.97e-04	0.798
1. PBF	Q818E8	Protein GrpE	0.00e+00	1.78e-41	3.97e-09	0.8375
1. PBF	A4YJR1	Protein GrpE	3.12e-14	1.67e-20	1.30e-08	0.8961
1. PBF	B9KCH1	Protein GrpE	0.00e+00	2.61e-31	9.18e-11	0.8139
1. PBF	Q9Z849	Protein GrpE	0.00e+00	4.58e-25	1.92e-11	0.8176
1. PBF	Q6MGQ3	Protein GrpE	1.47e-14	2.21e-27	8.61e-09	0.5119
1. PBF	A1STE3	Protein GrpE	1.11e-16	2.19e-41	0.018	0.8952
1. PBF	Q253K2	Protein GrpE	0.00e+00	7.92e-22	3.26e-13	0.8133
1. PBF	Q0AIY2	Protein GrpE	3.02e-12	9.10e-42	2.58e-10	0.4695
1. PBF	Q48E61	Protein GrpE	0.00e+00	2.36e-19	3.85e-05	0.8321
1. PBF	A7ZEB6	Protein GrpE	0.00e+00	2.38e-40	9.97e-14	0.8404
1. PBF	Q8EGS0	Protein GrpE	0.00e+00	9.80e-32	0.001	0.7913
1. PBF	Q6CRQ1	GrpE protein homolog, mitochondrial	0.00e+00	3.86e-13	0.001	0.7624
1. PBF	B0T367	Protein GrpE	0.00e+00	4.91e-04	1.01e-08	0.83
1. PBF	A7NCM8	Protein GrpE	0.00e+00	9.98e-49	4.07e-08	0.9097
1. PBF	A9M2A3	Protein GrpE	8.21e-11	1.08e-37	9.12e-14	0.5115
1. PBF	A5F369	Protein GrpE	2.32e-14	8.71e-41	1.33e-09	0.882
1. PBF	B7N6J9	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8784
1. PBF	A1K4C6	Protein GrpE	6.55e-15	4.22e-37	3.64e-07	0.5183
1. PBF	A1TLI0	Protein GrpE	7.55e-15	1.78e-38	4.86e-11	0.4854
1. PBF	B8DE37	Protein GrpE	0.00e+00	5.42e-39	6.43e-13	0.7092
1. PBF	A6WL03	Protein GrpE	0.00e+00	2.18e-32	0.046	0.8063
1. PBF	C0R3M5	Protein GrpE	0.00e+00	7.92e-42	5.00e-07	0.7222
1. PBF	Q87WN9	Protein GrpE	0.00e+00	4.29e-19	6.02e-05	0.8347
1. PBF	B3Q970	Protein GrpE	0.00e+00	4.69e-22	2.34e-10	0.8539
1. PBF	Q17VY3	Protein GrpE	2.42e-13	1.05e-45	1.05e-08	0.5285
1. PBF	Q8CXD2	Protein GrpE	0.00e+00	7.73e-33	2.16e-07	0.7589
1. PBF	A0KMI7	Protein GrpE	0.00e+00	2.00e-37	1.32e-05	0.853
1. PBF	Q8EUM5	Protein GrpE	0.00e+00	8.54e-36	1.70e-11	0.8403
1. PBF	Q049W5	Protein GrpE	0.00e+00	3.55e-46	6.69e-11	0.833
1. PBF	Q6FPH2	GrpE protein homolog, mitochondrial	1.19e-13	2.44e-15	0.006	0.7636
1. PBF	Q3K3T3	Protein GrpE	4.49e-11	2.85e-35	0.004	0.8872
1. PBF	P95333	Protein GrpE	6.18e-11	3.94e-17	7.34e-09	0.5087
1. PBF	P30726	Protein GrpE	2.22e-16	3.72e-41	1.75e-09	0.4565
1. PBF	A7ZQ54	Protein GrpE	0.00e+00	1.16e-44	0.001	0.8885
1. PBF	Q9HRY0	Protein GrpE	3.33e-16	3.29e-33	0.022	0.8144
1. PBF	Q5HNW5	Protein GrpE	0.00e+00	2.52e-30	6.59e-04	0.7958
1. PBF	Q835R8	Protein GrpE	0.00e+00	8.92e-40	1.33e-07	0.853
1. PBF	Q2NAJ5	Protein GrpE	2.22e-16	4.10e-46	7.68e-11	0.807
1. PBF	A3MZ85	Protein GrpE	9.99e-15	7.95e-41	3.49e-10	0.7972
1. PBF	B3R450	Protein GrpE	2.32e-13	8.92e-36	6.65e-09	0.4729
1. PBF	C6E644	Protein GrpE	0.00e+00	1.31e-47	1.11e-10	0.8031
1. PBF	A3PA63	Protein GrpE	0.00e+00	2.48e-24	0.006	0.7812
1. PBF	Q8G2Y6	Protein GrpE	0.00e+00	1.34e-35	1.21e-08	0.8883
1. PBF	A4VT28	Protein GrpE	0.00e+00	2.13e-29	1.49e-07	0.8733
1. PBF	P42369	Protein GrpE	0.00e+00	3.44e-36	2.91e-06	0.8636
1. PBF	Q73Q17	Protein GrpE	9.99e-16	1.25e-33	0.036	0.8313
1. PBF	B8ZLY8	Protein GrpE	3.82e-13	8.06e-33	0.004	0.8877
1. PBF	A9R2E4	Protein GrpE	1.44e-15	1.57e-37	2.53e-04	0.7936
1. PBF	Q892Q9	Protein GrpE	3.25e-14	4.53e-44	6.95e-08	0.4595
1. PBF	B6JPL1	Protein GrpE	7.88e-15	5.30e-47	5.94e-08	0.6946
1. PBF	Q2VYM5	Protein GrpE	0.00e+00	2.39e-28	3.03e-12	0.8673
1. PBF	B7MYA6	Protein GrpE	0.00e+00	1.52e-43	0.001	0.909
1. PBF	P0DB48	Protein GrpE	8.78e-13	2.99e-46	0.004	0.884
1. PBF	B1JW17	Protein GrpE	3.56e-12	1.10e-34	1.00e-11	0.4951
1. PBF	Q1AXX5	Protein GrpE	1.88e-09	1.10e-29	0.030	0.409
1. PBF	A8AVA7	Protein GrpE	1.29e-13	4.96e-39	2.46e-04	0.8765
1. PBF	Q7N1U7	Protein GrpE	1.22e-15	9.53e-42	4.47e-08	0.8459
1. PBF	Q8YUA7	Protein GrpE	3.22e-15	1.65e-34	0.022	0.7823
1. PBF	B5E231	Protein GrpE	0.00e+00	8.06e-33	0.004	0.8905
1. PBF	Q83C41	Protein GrpE	0.00e+00	2.26e-53	1.47e-10	0.7857
1. PBF	B2JGE4	Protein GrpE	5.82e-11	5.21e-33	7.31e-11	0.5043
1. PBF	Q92BN7	Protein GrpE	0.00e+00	1.78e-38	7.20e-13	0.705
1. PBF	A9N8H5	Protein GrpE	0.00e+00	2.26e-53	1.47e-10	0.7718
1. PBF	Q044B0	Protein GrpE	3.33e-16	1.32e-49	8.81e-10	0.8208
1. PBF	A6T227	Protein GrpE	3.33e-16	5.55e-35	1.16e-07	0.5005
1. PBF	Q5KWZ6	Protein GrpE	0.00e+00	4.02e-35	2.33e-15	0.8858
1. PBF	Q59984	Protein GrpE	1.11e-15	2.25e-35	0.004	0.8273
1. PBF	A6QHC4	Protein GrpE	1.11e-15	6.41e-37	5.01e-08	0.8039
1. PBF	Q9L7Z3	Protein GrpE	0.00e+00	1.26e-37	1.83e-10	0.818
1. PBF	Q6D8X9	Protein GrpE	0.00e+00	3.70e-39	3.74e-06	0.9012
1. PBF	A3QGP0	Protein GrpE	0.00e+00	3.92e-36	8.91e-04	0.729
1. PBF	Q9CNU1	Protein GrpE	0.00e+00	5.90e-46	5.23e-13	0.7492
1. PBF	Q31XD2	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8908
1. PBF	A3D2B1	Protein GrpE	0.00e+00	2.18e-32	0.046	0.8035
1. PBF	A0K4S6	Protein GrpE	1.92e-13	1.10e-34	1.00e-11	0.4765
1. PBF	Q0BX02	Protein GrpE	4.44e-16	4.59e-33	1.26e-08	0.858
1. PBF	Q32CX5	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9086
1. PBF	B5Y9H0	Protein GrpE	1.17e-10	3.22e-29	0.002	0.6734
1. PBF	B7HPL4	Protein GrpE	0.00e+00	3.56e-41	2.37e-11	0.7049
1. PBF	Q3YYM5	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8866
1. PBF	A8GI40	Protein GrpE	0.00e+00	4.97e-36	1.60e-08	0.8229
1. PBF	Q5HFH9	Protein GrpE	7.77e-16	3.02e-39	4.63e-08	0.8079
1. PBF	Q59240	Protein GrpE	0.00e+00	9.97e-26	7.56e-15	0.693
1. PBF	Q1RIX7	Protein GrpE	0.00e+00	3.99e-30	1.48e-11	0.8637
1. PBF	C5BQ34	Protein GrpE	1.11e-16	3.16e-32	4.04e-06	0.4711
1. PBF	Q2P460	Protein GrpE	2.90e-14	6.82e-33	0.002	0.7463
1. PBF	Q97S73	Protein GrpE	0.00e+00	7.17e-35	0.003	0.889
1. PBF	Q87BS7	Protein GrpE	4.47e-14	3.39e-34	0.003	0.756
1. PBF	Q7C0D0	Protein GrpE	0.00e+00	7.45e-44	0.001	0.9072
1. PBF	Q5RA81	GrpE protein homolog 1, mitochondrial	0.00e+00	5.04e-21	4.08e-06	0.8008
1. PBF	Q15UD4	Protein GrpE	0.00e+00	4.75e-34	1.26e-04	0.9195
1. PBF	Q6A661	Protein GrpE	4.42e-08	5.75e-17	1.38e-05	0.7258
1. PBF	A1RLV4	Protein GrpE	0.00e+00	6.55e-33	0.011	0.808
1. PBF	Q1R8B1	Protein GrpE	0.00e+00	1.52e-43	0.001	0.9066
1. PBF	A0Q7F1	Protein GrpE	0.00e+00	4.83e-50	7.46e-08	0.9068
1. PBF	A1AXV2	Protein GrpE	2.66e-15	3.56e-41	0.048	0.454
1. PBF	A4TNU6	Protein GrpE	1.22e-15	1.57e-37	2.53e-04	0.794
1. PBF	B1XBT4	Protein GrpE	0.00e+00	7.81e-44	0.001	0.9047
1. PBF	A8A3C0	Protein GrpE	0.00e+00	7.45e-44	0.001	0.8881
1. PBF	Q1H3B7	Protein GrpE	7.84e-11	1.38e-40	1.89e-09	0.5188
1. PBF	A9KKU1	Protein GrpE	2.13e-12	1.53e-27	1.24e-07	0.9079
1. PBF	Q7V9C9	Protein GrpE	0.00e+00	4.14e-22	4.80e-04	0.8173
1. PBF	Q71ZJ6	Protein GrpE	0.00e+00	4.69e-41	7.66e-13	0.7089
1. PBF	A2BTV4	Protein GrpE	0.00e+00	1.15e-24	0.002	0.8031
1. PBF	Q0I2Y4	Protein GrpE	0.00e+00	8.85e-43	1.53e-15	0.8195
1. PBF	Q8RB69	Protein GrpE	7.69e-13	9.95e-43	1.39e-09	0.5694
1. PBF	B3QTT2	Protein GrpE	1.61e-14	1.83e-37	1.03e-08	0.8181
1. PBF	Q8K9R7	Protein GrpE 1	0.00e+00	1.43e-35	0.047	0.7362
1. PBF	A8H6X2	Protein GrpE	0.00e+00	1.04e-43	5.89e-04	0.7706
1. PBF	Q3SIN5	Protein GrpE	1.89e-15	6.18e-29	9.78e-09	0.5404
1. PBF	B1KQY9	Protein GrpE	0.00e+00	1.74e-41	5.46e-04	0.7787
1. PBF	C4K2U3	Protein GrpE	0.00e+00	2.63e-32	7.80e-14	0.826
1. PBF	B1YKS8	Protein GrpE	0.00e+00	3.65e-32	2.19e-08	0.9157
1. PBF	Q1CAG9	Protein GrpE	3.33e-16	3.87e-37	2.97e-04	0.7941
1. PBF	A9NFN7	Protein GrpE	0.00e+00	2.78e-31	1.31e-15	0.8631
1. PBF	Q2FGE2	Protein GrpE	2.22e-15	6.41e-37	5.01e-08	0.8068
2. PF	Q6F6N4	Protein GrpE	6.66e-16	7.72e-38	NA	0.8135
2. PF	B2RLI9	Protein GrpE	3.46e-12	6.17e-44	NA	0.5129
2. PF	Q114R5	Protein GrpE	2.22e-16	3.68e-40	NA	0.7696
2. PF	B7IBK6	Protein GrpE	1.98e-13	2.73e-40	NA	0.6158
2. PF	Q7VEJ7	Protein GrpE	0.00e+00	9.42e-22	NA	0.9005
2. PF	A1A3P4	Protein GrpE	1.31e-06	9.09e-23	NA	0.8141
2. PF	B7H316	Protein GrpE	8.66e-14	2.73e-40	NA	0.6068
2. PF	Q2JVR0	Protein GrpE	3.17e-13	2.29e-19	NA	0.8313
2. PF	Q73T78	Protein GrpE	9.11e-11	1.17e-13	NA	0.7262
2. PF	A6LBD8	Protein GrpE	2.03e-14	7.94e-39	NA	0.4728
2. PF	A3M8W8	Protein GrpE	2.97e-13	2.73e-40	NA	0.6126
2. PF	Q59978	Protein GrpE	1.20e-14	2.56e-33	NA	0.8372
2. PF	Q97BG7	Protein GrpE	0.00e+00	2.73e-43	NA	0.7486
2. PF	Q9L516	Protein GrpE	1.47e-12	9.27e-43	NA	0.8042
2. PF	B5XVJ9	Protein GrpE	0.00e+00	2.50e-44	NA	0.7581
2. PF	Q5LED3	Protein GrpE	1.94e-12	6.87e-49	NA	0.4524
2. PF	Q9CB23	Protein GrpE	5.33e-11	2.68e-11	NA	0.726
2. PF	Q05562	Protein GrpE	6.98e-10	4.85e-13	NA	0.7754
2. PF	Q3IUI1	Protein GrpE	1.81e-11	5.82e-25	NA	0.551
2. PF	B0V5U3	Protein GrpE	1.11e-13	2.73e-40	NA	0.6097
2. PF	Q75C01	GrpE protein homolog, mitochondrial	0.00e+00	5.28e-29	NA	0.8352
2. PF	Q5R435	GrpE protein homolog 2, mitochondrial	2.30e-12	7.01e-22	NA	0.7664
2. PF	B1VMF2	Protein GrpE	1.33e-13	2.24e-22	NA	0.8021
2. PF	B2HZZ8	Protein GrpE	2.59e-13	2.73e-40	NA	0.6132
2. PF	Q826F5	Protein GrpE 2	5.19e-07	5.37e-37	NA	0.5099
2. PF	B3QPW9	Protein GrpE	3.64e-14	7.05e-45	NA	0.8797
2. PF	B8DT61	Protein GrpE	1.86e-10	3.34e-21	NA	0.743
2. PF	Q83N75	Protein GrpE	6.55e-14	1.22e-34	NA	0.701
2. PF	Q82EX8	Protein GrpE 1	1.65e-10	4.01e-23	NA	0.7171
2. PF	A1KFH3	Protein GrpE	1.34e-07	3.62e-08	NA	0.7249
2. PF	Q2JH51	Protein GrpE	5.79e-12	8.14e-20	NA	0.8236
2. PF	Q72IK6	Protein GrpE	1.89e-14	1.16e-23	NA	0.471
2. PF	P9WMT4	Protein GrpE	1.36e-10	1.11e-07	NA	0.7287
2. PF	Q8K9V9	Protein GrpE 2	0.00e+00	1.04e-43	NA	0.6319
2. PF	Q6NEZ0	Protein GrpE	8.59e-07	7.10e-27	NA	0.6971
2. PF	Q7U272	Protein GrpE	1.46e-10	3.62e-08	NA	0.7286
2. PF	A6TCM1	Protein GrpE	0.00e+00	2.88e-44	NA	0.7671
2. PF	Q6AC77	Protein GrpE	4.60e-09	8.97e-29	NA	0.681
2. PF	Q7MU00	Protein GrpE	4.62e-12	2.67e-43	NA	0.5338
2. PF	Q9RY24	Protein GrpE	1.50e-11	4.31e-32	NA	0.5146
2. PF	A5TZ78	Protein GrpE	1.75e-07	1.11e-07	NA	0.7241
2. PF	Q64VI6	Protein GrpE	3.82e-12	6.87e-49	NA	0.4547
2. PF	Q8A8C4	Protein GrpE	1.55e-13	1.37e-45	NA	0.4328
2. PF	Q8G6W2	Protein GrpE	1.63e-08	6.39e-25	NA	0.7891
2. PF	C1AK27	Protein GrpE	1.36e-07	3.62e-08	NA	0.7266
2. PF	Q9HJ84	Protein GrpE	3.33e-16	5.41e-45	NA	0.5984
2. PF	Q0P5N5	GrpE protein homolog 2, mitochondrial	2.63e-13	3.57e-20	NA	0.5349
2. PF	Q83MQ1	Protein GrpE	2.54e-13	1.87e-34	NA	0.6999
2. PF	Q9P5U4	GrpE protein homolog, mitochondrial	0.00e+00	1.86e-16	NA	0.7329
2. PF	Q8FM79	Protein GrpE	1.49e-08	1.99e-17	NA	0.678
2. PF	Q56236	Protein GrpE	9.33e-15	1.10e-23	NA	0.4785
2. PF	Q6L0S8	Protein GrpE	0.00e+00	7.39e-26	NA	0.6502
3. BF	Q7NBE4	Protein GrpE	0.00e+00	NA	6.31e-09	0.685
4. PB	Q2FXZ1	Protein GrpE	2.22e-16	6.41e-37	5.01e-08	NA
4. PB	O43047	GrpE protein homolog, mitochondrial	0.00e+00	1.37e-23	0.026	NA
4. PB	Q9ZFC7	Protein GrpE	6.74e-13	4.85e-02	0.001	NA
4. PB	Q99LP6	GrpE protein homolog 1, mitochondrial	0.00e+00	6.22e-20	1.59e-07	NA
4. PB	P97576	GrpE protein homolog 1, mitochondrial	0.00e+00	2.10e-19	8.73e-08	NA
4. PB	Q8LB47	GrpE protein homolog 2, mitochondrial	1.97e-09	5.28e-06	0.042	NA
4. PB	P38523	GrpE protein homolog, mitochondrial	0.00e+00	3.95e-19	0.006	NA
4. PB	P09372	Protein GrpE	0.00e+00	7.81e-44	0.001	NA
4. PB	P48604	GrpE protein homolog, mitochondrial	0.00e+00	1.85e-24	1.30e-05	NA
4. PB	Q9HAV7	GrpE protein homolog 1, mitochondrial	0.00e+00	5.04e-21	4.08e-06	NA
5. P	Q9FLP3	GrpE protein homolog 1, mitochondrial	2.57e-09	8.27e-10	NA	NA
5. P	Q8TAA5	GrpE protein homolog 2, mitochondrial	2.77e-12	9.26e-22	NA	NA
5. P	Q6M259	Protein GrpE	5.19e-08	1.02e-27	NA	NA
5. P	B4S7A0	ATP synthase subunit b 1	3.00e-05	1.64e-02	NA	NA
5. P	P9WMT5	Protein GrpE	1.50e-07	1.11e-07	NA	NA
5. P	Q54QF9	GrpE protein homolog, mitochondrial	0.00e+00	2.77e-24	NA	NA
5. P	O88396	GrpE protein homolog 2, mitochondrial	7.11e-15	8.72e-21	NA	NA
5. P	Q18421	GrpE protein homolog, mitochondrial	1.14e-10	1.50e-20	NA	NA
5. P	B1MD16	Regulatory protein RecX	6.46e-03	2.11e-02	NA	NA
5. P	A4QHI9	Protein GrpE	5.82e-08	1.35e-28	NA	NA