Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54856.1
JCVISYN3A_0544

Heat-inducible transcription repressor.
M. mycoides homolog: Q6MT04.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 10
Unique PROST Go: 6
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 402
Unique PROST Homologs: 24
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 4

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: hrcA; Heat-inducible transcription repressor
Zhang et al. [4]: GO:0045892|negative regulation of transcription, DNA-templated
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q93R29 (Heat-inducible transcription repressor HrcA) with a FATCAT P-Value: 0 and RMSD of 3.23 angstrom. The sequence alignment identity is 30.9%.
Structural alignment shown in left. Query protein AVX54856.1 colored as red in alignment, homolog Q93R29 colored as blue. Query protein AVX54856.1 is also shown in right top, homolog Q93R29 showed in right bottom. They are colored based on secondary structures. 

  AVX54856.1 MLTNRQIKILQTIVEEFIKTN--QPVGSKRILELLNMKISSATIRNESATLEHEGYLEKQHTSSGRTPSTKGYRYYVDNIM---KLDSADYTRLKIYLNQ 95
      Q93R29 MLTQRQDNILHQIIHNY--TNLGKPIGSKTLME-EGIAASSATIRNEMKTLEEYGLLVKPHSSSGRIPSLKGYRYYVDYLLEPEKLKKSE---VDV-MQQ 93

  AVX54856.1 LL--DLRKYDIDKTINYASEIISELTKMTAVVIKKQNIKDIKLKKIELILLS--EFLASVLFIFSD-GDVQNKMFNL-KDVALSDL-KIAIKLFSDVLVD 188
      Q93R29 SLGKDF--HEINDIIEQSAKILSKLTSYTALSI-GPDVSNRKLTGFKMVPLNNRQVIA---IIVTDKGNVENQVFSIPKSVDSEDLEKM-VRIINDKLIG 186

  AVX54856.1 VKLDEIDQYLNDLKHQLSLSIKQY----DYVLNTFINTILESKNEQKETHG--MRYMLENPEFNDTNKLKNAVKLVEQLSPFDWFNIAYESNKNMN---- 278
      Q93R29 EPL--LIVY-QRLGTEIPMILHKYFQTTEGILDLF-NNMLSEAFEEKIFVGGQMN-LL-N---SD--QIQN----IDQFKSM----LFMENSKQLNELLS 267

  AVX54856.1 -K---IAIKIGNEIDQIND---DISMI-AT-ELK-IGNSSTVLTLVGPKRVDYNQVNQLMNLI-IEIINTKEN--------- 340
      Q93R29 TKDQPIQIRIGSELG--NDLLSDMSLIQANYEIKDHGN-GT-IALLGSASMPYSKMLSLLDVFRQELAETLDDYYRSIDSFG 345

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0003677 DNA binding
1. PBF GO:0045892 negative regulation of transcription, DNA-templated
1. PBF GO:0003700 DNA-binding transcription factor activity
4. PB GO:0005886 plasma membrane
5. P GO:2000142 regulation of DNA-templated transcription, initiation
5. P GO:0005988 lactose metabolic process
5. P GO:0005737 cytoplasm
5. P GO:0006004 fucose metabolic process
5. P GO:0030246 carbohydrate binding
5. P GO:0000986

Uniprot GO Annotations

GO Description
GO:0003677 DNA binding
GO:0045892 negative regulation of transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P0A3I8 Heat-inducible transcription repressor HrcA 3.27e-12 3.62e-23 2.45e-15 0.6745
1. PBF A5IIT2 Heat-inducible transcription repressor HrcA 3.39e-12 2.03e-48 3.73e-22 0.5937
1. PBF A5ITB0 Heat-inducible transcription repressor HrcA 3.72e-10 2.23e-61 6.30e-36 0.6493
1. PBF B9DNK2 Heat-inducible transcription repressor HrcA 5.40e-11 4.35e-56 9.69e-28 0.6554
1. PBF A5FPT3 Heat-inducible transcription repressor HrcA 6.34e-11 3.94e-52 1.30e-27 0.644
1. PBF Q82BY5 Heat-inducible transcription repressor HrcA 8.31e-13 1.82e-55 6.65e-27 0.6737
1. PBF Q82UK7 Heat-inducible transcription repressor HrcA 5.77e-15 6.52e-42 2.00e-31 0.6409
1. PBF Q634M5 Heat-inducible transcription repressor HrcA 8.88e-16 4.35e-56 4.45e-43 0.7082
1. PBF Q92BN6 Heat-inducible transcription repressor HrcA 0.00e+00 7.56e-57 6.54e-43 0.721
1. PBF Q1JA81 Heat-inducible transcription repressor HrcA 2.23e-11 4.02e-42 1.69e-24 0.7173
1. PBF P72795 Heat-inducible transcription repressor HrcA 3.54e-14 2.34e-45 1.13e-18 0.6756
1. PBF P68792 Heat-inducible transcription repressor HrcA 7.23e-10 2.23e-61 6.30e-36 0.6775
1. PBF C1C5N5 Heat-inducible transcription repressor HrcA 1.70e-11 2.24e-37 6.82e-20 0.7294
1. PBF A1VFG4 Heat-inducible transcription repressor HrcA 6.52e-11 9.27e-48 3.49e-22 0.7023
1. PBF B1MZG8 Heat-inducible transcription repressor HrcA 0.00e+00 6.29e-71 5.42e-36 0.793
1. PBF Q47HJ5 Heat-inducible transcription repressor HrcA 4.28e-13 2.56e-38 1.29e-27 0.7121
1. PBF B9LHR5 Heat-inducible transcription repressor HrcA 2.20e-11 1.03e-41 1.81e-30 0.677
1. PBF Q818E7 Heat-inducible transcription repressor HrcA 9.99e-16 1.10e-53 5.23e-44 0.7217
1. PBF P9WMK2 Heat-inducible transcription repressor HrcA 3.61e-11 7.20e-55 5.35e-29 0.6358
1. PBF B1YKS7 Heat-inducible transcription repressor HrcA 2.55e-15 1.67e-61 1.00e-43 0.6842
1. PBF B6JCI0 Heat-inducible transcription repressor HrcA 2.07e-12 1.31e-24 1.66e-19 0.7216
1. PBF Q8EPW3 Heat-inducible transcription repressor HrcA 2.22e-15 3.15e-59 3.04e-43 0.7228
1. PBF A9ILE7 Heat-inducible transcription repressor HrcA 2.71e-10 9.25e-25 1.07e-16 0.7357
1. PBF B4EDZ7 Heat-inducible transcription repressor HrcA 4.47e-14 5.12e-42 1.59e-24 0.7293
1. PBF Q1J576 Heat-inducible transcription repressor HrcA 5.02e-11 3.74e-42 1.51e-24 0.7167
1. PBF Q0SHB5 Heat-inducible transcription repressor HrcA 5.70e-12 1.81e-52 3.15e-28 0.6781
1. PBF Q6NG13 Heat-inducible transcription repressor HrcA 2.84e-11 2.17e-51 7.95e-26 0.6327
1. PBF B0SHT3 Heat-inducible transcription repressor HrcA 1.12e-13 1.72e-49 9.07e-21 0.7328
1. PBF Q8RH08 Heat-inducible transcription repressor HrcA 1.43e-10 2.86e-47 3.91e-19 0.6291
1. PBF P25499 Heat-inducible transcription repressor HrcA 2.22e-15 2.11e-51 1.23e-46 0.6952
1. PBF Q5WHG3 Heat-inducible transcription repressor HrcA 5.55e-16 2.35e-58 1.36e-43 0.6958
1. PBF A4SFR7 Heat-inducible transcription repressor HrcA 1.62e-10 1.18e-54 2.28e-27 0.6604
1. PBF A5E8J0 Heat-inducible transcription repressor HrcA 1.14e-10 3.37e-27 1.90e-21 0.6788
1. PBF P54306 Heat-inducible transcription repressor HrcA 1.56e-08 5.75e-24 2.88e-15 0.6551
1. PBF B5E230 Heat-inducible transcription repressor HrcA 3.62e-13 2.09e-37 2.29e-20 0.7311
1. PBF A3CQC4 Heat-inducible transcription repressor HrcA 2.55e-13 3.01e-38 6.31e-22 0.7364
1. PBF P0CAV3 Heat-inducible transcription repressor HrcA 0.00e+00 3.75e-25 5.75e-16 0.7824
1. PBF C1AUK7 Heat-inducible transcription repressor HrcA 5.47e-12 5.02e-52 4.06e-28 0.6855
1. PBF B4SG54 Heat-inducible transcription repressor HrcA 4.43e-14 7.69e-61 2.67e-30 0.6841
1. PBF A0AIS6 Heat-inducible transcription repressor HrcA 0.00e+00 1.43e-56 1.04e-43 0.7244
1. PBF A9M7B7 Heat-inducible transcription repressor HrcA 1.49e-07 2.03e-23 1.98e-18 0.4906
1. PBF C5CYY5 Heat-inducible transcription repressor HrcA 2.69e-13 1.54e-39 2.45e-24 0.6721
1. PBF P64396 Heat-inducible transcription repressor HrcA 7.98e-08 2.03e-23 1.98e-18 0.4858
1. PBF B0B7W4 Heat-inducible transcription repressor HrcA 1.54e-09 1.52e-24 1.65e-11 0.6406
1. PBF A9NFN6 Heat-inducible transcription repressor HrcA 0.00e+00 3.24e-59 1.35e-35 0.8181
1. PBF Q98R68 Heat-inducible transcription repressor HrcA 6.11e-15 5.95e-51 6.83e-33 0.6727
1. PBF Q182F0 Heat-inducible transcription repressor HrcA 3.77e-15 6.76e-65 3.53e-27 0.728
1. PBF Q7VVX7 Heat-inducible transcription repressor HrcA 0.00e+00 8.71e-29 2.24e-21 0.7973
1. PBF P64399 Heat-inducible transcription repressor HrcA 1.13e-12 7.20e-55 5.35e-29 0.7058
1. PBF Q8YPZ6 Heat-inducible transcription repressor HrcA 1.36e-13 2.56e-60 3.86e-25 0.6673
1. PBF B1AJ61 Heat-inducible transcription repressor HrcA 0.00e+00 9.54e-60 1.22e-37 0.6759
1. PBF Q9CGZ0 Heat-inducible transcription repressor HrcA 2.69e-13 2.53e-39 8.24e-22 0.7666
1. PBF B2I6F8 Heat-inducible transcription repressor HrcA 4.85e-13 6.17e-39 4.08e-24 0.6802
1. PBF B7HPL5 Heat-inducible transcription repressor HrcA 1.11e-15 3.89e-56 5.74e-43 0.7282
1. PBF A0R0T9 Heat-inducible transcription repressor HrcA 3.03e-12 1.51e-54 1.55e-28 0.6936
1. PBF Q8PMB2 Heat-inducible transcription repressor HrcA 3.87e-12 1.32e-33 1.57e-20 0.667
1. PBF B3EPC5 Heat-inducible transcription repressor HrcA 2.69e-13 1.13e-57 5.40e-28 0.681
1. PBF Q7NXL8 Heat-inducible transcription repressor HrcA 2.68e-13 2.44e-38 1.84e-26 0.7277
1. PBF B1I6D9 Heat-inducible transcription repressor HrcA 8.06e-14 7.56e-57 3.19e-33 0.6666
1. PBF B9L0E5 Heat-inducible transcription repressor HrcA 1.12e-13 8.69e-57 9.20e-17 0.7349
1. PBF C1CCQ6 Heat-inducible transcription repressor HrcA 2.23e-11 2.40e-37 1.94e-20 0.7281
1. PBF Q5XAD4 Heat-inducible transcription repressor HrcA 2.21e-11 3.74e-42 1.51e-24 0.7186
1. PBF Q5FRF2 Heat-inducible transcription repressor HrcA 5.30e-12 2.76e-26 1.13e-17 0.7202
1. PBF Q3AW12 Heat-inducible transcription repressor HrcA 0.00e+00 5.15e-52 2.81e-21 0.7289
1. PBF A7GT10 Heat-inducible transcription repressor HrcA 6.66e-16 1.39e-52 2.66e-43 0.6787
1. PBF Q835R9 Heat-inducible transcription repressor HrcA 0.00e+00 2.33e-54 1.72e-30 0.7474
1. PBF Q84BU6 Heat-inducible transcription repressor HrcA 0.00e+00 1.30e-58 8.15e-40 0.7819
1. PBF B5YH61 Heat-inducible transcription repressor HrcA 6.66e-16 5.27e-56 9.00e-21 0.7742
1. PBF B0K3Y2 Heat-inducible transcription repressor HrcA 2.66e-13 1.25e-61 2.55e-33 0.692
1. PBF B0C2W4 Heat-inducible transcription repressor HrcA 3.00e-14 2.61e-49 2.00e-22 0.7409
1. PBF B9J7U0 Heat-inducible transcription repressor HrcA 2.02e-14 7.35e-24 5.18e-15 0.7488
1. PBF A7X2Y4 Heat-inducible transcription repressor HrcA 5.79e-10 2.23e-61 6.30e-36 0.6764
1. PBF Q6G1E5 Heat-inducible transcription repressor HrcA 1.21e-11 1.90e-25 4.68e-16 0.6968
1. PBF A6QHC5 Heat-inducible transcription repressor HrcA 4.02e-11 2.50e-61 2.89e-35 0.6717
1. PBF Q31QM1 Heat-inducible transcription repressor HrcA 1.98e-14 3.85e-61 6.37e-23 0.6691
1. PBF A9BP03 Heat-inducible transcription repressor HrcA 0.00e+00 2.10e-39 2.44e-27 0.788
1. PBF Q2NAJ6 Heat-inducible transcription repressor HrcA 1.88e-14 1.43e-20 5.57e-20 0.7095
1. PBF B1LCI0 Heat-inducible transcription repressor HrcA 2.86e-12 8.85e-49 7.93e-22 0.5744
1. PBF Q8KML8 Heat-inducible transcription repressor HrcA 0.00e+00 3.01e-57 1.95e-36 0.7407
1. PBF Q3ZYU9 Heat-inducible transcription repressor HrcA 6.44e-11 3.94e-52 1.30e-27 0.6469
1. PBF Q1WUF0 Heat-inducible transcription repressor HrcA 0.00e+00 1.45e-60 8.30e-46 0.7725
1. PBF A5GWB6 Heat-inducible transcription repressor HrcA 2.93e-12 3.67e-48 6.31e-28 0.7164
1. PBF Q2Y6A9 Heat-inducible transcription repressor HrcA 2.54e-13 7.73e-42 2.66e-28 0.7157
1. PBF Q63R42 Heat-inducible transcription repressor HrcA 8.88e-15 3.79e-41 6.36e-25 0.7286
1. PBF Q9X4R2 Heat-inducible transcription repressor HrcA 1.77e-11 2.09e-37 2.29e-20 0.725
1. PBF A5U567 Heat-inducible transcription repressor HrcA 9.48e-13 7.20e-55 5.35e-29 0.702
1. PBF Q84B70 Heat-inducible transcription repressor HrcA 7.25e-13 3.70e-62 5.29e-24 0.7392
1. PBF B7JN41 Heat-inducible transcription repressor HrcA 1.11e-15 6.77e-59 7.08e-43 0.7215
1. PBF A0PTU2 Heat-inducible transcription repressor HrcA 6.77e-15 3.71e-53 2.02e-31 0.6945
1. PBF Q9RDD6 Heat-inducible transcription repressor HrcA 5.20e-12 4.64e-55 2.07e-27 0.6444
1. PBF Q49Y24 Heat-inducible transcription repressor HrcA 4.28e-10 6.46e-58 2.42e-26 0.6331
1. PBF Q3AF11 Heat-inducible transcription repressor HrcA 2.22e-16 5.89e-56 2.23e-37 0.7081
1. PBF Q7NBC5 Heat-inducible transcription repressor HrcA 0.00e+00 2.88e-66 7.58e-47 0.8285
1. PBF Q8GH81 Heat-inducible transcription repressor HrcA 6.76e-11 4.28e-23 1.08e-15 0.6222
1. PBF P0A3I9 Heat-inducible transcription repressor HrcA 2.71e-12 3.62e-23 2.45e-15 0.6841
1. PBF Q4JWP8 Heat-inducible transcription repressor HrcA 2.06e-10 3.22e-50 1.52e-24 0.6428
1. PBF Q730L9 Heat-inducible transcription repressor HrcA 9.99e-16 5.57e-56 3.80e-43 0.736
1. PBF Q2NK67 Heat-inducible transcription repressor HrcA 0.00e+00 3.06e-61 3.01e-27 0.8106
1. PBF B3PZA3 Heat-inducible transcription repressor HrcA 1.50e-12 9.05e-24 1.74e-16 0.7353
1. PBF C1AQT7 Heat-inducible transcription repressor HrcA 3.63e-13 7.20e-55 5.35e-29 0.6051
1. PBF B2JGE8 Heat-inducible transcription repressor HrcA 8.87e-14 3.52e-39 1.29e-22 0.7506
1. PBF C5C491 Heat-inducible transcription repressor HrcA 5.92e-14 6.04e-54 3.08e-24 0.6808
1. PBF Q1B6B7 Heat-inducible transcription repressor HrcA 6.85e-11 6.38e-54 5.02e-29 0.6704
1. PBF B1JW13 Heat-inducible transcription repressor HrcA 1.97e-14 2.71e-41 1.06e-24 0.7304
1. PBF A0LH26 Heat-inducible transcription repressor HrcA 3.00e-15 4.10e-51 1.50e-29 0.7077
1. PBF Q9F1W4 Heat-inducible transcription repressor HrcA 0.00e+00 3.41e-60 9.46e-53 0.7468
1. PBF B9IY83 Heat-inducible transcription repressor HrcA 1.33e-15 3.89e-56 5.74e-43 0.7229
1. PBF Q7W514 Heat-inducible transcription repressor HrcA 0.00e+00 8.71e-29 2.24e-21 0.7856
1. PBF P30727 Heat-inducible transcription repressor HrcA 2.11e-15 3.14e-48 4.82e-41 0.7052
1. PBF B1Y3N8 Heat-inducible transcription repressor HrcA 7.23e-10 7.27e-39 1.17e-23 0.6411
1. PBF B7GQV7 Heat-inducible transcription repressor HrcA 2.56e-11 4.21e-34 2.27e-21 0.6719
1. PBF Q8XIS9 Heat-inducible transcription repressor HrcA 3.55e-15 2.23e-61 7.35e-44 0.6825
1. PBF A0LSZ6 Heat-inducible transcription repressor HrcA 4.80e-11 1.13e-49 2.24e-27 0.5929
1. PBF B7GKC6 Heat-inducible transcription repressor HrcA 4.44e-16 1.78e-54 1.26e-48 0.7103
1. PBF B8H8R9 Heat-inducible transcription repressor HrcA 0.00e+00 1.43e-56 2.72e-24 0.7552
1. PBF A1BHL3 Heat-inducible transcription repressor HrcA 2.44e-14 4.05e-55 4.70e-32 0.7473
1. PBF Q04Y45 Heat-inducible transcription repressor HrcA 1.08e-14 1.69e-45 3.51e-19 0.6912
1. PBF A3MNA5 Heat-inducible transcription repressor HrcA 0.00e+00 3.79e-41 6.36e-25 0.7715
1. PBF B2SXB7 Heat-inducible transcription repressor HrcA 0.00e+00 1.47e-39 7.61e-23 0.7795
1. PBF Q2JRN9 Heat-inducible transcription repressor HrcA 1.72e-12 3.43e-43 1.06e-22 0.662
1. PBF C3P8M2 Heat-inducible transcription repressor HrcA 1.11e-15 5.10e-59 1.24e-42 0.729
1. PBF Q8XW26 Heat-inducible transcription repressor HrcA 1.57e-13 4.88e-39 2.43e-18 0.7225
1. PBF Q6G8Y5 Heat-inducible transcription repressor HrcA 2.39e-11 2.50e-61 2.89e-35 0.6698
1. PBF O52163 Heat-inducible transcription repressor HrcA 1.57e-11 5.41e-53 4.38e-24 0.6932
1. PBF B2HM80 Heat-inducible transcription repressor HrcA 6.00e-15 1.40e-53 1.49e-31 0.7184
1. PBF Q4A656 Heat-inducible transcription repressor HrcA 4.00e-15 1.71e-35 8.47e-20 0.6483
1. PBF Q5YZX1 Heat-inducible transcription repressor HrcA 2.22e-14 4.76e-52 2.34e-26 0.6848
1. PBF C4L427 Heat-inducible transcription repressor HrcA 0.00e+00 1.36e-61 1.09e-34 0.7497
1. PBF Q7NIB2 Heat-inducible transcription repressor HrcA 3.33e-15 4.17e-49 7.40e-23 0.6217
1. PBF Q03MR8 Heat-inducible transcription repressor HrcA 1.85e-11 5.49e-34 6.40e-22 0.7501
1. PBF P0DJM4 Heat-inducible transcription repressor HrcA 0.00e+00 2.77e-57 5.88e-43 0.7126
1. PBF Q2JJ73 Heat-inducible transcription repressor HrcA 3.35e-13 8.07e-43 1.31e-22 0.6035
1. PBF A6U5E1 Heat-inducible transcription repressor HrcA 2.46e-07 5.23e-27 1.86e-15 0.5
1. PBF Q2J323 Heat-inducible transcription repressor HrcA 1.44e-13 9.55e-28 3.53e-21 0.7171
1. PBF Q9CCN2 Heat-inducible transcription repressor HrcA 1.87e-10 3.61e-54 2.22e-30 0.6605
1. PBF A6U254 Heat-inducible transcription repressor HrcA 5.95e-10 2.23e-61 6.30e-36 0.6757
1. PBF Q3Z6N9 Heat-inducible transcription repressor HrcA 8.20e-11 7.28e-53 1.55e-28 0.6435
1. PBF Q6A998 Heat-inducible transcription repressor HrcA 3.68e-12 1.58e-60 2.61e-24 0.6316
1. PBF C1ESL0 Heat-inducible transcription repressor HrcA 4.44e-16 4.35e-56 4.45e-43 0.7024
1. PBF Q892Q8 Heat-inducible transcription repressor HrcA 1.22e-15 3.68e-56 1.43e-33 0.6569
1. PBF Q9WZV5 Heat-inducible transcription repressor HrcA 8.99e-13 8.19e-49 4.64e-22 0.6005
1. PBF Q1GWJ6 Heat-inducible transcription repressor HrcA 7.34e-14 7.36e-20 5.65e-19 0.7311
1. PBF Q3B2T3 Heat-inducible transcription repressor HrcA 1.65e-13 2.99e-55 8.79e-26 0.6943
1. PBF C3L5R9 Heat-inducible transcription repressor HrcA 1.22e-15 5.10e-59 1.24e-42 0.7211
1. PBF O69266 Heat-inducible transcription repressor HrcA 2.39e-13 1.90e-64 9.77e-51 0.7299
1. PBF C3PHU9 Heat-inducible transcription repressor HrcA 4.35e-11 1.22e-49 1.21e-24 0.6042
1. PBF A1KL64 Heat-inducible transcription repressor HrcA 3.03e-11 5.18e-55 5.35e-29 0.6872
1. PBF Q9PB03 Heat-inducible transcription repressor HrcA 8.86e-14 6.78e-39 4.63e-25 0.6579
1. PBF A4QFZ9 Heat-inducible transcription repressor HrcA 1.32e-12 2.54e-53 3.21e-21 0.6732
1. PBF Q5H188 Heat-inducible transcription repressor HrcA 2.55e-11 6.00e-34 2.41e-20 0.3949
1. PBF P71498 Heat-inducible transcription repressor HrcA 0.00e+00 3.55e-107 0.0 0.9724
1. PBF Q8DKU4 Heat-inducible transcription repressor HrcA 2.28e-14 3.73e-59 3.04e-18 0.7041
1. PBF B8I307 Heat-inducible transcription repressor HrcA 3.73e-13 1.14e-55 9.95e-32 0.7492
1. PBF A8KYV9 Heat-inducible transcription repressor HrcA 6.96e-11 1.19e-58 1.36e-28 0.6518
1. PBF Q02ZQ9 Heat-inducible transcription repressor HrcA 2.34e-14 3.77e-39 5.77e-22 0.7936
1. PBF A9GHW2 Heat-inducible transcription repressor HrcA 1.24e-11 2.39e-38 6.56e-22 0.7014
1. PBF A6LRN2 Heat-inducible transcription repressor HrcA 3.00e-15 1.64e-64 1.18e-39 0.6688
1. PBF B3DRX0 Heat-inducible transcription repressor HrcA 2.19e-11 2.23e-33 1.85e-21 0.6408
1. PBF P0DB67 Heat-inducible transcription repressor hrcA 2.59e-11 1.41e-41 5.36e-25 0.7153
1. PBF Q87BS6 Heat-inducible transcription repressor HrcA 7.93e-14 6.17e-39 4.08e-24 0.6811
1. PBF B3WEQ9 Heat-inducible transcription repressor HrcA 0.00e+00 3.41e-51 3.72e-39 0.7743
1. PBF Q92SK1 Heat-inducible transcription repressor HrcA 8.44e-11 1.00e-25 1.27e-14 0.7084
1. PBF Q2JDK0 Heat-inducible transcription repressor HrcA 1.73e-14 8.08e-58 7.20e-30 0.6458
1. PBF Q3JP05 Heat-inducible transcription repressor HrcA 1.31e-14 3.79e-41 6.36e-25 0.7262
1. PBF Q2SZ00 Heat-inducible transcription repressor HrcA 8.77e-15 1.84e-41 4.74e-24 0.7032
1. PBF Q2YT45 Heat-inducible transcription repressor HrcA 2.57e-11 5.29e-61 1.73e-35 0.6884
1. PBF Q038N1 Heat-inducible transcription repressor HrcA 0.00e+00 4.94e-51 7.49e-40 0.8041
1. PBF A2RCW4 Heat-inducible transcription repressor HrcA 1.85e-11 3.74e-42 1.51e-24 0.7174
1. PBF Q1JKD4 Heat-inducible transcription repressor HrcA 2.21e-11 4.02e-42 1.69e-24 0.7168
1. PBF B1VAB8 Heat-inducible transcription repressor HrcA 0.00e+00 2.73e-61 2.62e-32 0.8192
1. PBF Q2G6M4 Heat-inducible transcription repressor HrcA 3.61e-13 9.90e-22 3.86e-15 0.6662
1. PBF P68793 Heat-inducible transcription repressor HrcA 5.11e-10 2.23e-61 6.30e-36 0.6753
1. PBF Q6YPL9 Heat-inducible transcription repressor HrcA 0.00e+00 7.18e-65 5.97e-31 0.7938
1. PBF A9AUH0 Heat-inducible transcription repressor HrcA 2.96e-10 1.74e-34 1.45e-21 0.6461
1. PBF Q8CP15 Heat-inducible transcription repressor HrcA 8.14e-12 1.44e-61 1.28e-28 0.6717
1. PBF Q253K3 Heat-inducible transcription repressor HrcA 1.31e-10 1.45e-23 1.64e-14 0.6342
1. PBF A6TSM2 Heat-inducible transcription repressor HrcA 2.22e-16 3.53e-59 6.47e-36 0.7604
1. PBF C5D4U3 Heat-inducible transcription repressor HrcA 0.00e+00 2.06e-59 1.09e-52 0.7175
1. PBF B2S8G3 Heat-inducible transcription repressor HrcA 2.01e-07 2.03e-23 1.98e-18 0.4908
1. PBF Q45550 Heat-inducible transcription repressor HrcA 0.00e+00 3.89e-58 5.49e-53 0.7013
1. PBF Q145F6 Heat-inducible transcription repressor HrcA 0.00e+00 2.56e-40 3.23e-23 0.7611
1. PBF A1UIQ9 Heat-inducible transcription repressor HrcA 1.40e-12 6.38e-54 5.02e-29 0.6897
1. PBF B7IYG9 Heat-inducible transcription repressor HrcA 5.55e-16 4.36e-53 2.96e-44 0.7286
1. PBF Q62HD0 Heat-inducible transcription repressor HrcA 1.07e-14 3.79e-41 6.36e-25 0.7405
1. PBF A4JBR5 Heat-inducible transcription repressor HrcA 8.55e-15 2.71e-41 2.02e-24 0.7439
1. PBF Q6AEB9 Heat-inducible transcription repressor HrcA 0.00e+00 3.29e-58 2.21e-27 0.7927
1. PBF Q8KCD6 Heat-inducible transcription repressor HrcA 1.64e-14 1.93e-57 1.15e-22 0.6912
1. PBF Q8G6C7 Heat-inducible transcription repressor HrcA 3.95e-11 1.47e-33 2.10e-21 0.6362
1. PBF A0K4S1 Heat-inducible transcription repressor HrcA 1.08e-14 2.71e-41 1.06e-24 0.7509
1. PBF B2J938 Heat-inducible transcription repressor HrcA 1.69e-13 1.35e-52 3.08e-22 0.6051
1. PBF P36426 Heat-inducible transcription repressor HrcA 2.89e-11 1.76e-25 1.44e-11 0.664
1. PBF A4T2C4 Heat-inducible transcription repressor HrcA 1.27e-12 6.04e-54 3.39e-25 0.7096
1. PBF O87775 Heat-inducible transcription repressor HrcA 0.00e+00 8.43e-56 4.00e-38 0.809
1. PBF Q71ZJ5 Heat-inducible transcription repressor HrcA 0.00e+00 2.77e-57 5.88e-43 0.7227
1. PBF B1MN38 Heat-inducible transcription repressor HrcA 2.83e-12 5.27e-53 4.96e-24 0.6782
1. PBF A0QEA3 Heat-inducible transcription repressor HrcA 2.41e-12 3.29e-56 2.86e-30 0.6923
1. PBF Q9Z850 Heat-inducible transcription repressor HrcA 1.20e-09 4.98e-18 4.25e-14 0.694
1. PBF Q03FR9 Heat-inducible transcription repressor HrcA 0.00e+00 1.06e-56 7.11e-34 0.7747
1. PBF A8Z4C1 Heat-inducible transcription repressor HrcA 8.89e-10 2.50e-61 2.89e-35 0.6624
1. PBF Q74IT4 Heat-inducible transcription repressor HrcA 0.00e+00 3.43e-61 7.59e-42 0.7993
1. PBF P64397 Heat-inducible transcription repressor HrcA 3.38e-10 2.03e-23 1.98e-18 0.4189
1. PBF Q0RP78 Heat-inducible transcription repressor HrcA 6.27e-14 2.41e-57 1.12e-28 0.6342
1. PBF A3NYY3 Heat-inducible transcription repressor HrcA 1.53e-14 3.79e-41 6.36e-25 0.7438
1. PBF B8DKI5 Heat-inducible transcription repressor HrcA 8.92e-13 3.54e-46 3.58e-18 0.7128
1. PBF Q3SHA4 Heat-inducible transcription repressor HrcA 1.29e-14 1.91e-39 3.14e-20 0.6564
1. PBF Q3AQP3 Heat-inducible transcription repressor HrcA 3.36e-13 3.39e-56 9.14e-29 0.7061
1. PBF Q04LY2 Heat-inducible transcription repressor HrcA 1.44e-11 2.40e-37 1.94e-20 0.7304
1. PBF A1A1M6 Heat-inducible transcription repressor HrcA 2.67e-11 1.21e-31 1.28e-21 0.662
1. PBF A9WEX3 Heat-inducible transcription repressor HrcA 2.12e-11 1.03e-41 1.81e-30 0.6622
1. PBF Q3MCK2 Heat-inducible transcription repressor HrcA 5.60e-14 9.67e-61 4.91e-25 0.7046
1. PBF B5ZMW9 Heat-inducible transcription repressor HrcA 2.55e-14 5.65e-23 2.96e-16 0.7443
1. PBF P68794 Heat-inducible transcription repressor HrcA 5.44e-10 2.23e-61 6.30e-36 0.6643
1. PBF A3DF27 Heat-inducible transcription repressor HrcA 0.00e+00 3.57e-49 3.76e-34 0.8125
1. PBF Q8DQW9 Heat-inducible transcription repressor HrcA 1.89e-11 2.40e-37 1.94e-20 0.7235
1. PBF A5GP57 Heat-inducible transcription repressor HrcA 7.62e-13 5.55e-49 1.08e-27 0.6761
1. PBF C1A1G4 Heat-inducible transcription repressor HrcA 4.89e-12 4.86e-53 2.44e-26 0.6843
1. PBF A1TBR8 Heat-inducible transcription repressor HrcA 2.17e-11 4.48e-53 5.90e-27 0.6486
1. PBF Q74H61 Heat-inducible transcription repressor HrcA 6.02e-14 2.89e-50 4.91e-26 0.6998
1. PBF B9MEI9 Heat-inducible transcription repressor HrcA 6.47e-14 1.98e-38 9.12e-25 0.7012
1. PBF C1D6U0 Heat-inducible transcription repressor HrcA 1.62e-14 1.70e-34 2.33e-23 0.6887
1. PBF Q38W91 Heat-inducible transcription repressor HrcA 0.00e+00 2.40e-55 6.84e-39 0.8066
1. PBF Q4A902 Heat-inducible transcription repressor HrcA 5.93e-14 3.86e-49 2.24e-25 0.6714
1. PBF Q8PAL1 Heat-inducible transcription repressor HrcA 6.30e-12 2.72e-33 2.66e-22 0.6831
1. PBF P0DB66 Heat-inducible transcription repressor hrcA 2.19e-11 1.41e-41 5.36e-25 0.7195
1. PBF Q73XZ5 Heat-inducible transcription repressor HrcA 1.10e-12 9.42e-56 1.16e-30 0.6969
1. PBF Q3KLV9 Heat-inducible transcription repressor HrcA 2.08e-09 4.37e-27 6.54e-13 0.6453
1. PBF Q67S56 Heat-inducible transcription repressor HrcA 1.31e-12 1.40e-61 2.99e-40 0.7189
1. PBF Q5KWZ5 Heat-inducible transcription repressor HrcA 3.15e-14 3.50e-51 7.44e-51 0.722
1. PBF Q1H396 Heat-inducible transcription repressor HrcA 0.00e+00 1.68e-38 1.27e-26 0.7701
1. PBF Q6NCY7 Heat-inducible transcription repressor HrcA 2.31e-13 2.60e-27 7.82e-22 0.6575
1. PBF Q0AWM1 Heat-inducible transcription repressor HrcA 3.08e-13 4.74e-65 5.34e-35 0.6781
1. PBF Q2IHN8 Heat-inducible transcription repressor HrcA 4.62e-14 1.19e-40 6.83e-25 0.6516
1. PBF A1SHX8 Heat-inducible transcription repressor HrcA 6.30e-11 9.84e-58 1.21e-27 0.657
1. PBF Q8E7Q9 Heat-inducible transcription repressor HrcA 3.80e-11 1.03e-39 6.24e-25 0.7192
1. PBF Q93R29 Heat-inducible transcription repressor HrcA 0.00e+00 1.67e-58 4.73e-27 0.7842
1. PBF B2G6W1 Heat-inducible transcription repressor HrcA 0.00e+00 1.42e-51 1.47e-41 0.8269
1. PBF B0BC29 Heat-inducible transcription repressor HrcA 1.93e-09 1.52e-24 1.65e-11 0.6416
1. PBF Q8NZM6 Heat-inducible transcription repressor HrcA 3.44e-11 3.74e-42 1.51e-24 0.7224
1. PBF B8ZLY7 Heat-inducible transcription repressor HrcA 3.08e-13 2.40e-37 1.94e-20 0.7342
1. PBF Q5M6D3 Heat-inducible transcription repressor HrcA 4.18e-11 5.49e-34 6.40e-22 0.7316
1. PBF A7Z6W3 Heat-inducible transcription repressor HrcA 2.46e-14 5.71e-53 8.16e-45 0.7099
1. PBF Q65H52 Heat-inducible transcription repressor HrcA 9.99e-16 7.78e-57 2.25e-47 0.6576
1. PBF Q12DY9 Heat-inducible transcription repressor HrcA 6.43e-13 3.54e-38 1.69e-24 0.7056
1. PBF Q1JFC6 Heat-inducible transcription repressor HrcA 2.60e-11 1.41e-41 5.36e-25 0.7177
1. PBF Q04VD0 Heat-inducible transcription repressor HrcA 1.45e-14 1.69e-45 3.51e-19 0.7143
1. PBF Q7WGH9 Heat-inducible transcription repressor HrcA 0.00e+00 8.71e-29 2.24e-21 0.7695
1. PBF Q88VL8 Heat-inducible transcription repressor HrcA 0.00e+00 3.54e-52 6.99e-41 0.8048
1. PBF Q21CI5 Heat-inducible transcription repressor HrcA 1.06e-13 1.44e-24 2.90e-20 0.6721
1. PBF Q0BI25 Heat-inducible transcription repressor HrcA 9.21e-15 1.45e-41 6.82e-25 0.7254
1. PBF Q0SRE1 Heat-inducible transcription repressor HrcA 3.44e-15 4.99e-61 2.84e-43 0.6805
1. PBF Q48RR1 Heat-inducible transcription repressor HrcA 3.73e-11 3.74e-42 1.51e-24 0.719
1. PBF A5VJE5 Heat-inducible transcription repressor HrcA 0.00e+00 1.42e-51 1.47e-41 0.8442
1. PBF B2A1M7 Heat-inducible transcription repressor HrcA 8.33e-12 3.12e-56 1.56e-24 0.6615
1. PBF Q044B1 Heat-inducible transcription repressor HrcA 0.00e+00 9.64e-62 2.54e-43 0.7559
1. PBF B9KAB7 Heat-inducible transcription repressor HrcA 1.16e-12 4.29e-50 5.14e-22 0.5904
1. PBF Q5NRL5 Heat-inducible transcription repressor HrcA 2.37e-12 6.64e-22 5.55e-12 0.6961
1. PBF P61446 Heat-inducible transcription repressor HrcA 1.24e-14 2.86e-45 1.18e-19 0.7039
1. PBF C0M7T7 Heat-inducible transcription repressor HrcA 1.67e-11 4.52e-40 2.25e-20 0.7295
1. PBF A0JX46 Heat-inducible transcription repressor HrcA 3.24e-14 4.98e-57 2.28e-26 0.6296
1. PBF Q7U3Z7 Heat-inducible transcription repressor HrcA 0.00e+00 9.01e-47 3.86e-24 0.7614
1. PBF B8DE36 Heat-inducible transcription repressor HrcA 0.00e+00 2.77e-57 5.88e-43 0.7406
1. PBF B8GXP3 Heat-inducible transcription repressor HrcA 0.00e+00 1.90e-25 4.53e-16 0.7613
1. PBF Q1QRU4 Heat-inducible transcription repressor HrcA 2.34e-11 2.66e-27 1.03e-21 0.6889
1. PBF A9KKU2 Heat-inducible transcription repressor HrcA 2.39e-11 9.30e-58 1.40e-25 0.6245
1. PBF A5D3X8 Heat-inducible transcription repressor HrcA 3.33e-16 4.13e-54 7.33e-37 0.6951
1. PBF C3MEJ2 Heat-inducible transcription repressor HrcA 1.30e-11 4.91e-25 8.24e-16 0.7009
1. PBF Q9REF2 Heat-inducible transcription repressor HrcA 1.17e-11 1.24e-27 7.01e-21 0.6837
1. PBF Q0TNS5 Heat-inducible transcription repressor HrcA 3.89e-15 9.40e-61 2.87e-43 0.6873
1. PBF Q2RKX6 Heat-inducible transcription repressor HrcA 3.33e-16 4.48e-58 8.72e-27 0.736
1. PBF C1CJ04 Heat-inducible transcription repressor HrcA 4.22e-13 1.16e-36 2.00e-20 0.7313
1. PBF Q3SW79 Heat-inducible transcription repressor HrcA 1.66e-07 1.57e-28 6.14e-20 0.5076
1. PBF Q8L3A0 Heat-inducible transcription repressor HrcA 0.00e+00 3.24e-59 1.35e-35 0.7703
1. PBF Q81LS0 Heat-inducible transcription repressor HrcA 9.99e-16 5.10e-59 1.24e-42 0.7087
1. PBF C1CQ16 Heat-inducible transcription repressor HrcA 1.23e-11 1.59e-37 2.23e-20 0.728
1. PBF A4J7F6 Heat-inducible transcription repressor HrcA 5.55e-16 1.21e-54 3.53e-31 0.6665
1. PBF Q5EF74 Heat-inducible transcription repressor HrcA 2.86e-11 1.84e-63 9.69e-23 0.6634
1. PBF G2K048 Heat-inducible transcription repressor HrcA 0.00e+00 2.77e-57 5.88e-43 0.7472
1. PBF Q11B41 Heat-inducible transcription repressor HrcA 1.86e-10 2.36e-25 4.51e-20 0.7168
1. PBF Q0AHZ3 Heat-inducible transcription repressor HrcA 7.66e-15 1.11e-38 3.18e-30 0.6497
1. PBF P42370 Heat-inducible transcription repressor HrcA 1.99e-14 5.89e-39 4.83e-22 0.7905
1. PBF Q4AAT9 Heat-inducible transcription repressor HrcA 2.48e-13 3.86e-49 2.24e-25 0.6672
1. PBF Q99YC7 Heat-inducible transcription repressor HrcA 2.25e-11 4.02e-42 1.69e-24 0.7162
1. PBF Q47RP1 Heat-inducible transcription repressor HrcA 2.78e-12 6.11e-51 1.64e-25 0.644
1. PBF B4S9D2 Heat-inducible transcription repressor HrcA 4.57e-14 3.15e-59 6.60e-28 0.6752
1. PBF Q6MT04 Heat-inducible transcription repressor HrcA 0.00e+00 4.07e-120 0.0 0.9714
1. PBF B8FUN6 Heat-inducible transcription repressor HrcA 4.41e-14 1.68e-54 2.95e-31 0.6854
1. PBF Q6G564 Heat-inducible transcription repressor HrcA 1.28e-10 5.58e-26 6.72e-16 0.4357
1. PBF B3EE33 Heat-inducible transcription repressor HrcA 1.11e-16 9.68e-56 3.31e-30 0.7595
1. PBF Q3K3T4 Heat-inducible transcription repressor HrcA 2.14e-11 6.58e-44 2.42e-26 0.7239
1. PBF B4UJT7 Heat-inducible transcription repressor HrcA 1.34e-13 4.85e-40 3.33e-24 0.6615
1. PBF C1KVC2 Heat-inducible transcription repressor HrcA 0.00e+00 2.77e-57 5.88e-43 0.7223
1. PBF Q6GGB8 Heat-inducible transcription repressor HrcA 1.24e-09 2.57e-61 7.61e-36 0.6591
1. PBF P75351 Heat-inducible transcription repressor HrcA 0.00e+00 2.97e-61 7.49e-46 0.7567
1. PBF C0RGM6 Heat-inducible transcription repressor HrcA 1.14e-11 2.03e-23 1.98e-18 0.6919
1. PBF B5ZBR8 Heat-inducible transcription repressor HrcA 1.11e-16 2.16e-60 8.47e-38 0.7397
1. PBF B8G4T8 Heat-inducible transcription repressor HrcA 4.85e-11 1.01e-38 3.10e-32 0.6804
1. PBF B9DVF5 Heat-inducible transcription repressor HrcA 1.72e-11 5.78e-42 4.30e-21 0.7381
1. PBF A2SL47 Heat-inducible transcription repressor HrcA 3.08e-14 6.89e-41 1.09e-28 0.7218
1. PBF Q8RB70 Heat-inducible transcription repressor HrcA 9.39e-13 3.20e-62 3.07e-33 0.6664
1. PBF Q824B0 Heat-inducible transcription repressor HrcA 8.86e-11 6.74e-20 5.93e-14 0.631
1. PBF Q5N3M2 Heat-inducible transcription repressor HrcA 1.07e-12 3.85e-61 6.37e-23 0.6616
1. PBF B2V2I3 Heat-inducible transcription repressor HrcA 7.99e-15 2.96e-60 8.32e-41 0.6495
1. PBF Q6F147 Heat-inducible transcription repressor HrcA 0.00e+00 8.46e-74 4.19e-128 0.9154
1. PBF Q9PPG2 Heat-inducible transcription repressor HrcA 3.61e-06 1.55e-09 0.002 0.5244
1. PBF B3PN01 Heat-inducible transcription repressor HrcA 3.81e-11 1.42e-57 2.99e-38 0.6651
1. PBF Q3BVC0 Heat-inducible transcription repressor HrcA 7.36e-12 2.22e-34 7.95e-21 0.6631
1. PBF B3Q969 Heat-inducible transcription repressor HrcA 2.09e-13 2.60e-27 7.82e-22 0.6541
1. PBF Q72DW6 Heat-inducible transcription repressor HrcA 6.80e-11 8.36e-48 4.52e-22 0.7093
1. PBF Q8EWX9 Heat-inducible transcription repressor HrcA 0.00e+00 3.12e-70 7.96e-58 0.7177
1. PBF B4U1A7 Heat-inducible transcription repressor HrcA 1.73e-11 4.63e-40 3.27e-20 0.7327
1. PBF O06940 Heat-inducible transcription repressor HrcA 4.42e-11 7.63e-44 9.17e-24 0.7299
1. PBF A1VKP8 Heat-inducible transcription repressor HrcA 0.00e+00 2.20e-39 6.44e-24 0.7777
1. PBF A5CRA6 Heat-inducible transcription repressor HrcA 0.00e+00 3.06e-54 1.27e-22 0.7392
1. PBF B2TLZ5 Heat-inducible transcription repressor HrcA 6.22e-15 3.74e-61 7.49e-41 0.646
1. PBF Q4L6T2 Heat-inducible transcription repressor HrcA 8.47e-12 3.15e-64 1.65e-31 0.6798
1. PBF A1WGR9 Heat-inducible transcription repressor HrcA 1.93e-14 1.95e-37 7.92e-24 0.7151
1. PBF A3ND74 Heat-inducible transcription repressor HrcA 1.43e-14 3.79e-41 6.36e-25 0.7456
1. PBF Q7V4D3 Heat-inducible transcription repressor HrcA 1.20e-12 1.75e-35 8.55e-23 0.7282
1. PBF Q6MB28 Heat-inducible transcription repressor HrcA 3.91e-11 1.82e-28 6.36e-11 0.621
1. PBF Q9PQ68 Heat-inducible transcription repressor HrcA 1.11e-16 9.54e-60 1.22e-37 0.7714
1. PBF B0TAD4 Heat-inducible transcription repressor HrcA 9.63e-14 8.11e-52 9.85e-29 0.7024
1. PBF Q5HNW4 Heat-inducible transcription repressor HrcA 7.54e-12 1.44e-61 1.28e-28 0.6688
1. PBF P47447 Heat-inducible transcription repressor HrcA 0.00e+00 8.02e-59 2.81e-37 0.8264
1. PBF Q8NWA8 Heat-inducible transcription repressor HrcA 7.97e-10 2.50e-61 2.89e-35 0.6589
1. PBF P61447 Heat-inducible transcription repressor HrcA 1.35e-14 2.86e-45 1.18e-19 0.7061
1. PBF O24933 Heat-inducible transcription repressor HrcA 1.59e-06 1.01e-08 1.37e-08 0.5464
1. PBF Q049W4 Heat-inducible transcription repressor HrcA 0.00e+00 4.16e-62 1.02e-42 0.7325
1. PBF Q5M1U0 Heat-inducible transcription repressor HrcA 1.15e-11 5.49e-34 6.40e-22 0.7493
1. PBF A4YJR2 Heat-inducible transcription repressor HrcA 7.77e-11 1.56e-26 2.38e-21 0.6941
1. PBF Q6KIH9 Heat-inducible transcription repressor HrcA 2.55e-15 2.07e-66 9.65e-40 0.6872
1. PBF B0CJ31 Heat-inducible transcription repressor HrcA 2.42e-11 2.03e-23 1.98e-18 0.6744
1. PBF B1VY37 Heat-inducible transcription repressor HrcA 6.71e-13 1.99e-53 1.17e-25 0.7076
1. PBF B3QZK4 Heat-inducible transcription repressor HrcA 0.00e+00 1.39e-49 5.31e-28 0.8175
1. PBF Q607A3 Heat-inducible transcription repressor HrcA 1.99e-14 8.53e-29 7.88e-19 0.6721
1. PBF A1W4H2 Heat-inducible transcription repressor HrcA 0.00e+00 7.09e-38 8.16e-24 0.7481
1. PBF Q9ZMW2 Heat-inducible transcription repressor HrcA 1.85e-06 5.43e-09 5.16e-10 0.5415
1. PBF B1IA50 Heat-inducible transcription repressor HrcA 1.02e-11 1.59e-37 2.23e-20 0.732
1. PBF B0KA83 Heat-inducible transcription repressor HrcA 4.52e-13 5.44e-61 1.51e-32 0.6862
1. PBF B7HCU2 Heat-inducible transcription repressor HrcA 7.77e-16 1.10e-53 5.23e-44 0.7324
1. PBF A6WDI1 Heat-inducible transcription repressor HrcA 7.77e-16 5.27e-56 2.15e-25 0.7306
1. PBF B8HQ19 Heat-inducible transcription repressor HrcA 2.18e-13 4.48e-53 8.25e-22 0.7179
1. PBF C0ZB46 Heat-inducible transcription repressor HrcA 7.77e-16 5.42e-56 4.36e-47 0.7275
1. PBF A7NS62 Heat-inducible transcription repressor HrcA 1.35e-14 1.90e-43 3.22e-31 0.6272
1. PBF Q98DN7 Heat-inducible transcription repressor HrcA 0.00e+00 7.89e-20 2.31e-19 0.7578
1. PBF B0T368 Heat-inducible transcription repressor HrcA 0.00e+00 4.63e-25 1.51e-16 0.8002
1. PBF Q8E2A0 Heat-inducible transcription repressor HrcA 2.30e-11 9.15e-42 5.26e-25 0.7196
1. PBF B2GHU5 Heat-inducible transcription repressor HrcA 1.66e-13 1.78e-54 1.14e-26 0.6057
1. PBF B0U3K0 Heat-inducible transcription repressor HrcA 6.81e-14 6.78e-39 4.63e-25 0.6916
1. PBF B1YTJ4 Heat-inducible transcription repressor HrcA 1.13e-14 1.45e-41 6.82e-25 0.7355
1. PBF A9VHU3 Heat-inducible transcription repressor HrcA 5.55e-16 9.50e-59 9.51e-43 0.7095
1. PBF A3Q272 Heat-inducible transcription repressor HrcA 6.86e-11 6.38e-54 5.02e-29 0.6747
1. PBF B8DUG2 Heat-inducible transcription repressor HrcA 5.09e-11 3.20e-39 1.11e-17 0.6352
1. PBF Q1BYY0 Heat-inducible transcription repressor HrcA 3.79e-14 2.71e-41 1.06e-24 0.7429
1. PBF A5UYW7 Heat-inducible transcription repressor HrcA 6.55e-15 2.16e-44 4.66e-31 0.6234
1. PBF Q5HFH8 Heat-inducible transcription repressor HrcA 3.22e-10 2.50e-61 2.89e-35 0.6691
1. PBF B3QPX0 Heat-inducible transcription repressor HrcA 2.43e-14 1.11e-55 3.27e-24 0.7092
1. PBF Q1MMD0 Heat-inducible transcription repressor HrcA 1.16e-11 1.32e-25 1.80e-16 0.7572
1. PBF Q2FGE1 Heat-inducible transcription repressor HrcA 1.28e-09 2.50e-61 2.89e-35 0.6714
1. PBF B8JCT2 Heat-inducible transcription repressor HrcA 3.59e-12 4.85e-40 3.33e-24 0.6472
1. PBF A8AVA6 Heat-inducible transcription repressor HrcA 2.13e-13 8.17e-39 2.02e-20 0.7468
1. PBF Q8FNF4 Heat-inducible transcription repressor HrcA 1.28e-11 1.62e-50 2.23e-23 0.6692
1. PBF Q8NNB3 Heat-inducible transcription repressor HrcA 1.14e-13 2.47e-53 3.33e-21 0.6685
1. PBF Q21XX3 Heat-inducible transcription repressor HrcA 3.84e-14 2.74e-38 5.51e-26 0.6673
1. PBF Q9KD74 Heat-inducible transcription repressor HrcA 0.00e+00 3.69e-51 1.24e-45 0.7478
1. PBF Q602E0 Heat-inducible transcription repressor HrcA 1.51e-13 3.86e-49 2.24e-25 0.6721
1. PBF A9AGC4 Heat-inducible transcription repressor HrcA 3.04e-14 1.84e-41 3.88e-25 0.7351
1. PBF C0ME88 Heat-inducible transcription repressor HrcA 2.92e-11 1.47e-39 2.25e-20 0.7385
1. PBF B8ZUS6 Heat-inducible transcription repressor HrcA 1.74e-10 3.61e-54 2.22e-30 0.6747
1. PBF Q6HDK5 Heat-inducible transcription repressor HrcA 9.99e-16 6.77e-59 7.08e-43 0.7271
1. PBF A8FFD4 Heat-inducible transcription repressor HrcA 6.66e-16 3.16e-55 3.30e-51 0.7481
1. PBF A0RIT5 Heat-inducible transcription repressor HrcA 7.77e-16 1.03e-56 5.56e-43 0.7297
1. PBF A1TT56 Heat-inducible transcription repressor HrcA 0.00e+00 2.10e-36 1.16e-27 0.7506
4. PB P9WMK3 Heat-inducible transcription repressor HrcA 3.08e-10 7.20e-55 5.35e-29 NA
4. PB Q2FXZ0 Heat-inducible transcription repressor HrcA 6.59e-10 2.50e-61 2.89e-35 NA
5. P B1IRU8 Transcriptional regulator LsrR 1.41e-01 4.98e-03 NA NA
5. P O05405 Uncharacterized protein YrhO 6.81e-03 9.28e-03 NA NA
5. P P18816 Lactose phosphotransferase system repressor 5.73e-02 1.97e-02 NA NA
5. P P45552 Uncharacterized protein YhfZ 5.61e-02 3.34e-03 NA NA
5. P Q8ZKQ5 Transcriptional regulator LsrR 1.73e-01 1.29e-04 NA NA
5. P O32253 Central glycolytic genes regulator 2.46e-02 9.37e-03 NA NA
5. P P94591 HTH-type transcriptional repressor GlcR 7.22e-02 1.50e-02 NA NA
5. P Q5PJE8 Transcriptional regulator LsrR 1.75e-01 1.03e-04 NA NA
5. P Q8PXY1 Global nitrogen regulator NrpRI 4.78e-03 2.04e-03 NA NA
5. P Q2YIQ4 Erythritol catabolism regulatory protein EryD 8.24e-02 3.00e-03 NA NA
5. P P76141 Transcriptional regulator LsrR 1.43e-01 5.70e-03 NA NA
5. P D4GYE7 HTH-type transcriptional regulator GlpR 3.26e-02 1.97e-02 NA NA
5. P B1LFA3 Transcriptional regulator LsrR 1.40e-01 6.71e-03 NA NA
5. P P35168 Central glycolytic genes regulator 1.92e-02 6.91e-03 NA NA
5. P A8A065 Transcriptional regulator LsrR 2.04e-01 4.98e-03 NA NA
5. P Q7N2E0 Transcriptional regulator LsrR 1.77e-01 2.02e-02 NA NA
5. P Q57HE3 Transcriptional regulator LsrR 1.71e-01 9.07e-05 NA NA
5. P A6TEB9 Transcriptional regulator LsrR 1.36e-01 5.06e-05 NA NA
5. P B1XEA0 Transcriptional regulator LsrR 1.31e-01 5.70e-03 NA NA
5. P Q8XAY6 Transcriptional regulator LsrR 1.42e-01 4.98e-03 NA NA
5. P A4WER5 Transcriptional regulator LsrR 1.31e-01 9.26e-05 NA NA
5. P A9MZF9 Transcriptional regulator LsrR 1.20e-01 1.03e-04 NA NA
5. P Q8Z2X4 Transcriptional regulator LsrR 1.14e-01 1.03e-04 NA NA
5. P A7ZLX0 Transcriptional regulator LsrR 1.46e-01 3.76e-03 NA NA
6. F Q93PU6 HTH-type transcriptional regulator TtgV 1.30e-03 NA NA 0.2802
6. F Q9R9U0 HTH-type transcriptional regulator SrpS 1.32e-03 NA NA 0.2755
6. F Q0K846 Probable transcriptional regulator SauR 4.76e-03 NA NA 0.2718
6. F P17430 Acetate operon repressor 5.08e-03 NA NA 0.2706