Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54857.1
JCVISYN3A_0545
ATP-dependent Clp protease subunit B.
M. mycoides homolog: Q6MT03.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 118
Unique PROST Go: 8
Unique BLAST Go: 37
Unique Foldseek Go: 27
Total Homologs: 962
Unique PROST Homologs: 1
Unique BLAST Homologs: 527
Unique Foldseek Homologs: 205
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9CFF3
(Chaperone protein ClpB) with a FATCAT P-Value: 0 and RMSD of 3.64 angstrom. The sequence alignment identity is 46.8%.
Structural alignment shown in left. Query protein AVX54857.1 colored as red in alignment, homolog Q9CFF3 colored as blue.
Query protein AVX54857.1 is also shown in right top, homolog Q9CFF3 showed in right bottom. They are colored based on secondary structures.
AVX54857.1 ---------------------------------------------------------------------------------------------------- 0
Q9CFF3 MDIEKMTTTMQEALGSAQQIAQVRHHQVIEVPHLWRIFVQPNSFGANFYKDLGIDLDDYTNLIEKEIDKINSVEGSNITYGQNLSPDLFQIFTEADKIAQ 100
AVX54857.1 -----------------------------------------MEFQEKG--KVTD--------ALKKYTRDLTKDAKDNKLDPVIGREEEISRVIQILSRK 49
Q9CFF3 KMGDEYLSTEIILLALFELKQNPLTSYLVSHGLTKAKAQAAIE-KLRGGDKVTSQNAEETYKALEKYGVDLVAQVKSGKQDPVIGRDEEIRDVIRVLSRK 199
AVX54857.1 TKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPTLLKNKRILELYMGSLMAGAMYMGDYESRVKAVVNEIQKSNGEIILFIDELHLIVGAGKT-GNNSGMD 148
Q9CFF3 TKNNPVLIGEPGVGKTAIVEGLAQRIVRKDVPENLKDKTIFSLDMGALIAGAKYRGEFEERLKAVLNEVKKSDGQIILFIDELHTIVGAGKTEGS---MD 296
AVX54857.1 VSNLLKPALARGELKAIGSTTLNEYRQYIEKDAALERRFQRVLVSEPTIDQTISILRGLKDRFETYHGVRIHDNALVSAAKLSSRYITDRYLPDKAIDLV 248
Q9CFF3 AGNLLKPMLARGELHLIGATTLDEYRKYMETDKALERRFQKVLVTEPTVEDTISILRGLKERFEIHHGVTIHDNALVAAATLSNRYITDRFLPDKAIDLV 396
AVX54857.1 DEACASIRTELASVPIELDQVNRKVMQLEIETSALEKEKDDKSKERWQEAKKELDSLKIEQASLNEKWEKEKEELSRINSVKSSIESLKQELETAQNDGN 348
Q9CFF3 DEASATIRVEMNSLPTELDQANRRLMQLEIEEAALKKERDDASKKRLEIIRGEIAELREENNQLKAQWEAEKKEVGNISEKRNELEHARHELEEAQNEGN 496
AVX54857.1 YKRAGEIQYSLLPSLEKSL-ALFEKQTGS--KMISEEVTEHEIAKVVSKSTGILVDRLISSEKEKLLNLEDLLKKYVKGQDQAIKAVTSAIMRSRSGIKN 445
Q9CFF3 LEKAAALRYGKIPEIEKELKAIEEKAKSDDLSLVQESVTEEQITEVVGRMTGIPITKLVEGEREKLLHLPETLHQRVVGQDEAVEAVSDAIIRARAGIQD 596
AVX54857.1 PDKPIGSFLFLGPTGVGKTEVARSLADILFNSPKKMIRLDMSEYMEKHSVAKLIGAPPGYVGYEEGGRLTEAVRRNPYSIVLFDEIEKAHTDVFNILLQI 545
Q9CFF3 PNRPLGSFLFLGPTGVGKTELAKALAENLFDSEEHMVRIDMSEYMEKHSVSRLVGAPPGYVGYDEGGQLTEAVRRNPYTIILLDEIEKAHPDVFNILLQV 696
AVX54857.1 LDDGRLTDSLGKTIDFKNTIIVMTSNIASQYLLTSDELVQVDDQ-KIQEE-----LNKV---FRPEFLNRIDNIVYFNALSVQTIGEIVDKVLEELSTRL 636
Q9CFF3 LDDGRLTDSKGVLVDFKNTVLIMTSNVGSQYLL--D---NVGENGEISEETTENVMSQLRAHFKPEFLNRIDDTILFKPLALEDIKNIIVKMTSQLSHRL 791
AVX54857.1 QDEQNYFINFSEEARNKI-INE-GYDRLFGARPIKRYIEKNIETLIAHYIISGEVVENTRYLIDVKNNQ--F---TLEEFKQFN 713
Q9CFF3 -EEMDVQLELSEEV--KVWIAENAYEPAYGARPLKRYLTKVIENPLAKLIIGGKIPPKSKVIVTLVENKIDFDIQTIAE----- 867
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0034605 | cellular response to heat |
| 1. PBF | GO:0042026 | protein refolding |
| 1. PBF | GO:0009507 | chloroplast |
| 1. PBF | GO:0043335 | protein unfolding |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0031249 | denatured protein binding |
| 1. PBF | GO:0009408 | response to heat |
| 1. PBF | GO:0140453 | protein aggregate center |
| 2. PF | GO:0005737 | cytoplasm |
| 2. PF | GO:0035617 | stress granule disassembly |
| 3. BF | GO:0016558 | protein import into peroxisome matrix |
| 3. BF | GO:0004176 | ATP-dependent peptidase activity |
| 3. BF | GO:0051082 | unfolded protein binding |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0000502 | proteasome complex |
| 3. BF | GO:0022624 | proteasome accessory complex |
| 3. BF | GO:0008233 | peptidase activity |
| 3. BF | GO:0042645 | mitochondrial nucleoid |
| 3. BF | GO:0036402 | proteasome-activating activity |
| 3. BF | GO:0004252 | serine-type endopeptidase activity |
| 3. BF | GO:0046872 | metal ion binding |
| 3. BF | GO:0001824 | blastocyst development |
| 3. BF | GO:0006515 | protein quality control for misfolded or incompletely synthesized proteins |
| 3. BF | GO:0046983 | protein dimerization activity |
| 3. BF | GO:0016021 | integral component of membrane |
| 3. BF | GO:0006457 | protein folding |
| 3. BF | GO:0043565 | sequence-specific DNA binding |
| 3. BF | GO:0009376 | HslUV protease complex |
| 3. BF | GO:0007005 | mitochondrion organization |
| 3. BF | GO:0005782 | peroxisomal matrix |
| 3. BF | GO:0030163 | protein catabolic process |
| 4. PB | GO:0009532 | plastid stroma |
| 4. PB | GO:0010380 | regulation of chlorophyll biosynthetic process |
| 4. PB | GO:0140545 | protein disaggregase activity |
| 4. PB | GO:0009658 | chloroplast organization |
| 4. PB | GO:0051085 | chaperone cofactor-dependent protein refolding |
| 4. PB | GO:1990169 | stress response to copper ion |
| 4. PB | GO:0016887 | ATP hydrolysis activity |
| 4. PB | GO:1990170 | stress response to cadmium ion |
| 4. PB | GO:0051787 | misfolded protein binding |
| 4. PB | GO:0071218 | cellular response to misfolded protein |
| 4. PB | GO:0031897 | Tic complex |
| 4. PB | GO:0045037 | protein import into chloroplast stroma |
| 4. PB | GO:0070414 | trehalose metabolism in response to heat stress |
| 4. PB | GO:0070370 | cellular heat acclimation |
| 4. PB | GO:0009941 | chloroplast envelope |
| 5. P | GO:1990275 | preribosome binding |
| 5. P | GO:0009570 | chloroplast stroma |
| 5. P | GO:0051087 | chaperone binding |
| 5. P | GO:0034975 | protein folding in endoplasmic reticulum |
| 5. P | GO:1902584 | positive regulation of response to water deprivation |
| 5. P | GO:0045036 | protein targeting to chloroplast |
| 5. P | GO:1901002 | positive regulation of response to salt stress |
| 5. P | GO:0072380 | TRC complex |
| 6. F | GO:0001556 | oocyte maturation |
| 6. F | GO:0048477 | oogenesis |
| 6. F | GO:0106300 | protein-DNA covalent cross-linking repair |
| 6. F | GO:0006270 | DNA replication initiation |
| 6. F | GO:0004222 | metalloendopeptidase activity |
| 6. F | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 6. F | GO:0022623 | proteasome-activating nucleotidase complex |
| 6. F | GO:0007130 | synaptonemal complex assembly |
| 6. F | GO:0031411 | gas vesicle |
| 6. F | GO:0007131 | reciprocal meiotic recombination |
| 6. F | GO:0006275 | regulation of DNA replication |
| 6. F | GO:0032510 | endosome to lysosome transport via multivesicular body sorting pathway |
| 6. F | GO:0051598 | meiotic recombination checkpoint signaling |
| 6. F | GO:0003688 | DNA replication origin binding |
| 6. F | GO:0005773 | vacuole |
| 6. F | GO:0007141 | male meiosis I |
| 6. F | GO:0006302 | double-strand break repair |
| 6. F | GO:1903843 | cellular response to arsenite ion |
| 6. F | GO:0061857 | endoplasmic reticulum stress-induced pre-emptive quality control |
| 6. F | GO:0006260 | DNA replication |
| 6. F | GO:0001673 | male germ cell nucleus |
| 6. F | GO:0007144 | female meiosis I |
| 6. F | GO:1905634 | regulation of protein localization to chromatin |
| 6. F | GO:0019941 | modification-dependent protein catabolic process |
| 6. F | GO:0010498 | proteasomal protein catabolic process |
| 6. F | GO:0031412 | gas vesicle organization |
| 6. F | GO:0043273 | CTPase activity |
| 7. B | GO:0003677 | DNA binding |
| 7. B | GO:0070407 | oxidation-dependent protein catabolic process |
| 7. B | GO:0003697 | single-stranded DNA binding |
| 7. B | GO:0006625 | protein targeting to peroxisome |
| 7. B | GO:0070581 | rolling circle DNA replication |
| 7. B | GO:0140374 | antiviral innate immune response |
| 7. B | GO:0061641 | CENP-A containing chromatin organization |
| 7. B | GO:0048527 | lateral root development |
| 7. B | GO:0032042 | mitochondrial DNA metabolic process |
| 7. B | GO:0000262 | mitochondrial chromosome |
| 7. B | GO:1901858 | regulation of mitochondrial DNA metabolic process |
| 7. B | GO:0010044 | response to aluminum ion |
| 7. B | GO:0016560 | protein import into peroxisome matrix, docking |
| 7. B | GO:0005759 | mitochondrial matrix |
| 7. B | GO:0045899 | positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| 7. B | GO:0032508 | DNA duplex unwinding |
| 7. B | GO:2000200 | regulation of ribosomal subunit export from nucleus |
| 7. B | GO:0016485 | protein processing |
| 7. B | GO:0039529 | RIG-I signaling pathway |
| 7. B | GO:0003727 | single-stranded RNA binding |
| 7. B | GO:0034599 | cellular response to oxidative stress |
| 7. B | GO:0031597 | cytosolic proteasome complex |
| 7. B | GO:0009725 | response to hormone |
| 7. B | GO:0035694 | mitochondrial protein catabolic process |
| 7. B | GO:0008540 | proteasome regulatory particle, base subcomplex |
| 7. B | GO:0070182 | DNA polymerase binding |
| 7. B | GO:0016234 | inclusion body |
| 7. B | GO:0008270 | zinc ion binding |
| 7. B | GO:0000287 | magnesium ion binding |
| 7. B | GO:0070013 | intracellular organelle lumen |
| 7. B | GO:1902347 | response to strigolactone |
| 7. B | GO:0001018 | mitochondrial promoter sequence-specific DNA binding |
| 7. B | GO:0051131 | chaperone-mediated protein complex assembly |
| 7. B | GO:0051880 | G-quadruplex DNA binding |
| 7. B | GO:0110136 | protein-RNA complex remodeling |
| 7. B | GO:0034622 | |
| 7. B | GO:0006508 | proteolysis |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0000166 | nucleotide binding |
| GO:0008233 | peptidase activity |
| GO:0016887 | ATP hydrolysis activity |
| GO:0005524 | ATP binding |
| GO:0006508 | proteolysis |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P46523 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog, chloroplastic (Fragment) | 0.00e+00 | 3.64e-09 | 0.0 | 0.775 |
| 1. PBF | Q5HRM8 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 1.05e-13 | 0.0 | 0.7752 |
| 1. PBF | Q7X2S8 | Chaperone protein ClpB | 0.00e+00 | 1.73e-12 | 0.0 | 0.9661 |
| 1. PBF | Q7WSY8 | Chaperone protein ClpB | 0.00e+00 | 8.26e-13 | 0.0 | 0.8876 |
| 1. PBF | Q6GBW3 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7765 |
| 1. PBF | P47597 | Chaperone protein ClpB | 0.00e+00 | 1.13e-83 | 0.0 | 0.8402 |
| 1. PBF | Q6GDQ0 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 6.43e-21 | 3.45e-164 | 0.6931 |
| 1. PBF | Q9PI02 | Chaperone protein ClpB | 0.00e+00 | 2.06e-14 | 0.0 | 0.8569 |
| 1. PBF | P37571 | Negative regulator of genetic competence ClpC/MecB | 0.00e+00 | 3.68e-10 | 0.0 | 0.7813 |
| 1. PBF | Q9CI09 | ATP-dependent Clp protease ATP-binding subunit ClpE | 0.00e+00 | 1.85e-18 | 1.71e-93 | 0.7062 |
| 1. PBF | Q7VQF3 | Chaperone protein ClpB | 0.00e+00 | 1.04e-16 | 0.0 | 0.8588 |
| 1. PBF | P53533 | Chaperone protein ClpB 1 | 0.00e+00 | 3.53e-13 | 0.0 | 0.8898 |
| 1. PBF | P74459 | Chaperone protein ClpB 1 | 0.00e+00 | 4.73e-15 | 0.0 | 0.9385 |
| 1. PBF | P75247 | Chaperone protein ClpB | 0.00e+00 | 8.87e-82 | 0.0 | 0.919 |
| 1. PBF | Q72AW6 | Chaperone protein ClpB | 0.00e+00 | 5.54e-15 | 0.0 | 0.9611 |
| 1. PBF | P0C281 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7438 |
| 1. PBF | Q6MIV0 | Chaperone protein ClpB | 0.00e+00 | 9.46e-15 | 0.0 | 0.9332 |
| 1. PBF | O78410 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog | 0.00e+00 | 3.15e-16 | 0.0 | 0.727 |
| 1. PBF | Q8XKG8 | Chaperone protein ClpB | 0.00e+00 | 1.24e-16 | 0.0 | 0.8904 |
| 1. PBF | Q7A797 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7427 |
| 1. PBF | P53532 | Chaperone protein ClpB | 0.00e+00 | 6.09e-11 | 0.0 | 0.8519 |
| 1. PBF | Q9Z6E4 | Chaperone protein ClpB | 0.00e+00 | 3.05e-11 | 0.0 | 0.9327 |
| 1. PBF | Q73K92 | Chaperone protein ClpB | 0.00e+00 | 1.20e-14 | 0.0 | 0.8538 |
| 1. PBF | Q7NWN7 | Chaperone protein ClpB | 0.00e+00 | 2.46e-13 | 0.0 | 0.8995 |
| 1. PBF | Q7VBL0 | Chaperone protein ClpB | 0.00e+00 | 9.90e-14 | 0.0 | 0.8801 |
| 1. PBF | Q5HQI5 | Chaperone protein ClpB | 0.00e+00 | 7.59e-15 | 0.0 | 0.8899 |
| 1. PBF | Q8FM94 | Chaperone protein ClpB | 0.00e+00 | 6.09e-11 | 0.0 | 0.8362 |
| 1. PBF | Q9PGC1 | Chaperone protein ClpB | 0.00e+00 | 4.59e-15 | 0.0 | 0.9559 |
| 1. PBF | P63286 | Chaperone protein ClpB | 0.00e+00 | 9.48e-12 | 0.0 | 0.9234 |
| 1. PBF | Q8DTC7 | Chaperone protein ClpB | 0.00e+00 | 1.44e-10 | 0.0 | 0.8537 |
| 1. PBF | Q9CB26 | Chaperone protein ClpB | 0.00e+00 | 1.25e-11 | 0.0 | 0.9536 |
| 1. PBF | Q6GAV1 | Chaperone protein ClpB | 0.00e+00 | 2.33e-14 | 0.0 | 0.8905 |
| 1. PBF | Q89UL2 | Chaperone protein ClpB | 0.00e+00 | 1.04e-13 | 0.0 | 0.9527 |
| 1. PBF | Q68XR2 | Chaperone protein ClpB | 0.00e+00 | 8.47e-15 | 0.0 | 0.8809 |
| 1. PBF | Q8Y570 | Chaperone protein ClpB | 0.00e+00 | 7.76e-14 | 0.0 | 0.8761 |
| 1. PBF | Q9JTP9 | Chaperone protein ClpB | 0.00e+00 | 2.29e-12 | 0.0 | 0.8895 |
| 1. PBF | Q8RHQ8 | Chaperone protein ClpB | 0.00e+00 | 6.09e-15 | 0.0 | 0.9081 |
| 1. PBF | O31673 | ATP-dependent Clp protease ATP-binding subunit ClpE | 0.00e+00 | 6.35e-27 | 0.0 | 0.7554 |
| 1. PBF | O34209 | Chaperone protein ClpB 2 | 0.00e+00 | 4.68e-14 | 0.0 | 0.9197 |
| 1. PBF | P63285 | Chaperone protein ClpB | 0.00e+00 | 9.48e-12 | 0.0 | 0.9385 |
| 1. PBF | Q8G4X4 | Chaperone protein ClpB | 0.00e+00 | 2.37e-11 | 0.0 | 0.8831 |
| 1. PBF | Q7M9X4 | Chaperone protein ClpB | 0.00e+00 | 2.14e-11 | 0.0 | 0.8302 |
| 1. PBF | Q73BY1 | Chaperone protein ClpB | 0.00e+00 | 6.98e-16 | 0.0 | 0.8708 |
| 1. PBF | Q5HD02 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 3.91e-20 | 3.18e-163 | 0.711 |
| 1. PBF | Q74FF1 | Chaperone protein ClpB | 0.00e+00 | 1.31e-12 | 0.0 | 0.8101 |
| 1. PBF | P0ABI0 | ATP-dependent Clp protease ATP-binding subunit ClpA | 0.00e+00 | 2.08e-13 | 8.41e-84 | 0.6585 |
| 1. PBF | Q8EU05 | Chaperone protein ClpB | 0.00e+00 | 2.76e-12 | 0.0 | 0.7823 |
| 1. PBF | Q8YM56 | Chaperone protein ClpB 2 | 0.00e+00 | 3.95e-14 | 0.0 | 0.8866 |
| 1. PBF | Q898C7 | Chaperone protein ClpB | 0.00e+00 | 3.96e-16 | 0.0 | 0.8556 |
| 1. PBF | Q7W9E6 | Chaperone protein ClpB | 0.00e+00 | 2.25e-12 | 0.0 | 0.9572 |
| 1. PBF | Q822Q4 | Chaperone protein ClpB | 0.00e+00 | 1.09e-15 | 0.0 | 0.8372 |
| 1. PBF | O83110 | Chaperone protein ClpB | 0.00e+00 | 5.36e-17 | 0.0 | 0.8375 |
| 1. PBF | Q8DG71 | Chaperone protein ClpB 2 | 0.00e+00 | 1.81e-12 | 0.0 | 0.864 |
| 1. PBF | P0ABI1 | ATP-dependent Clp protease ATP-binding subunit ClpA | 0.00e+00 | 2.08e-13 | 8.41e-84 | 0.6953 |
| 1. PBF | Q8EW28 | Chaperone protein ClpB | 0.00e+00 | 7.95e-88 | 0.0 | 0.8455 |
| 1. PBF | Q8YJ91 | Chaperone protein ClpB | 0.00e+00 | 2.00e-14 | 0.0 | 0.9326 |
| 1. PBF | Q8EBE6 | Chaperone protein ClpB | 0.00e+00 | 2.23e-14 | 0.0 | 0.969 |
| 1. PBF | Q7UBW5 | Chaperone protein ClpB | 0.00e+00 | 8.82e-12 | 0.0 | 0.9322 |
| 1. PBF | Q8YUL9 | Chaperone protein ClpB 1 | 0.00e+00 | 1.00e-12 | 0.0 | 0.8881 |
| 1. PBF | Q92JK8 | Chaperone protein ClpB | 0.00e+00 | 3.34e-15 | 0.0 | 0.9131 |
| 1. PBF | Q8CPT5 | Chaperone protein ClpB | 0.00e+00 | 4.51e-15 | 0.0 | 0.8859 |
| 1. PBF | O68185 | Chaperone protein ClpB | 0.00e+00 | 1.71e-15 | 0.0 | 0.8812 |
| 1. PBF | P31543 | Heat shock protein 100 | 0.00e+00 | 1.88e-14 | 0.0 | 0.8047 |
| 1. PBF | G2K265 | Chaperone protein ClpB | 0.00e+00 | 7.76e-14 | 0.0 | 0.8909 |
| 1. PBF | Q4UN57 | Chaperone protein ClpB | 0.00e+00 | 2.68e-15 | 0.0 | 0.8932 |
| 1. PBF | Q2FJB5 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7385 |
| 1. PBF | Q99R88 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 3.40e-20 | 1.65e-163 | 0.6953 |
| 1. PBF | Q9S5Z2 | ATP-dependent Clp protease ATP-binding subunit ClpE | 0.00e+00 | 7.96e-18 | 9.91e-94 | 0.6835 |
| 1. PBF | Q8NXY8 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 6.76e-14 | 0.0 | 0.7421 |
| 1. PBF | Q7WHB6 | Chaperone protein ClpB | 0.00e+00 | 2.76e-12 | 0.0 | 0.9558 |
| 1. PBF | Q83N78 | Chaperone protein ClpB | 0.00e+00 | 8.86e-77 | 0.0 | 0.8392 |
| 1. PBF | Q5XCL7 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 1.58e-25 | 8.89e-153 | 0.7591 |
| 1. PBF | Q1XDF4 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog | 0.00e+00 | 1.80e-15 | 0.0 | 0.744 |
| 1. PBF | Q87AX8 | Chaperone protein ClpB | 0.00e+00 | 4.66e-15 | 0.0 | 0.9513 |
| 1. PBF | P05444 | ClpA homolog protein | 0.00e+00 | 4.62e-09 | 4.58e-78 | 0.7215 |
| 1. PBF | Q7V8B1 | Chaperone protein ClpB | 0.00e+00 | 2.46e-12 | 0.0 | 0.9008 |
| 1. PBF | Q9HVN5 | Chaperone protein ClpB | 0.00e+00 | 1.47e-13 | 0.0 | 0.924 |
| 1. PBF | Q9A9T4 | Chaperone protein ClpB | 0.00e+00 | 2.15e-13 | 0.0 | 0.9445 |
| 1. PBF | Q82SD8 | Chaperone protein ClpB | 0.00e+00 | 7.30e-14 | 0.0 | 0.9057 |
| 1. PBF | Q92MK7 | Chaperone protein ClpB | 0.00e+00 | 1.93e-13 | 0.0 | 0.9151 |
| 1. PBF | P44403 | Chaperone protein ClpB | 0.00e+00 | 2.29e-12 | 0.0 | 0.9531 |
| 1. PBF | Q8CQ88 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 1.05e-13 | 0.0 | 0.7725 |
| 1. PBF | Q929G7 | Chaperone protein ClpB | 0.00e+00 | 8.88e-15 | 0.0 | 0.8895 |
| 1. PBF | Q9Z8A6 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 1.20e-12 | 0.0 | 0.7399 |
| 1. PBF | Q6GIB2 | Chaperone protein ClpB | 0.00e+00 | 1.79e-14 | 0.0 | 0.9044 |
| 1. PBF | Q7CU92 | Chaperone protein ClpB | 0.00e+00 | 7.01e-13 | 0.0 | 0.9229 |
| 1. PBF | Q9RVI3 | Chaperone protein ClpB | 0.00e+00 | 1.18e-14 | 0.0 | 0.8624 |
| 1. PBF | Q97KG0 | Chaperone protein ClpB | 0.00e+00 | 7.64e-14 | 0.0 | 0.8918 |
| 1. PBF | Q7MNK1 | Chaperone protein ClpB | 0.00e+00 | 1.68e-12 | 0.0 | 0.8612 |
| 1. PBF | Q7CEG6 | Chaperone protein ClpB | 0.00e+00 | 2.99e-14 | 0.0 | 0.9176 |
| 1. PBF | Q82EU9 | Chaperone protein ClpB 1 | 0.00e+00 | 5.63e-15 | 0.0 | 0.8873 |
| 1. PBF | P17422 | Chaperone protein ClpB | 0.00e+00 | 1.81e-12 | 0.0 | 0.8915 |
| 1. PBF | Q1RGR1 | Chaperone protein ClpB | 0.00e+00 | 4.59e-15 | 0.0 | 0.8941 |
| 1. PBF | Q9JYQ8 | Chaperone protein ClpB | 0.00e+00 | 8.90e-13 | 0.0 | 0.8821 |
| 1. PBF | Q99W78 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7717 |
| 1. PBF | Q98G96 | Chaperone protein ClpB | 0.00e+00 | 1.97e-12 | 0.0 | 0.9137 |
| 1. PBF | P24428 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 9.52e-11 | 0.0 | 0.7615 |
| 1. PBF | Q87S63 | Chaperone protein ClpB | 0.00e+00 | 3.98e-12 | 0.0 | 0.9762 |
| 1. PBF | Q6MD97 | Chaperone protein ClpB | 0.00e+00 | 3.53e-13 | 0.0 | 0.8467 |
| 1. PBF | Q9I742 | AAA+ ATPase ClpV1 | 6.66e-16 | 1.02e-07 | 2.19e-152 | 0.7437 |
| 1. PBF | Q4L3I4 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 4.68e-14 | 0.0 | 0.7772 |
| 1. PBF | Q831Y7 | Chaperone protein ClpB | 0.00e+00 | 3.59e-16 | 0.0 | 0.9544 |
| 1. PBF | A0R574 | ATP-dependent Clp protease ATP-binding subunit ClpC1 | 0.00e+00 | 7.98e-12 | 0.0 | 0.7569 |
| 1. PBF | Q49V34 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 3.04e-13 | 0.0 | 0.7825 |
| 1. PBF | Q73T66 | Chaperone protein ClpB | 0.00e+00 | 5.48e-12 | 0.0 | 0.9321 |
| 1. PBF | P63287 | Chaperone protein ClpB | 0.00e+00 | 9.21e-12 | 0.0 | 0.9479 |
| 1. PBF | P9WPD0 | Chaperone protein ClpB | 0.00e+00 | 9.21e-12 | 0.0 | 0.9533 |
| 1. PBF | Q7VJY3 | Chaperone protein ClpB | 0.00e+00 | 4.90e-14 | 0.0 | 0.8525 |
| 1. PBF | Q81GM5 | Chaperone protein ClpB | 0.00e+00 | 4.37e-15 | 0.0 | 0.8581 |
| 1. PBF | Q2FDV8 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 3.71e-20 | 8.04e-163 | 0.6788 |
| 1. PBF | P0A523 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 5.24e-12 | 0.0 | 0.757 |
| 1. PBF | P9WPC8 | ATP-dependent Clp protease ATP-binding subunit ClpC1 | 0.00e+00 | 3.15e-12 | 0.0 | 0.7621 |
| 1. PBF | Q9KU18 | Chaperone protein ClpB | 0.00e+00 | 3.22e-13 | 0.0 | 0.9268 |
| 1. PBF | Q7VNH1 | Chaperone protein ClpB | 0.00e+00 | 6.49e-15 | 0.0 | 0.9649 |
| 1. PBF | Q81TT4 | Chaperone protein ClpB | 0.00e+00 | 1.24e-15 | 0.0 | 0.921 |
| 1. PBF | Q73IE4 | Chaperone protein ClpB | 0.00e+00 | 5.78e-13 | 0.0 | 0.8851 |
| 1. PBF | Q7N788 | Chaperone protein ClpB | 0.00e+00 | 9.04e-14 | 0.0 | 0.9232 |
| 1. PBF | O67588 | Chaperone protein ClpB | 0.00e+00 | 5.85e-06 | 0.0 | 0.7437 |
| 1. PBF | Q83FI1 | Chaperone protein ClpB | 0.00e+00 | 2.50e-77 | 0.0 | 0.8357 |
| 1. PBF | Q8NXE7 | Chaperone protein ClpB | 0.00e+00 | 2.73e-14 | 0.0 | 0.8884 |
| 1. PBF | Q2YSD6 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 1.05e-13 | 0.0 | 0.7497 |
| 1. PBF | Q9CKC0 | Chaperone protein ClpB | 0.00e+00 | 1.11e-12 | 0.0 | 0.9565 |
| 1. PBF | Q7U3T3 | Chaperone protein ClpB 2 | 0.00e+00 | 9.71e-09 | 0.0 | 0.88 |
| 1. PBF | Q7U637 | Chaperone protein ClpB 1 | 0.00e+00 | 1.09e-12 | 0.0 | 0.8924 |
| 1. PBF | Q6N1H2 | Chaperone protein ClpB | 0.00e+00 | 2.04e-15 | 0.0 | 0.9063 |
| 1. PBF | Q826F2 | Chaperone protein ClpB 2 | 0.00e+00 | 8.90e-14 | 0.0 | 0.8969 |
| 1. PBF | Q7AJA9 | Chaperone protein ClpB | 0.00e+00 | 2.21e-13 | 0.0 | 0.9259 |
| 1. PBF | Q83F55 | Chaperone protein ClpB | 0.00e+00 | 1.09e-13 | 0.0 | 0.9119 |
| 1. PBF | Q06716 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 8.76e-11 | 1.13e-73 | 0.7156 |
| 1. PBF | Q7CQ01 | Chaperone protein ClpB | 0.00e+00 | 2.85e-12 | 0.0 | 0.9583 |
| 1. PBF | Q9CFF3 | Chaperone protein ClpB | 0.00e+00 | 2.04e-15 | 0.0 | 0.8616 |
| 1. PBF | Q89YY3 | Chaperone protein ClpB | 0.00e+00 | 7.22e-17 | 0.0 | 0.8666 |
| 1. PBF | Q8DJ40 | Chaperone protein ClpB 1 | 0.00e+00 | 4.73e-15 | 0.0 | 0.8898 |
| 1. PBF | O84115 | Chaperone protein ClpB | 0.00e+00 | 5.37e-14 | 0.0 | 0.9602 |
| 1. PBF | Q6GJE4 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | 0.7468 |
| 1. PBF | Q8P6A0 | Chaperone protein ClpB | 0.00e+00 | 1.49e-13 | 0.0 | 0.9613 |
| 1. PBF | Q8PHQ4 | Chaperone protein ClpB | 0.00e+00 | 1.87e-13 | 0.0 | 0.958 |
| 1. PBF | Q71XF9 | Chaperone protein ClpB | 0.00e+00 | 1.94e-14 | 0.0 | 0.8876 |
| 1. PBF | Q7UM33 | Chaperone protein ClpB | 0.00e+00 | 1.71e-11 | 0.0 | 0.8881 |
| 1. PBF | Q8CJV9 | Chaperone protein ClpB | 0.00e+00 | 3.34e-12 | 0.0 | 0.9018 |
| 1. PBF | Q9PKS5 | Chaperone protein ClpB | 0.00e+00 | 2.99e-15 | 0.0 | 0.945 |
| 1. PBF | P51332 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog | 0.00e+00 | 2.55e-15 | 0.0 | 0.7439 |
| 1. PBF | Q6G6C6 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 4.84e-20 | 3.11e-163 | 0.7041 |
| 1. PBF | Q6LMY0 | Chaperone protein ClpB | 0.00e+00 | 1.47e-12 | 0.0 | 0.9678 |
| 1. PBF | Q74X11 | Chaperone protein ClpB | 0.00e+00 | 7.75e-12 | 0.0 | 0.9101 |
| 1. PBF | Q8NUR7 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 4.84e-20 | 3.11e-163 | 0.6603 |
| 1. PBF | Q9ZEA9 | Chaperone protein ClpB | 0.00e+00 | 2.81e-14 | 0.0 | 0.8997 |
| 1. PBF | Q8DEV2 | Chaperone protein ClpB | 0.00e+00 | 2.35e-12 | 0.0 | 0.8762 |
| 1. PBF | Q8XZR0 | Chaperone protein ClpB | 0.00e+00 | 2.31e-13 | 0.0 | 0.8793 |
| 1. PBF | P71404 | Chaperone protein ClpB | 0.00e+00 | 8.38e-18 | 0.0 | 0.8861 |
| 1. PBF | Q7VYV6 | Chaperone protein ClpB | 0.00e+00 | 1.92e-12 | 0.0 | 0.9545 |
| 1. PBF | Q7NFE9 | Chaperone protein ClpB | 0.00e+00 | 1.02e-16 | 0.0 | 0.8766 |
| 1. PBF | Q7MVE7 | Chaperone protein ClpB | 0.00e+00 | 7.80e-20 | 0.0 | 0.8738 |
| 1. PBF | Q9ZMH1 | Chaperone protein ClpB | 0.00e+00 | 1.97e-17 | 0.0 | 0.8394 |
| 1. PBF | O84288 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 5.44e-13 | 0.0 | 0.7363 |
| 1. PBF | Q88VX7 | Chaperone protein ClpB | 0.00e+00 | 1.32e-13 | 0.0 | 0.8936 |
| 1. PBF | Q5HHB0 | Chaperone protein ClpB | 0.00e+00 | 2.33e-14 | 0.0 | 0.8841 |
| 1. PBF | Q72IK9 | Chaperone protein ClpB | 0.00e+00 | 2.41e-14 | 0.0 | 0.9659 |
| 1. PBF | Q9RA63 | Chaperone protein ClpB | 0.00e+00 | 5.44e-13 | 0.0 | 0.9658 |
| 1. PBF | Q7V2A3 | Chaperone protein ClpB | 0.00e+00 | 4.20e-14 | 0.0 | 0.8551 |
| 1. PBF | Q889C2 | Chaperone protein ClpB | 0.00e+00 | 1.13e-11 | 0.0 | 0.9638 |
| 1. PBF | Q6NF05 | Chaperone protein ClpB | 0.00e+00 | 1.83e-11 | 0.0 | 0.8363 |
| 1. PBF | Q7A3F4 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 3.40e-20 | 1.65e-163 | 0.6894 |
| 1. PBF | P31540 | Heat shock protein hsp98 | 0.00e+00 | 1.70e-12 | 0.0 | 0.9362 |
| 1. PBF | P49574 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog | 0.00e+00 | 3.42e-16 | 0.0 | 0.7713 |
| 1. PBF | Q7NAZ3 | Chaperone protein ClpB | 0.00e+00 | 3.68e-85 | 0.0 | 0.7894 |
| 1. PBF | Q2YWB1 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 1.87e-21 | 1.01e-164 | 0.7031 |
| 1. PBF | Q7AMH5 | Chaperone protein ClpB | 0.00e+00 | 2.85e-12 | 0.0 | 0.9342 |
| 1. PBF | Q88Q71 | Chaperone protein ClpB | 0.00e+00 | 1.13e-11 | 0.0 | 0.8573 |
| 1. PBF | P35594 | ATP-dependent Clp protease ATP-binding subunit ClpE | 0.00e+00 | 1.22e-18 | 9.19e-170 | 0.6786 |
| 1. PBF | Q9F746 | Chaperone protein ClpB | 0.00e+00 | 3.04e-10 | 9.72e-157 | 0.8199 |
| 1. PBF | Q54316 | Hemolysin B | 0.00e+00 | 7.98e-12 | 0.0 | 0.7457 |
| 1. PBF | Q72QU2 | Chaperone protein ClpB | 0.00e+00 | 2.17e-16 | 0.0 | 0.9624 |
| 1. PBF | Q99VB5 | Chaperone protein ClpB | 0.00e+00 | 2.64e-14 | 0.0 | 0.9045 |
| 1. PBF | Q9TM05 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog | 0.00e+00 | 3.03e-09 | 0.0 | 0.7248 |
| 1. PBF | P74361 | Chaperone protein ClpB 2 | 0.00e+00 | 1.33e-14 | 0.0 | 0.8658 |
| 1. PBF | Q9PKA8 | Probable ATP-dependent Clp protease ATP-binding subunit | 0.00e+00 | 9.75e-10 | 0.0 | 0.7493 |
| 1. PBF | Q7A6G6 | Chaperone protein ClpB | 0.00e+00 | 2.64e-14 | 0.0 | 0.8725 |
| 1. PBF | Q8F509 | Chaperone protein ClpB | 0.00e+00 | 2.24e-16 | 0.0 | 0.9321 |
| 2. PF | O78439 | Uncharacterized AAA domain-containing protein ycf46 | 4.17e-06 | 8.02e-04 | NA | 0.4192 |
| 2. PF | P51189 | Uncharacterized AAA domain-containing protein ycf46 | 6.76e-06 | 3.10e-02 | NA | 0.4159 |
| 2. PF | Q6B952 | Uncharacterized AAA domain-containing protein ycf46 | 7.23e-06 | 4.24e-03 | NA | 0.4062 |
| 3. BF | F2Z6D2 | Cell division protein C | 8.99e-05 | NA | 0.008 | 0.6038 |
| 3. BF | Q8PPP7 | ATP-dependent protease ATPase subunit HslU | 6.20e-03 | NA | 0.006 | 0.4467 |
| 3. BF | Q3T030 | 26S proteasome regulatory subunit 6B | 2.29e-04 | NA | 0.002 | 0.5071 |
| 3. BF | B3R057 | ATP-dependent zinc metalloprotease FtsH 1 | 1.33e-03 | NA | 0.003 | 0.5976 |
| 3. BF | Q8KA87 | Probable chaperone protein ClpB 2 | 0.00e+00 | NA | 5.49e-120 | 0.9355 |
| 3. BF | Q4R7L3 | 26S proteasome regulatory subunit 6B | 3.38e-04 | NA | 0.002 | 0.5058 |
| 3. BF | Q5WYQ8 | ATP-dependent protease ATPase subunit HslU | 1.44e-03 | NA | 0.001 | 0.4518 |
| 3. BF | B0S2N4 | Lon protease | 2.43e-04 | NA | 0.003 | 0.4105 |
| 3. BF | B0TFI9 | Lon protease | 9.91e-05 | NA | 0.001 | 0.3471 |
| 3. BF | P85200 | 26S proteasome regulatory subunit 6B homolog | 4.55e-04 | NA | 0.045 | 0.4737 |
| 3. BF | A9KH99 | Lon protease | 1.65e-04 | NA | 0.002 | 0.4047 |
| 3. BF | P35100 | Chaperone protein ClpC, chloroplastic | 0.00e+00 | NA | 0.0 | 0.7398 |
| 3. BF | A0R196 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.80e-06 | NA | 0.003 | 0.5648 |
| 3. BF | Q5GVM7 | ATP-dependent protease ATPase subunit HslU | 1.48e-03 | NA | 0.006 | 0.4455 |
| 3. BF | P31542 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic | 0.00e+00 | NA | 0.0 | 0.7424 |
| 3. BF | Q9RXG4 | Lon protease | 5.44e-05 | NA | 1.20e-04 | 0.3851 |
| 3. BF | A8F5A8 | ATP-dependent protease ATPase subunit HslU | 1.19e-02 | NA | 4.97e-04 | 0.4501 |
| 3. BF | Q5ZXU0 | ATP-dependent protease ATPase subunit HslU | 1.43e-03 | NA | 0.001 | 0.4487 |
| 3. BF | Q31GE9 | Lon protease 1 | 1.48e-04 | NA | 0.013 | 0.4022 |
| 3. BF | Q73XN1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.98e-06 | NA | 0.025 | 0.5767 |
| 3. BF | P31541 | ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic | 0.00e+00 | NA | 0.0 | 0.7394 |
| 3. BF | Q04A05 | ATP-dependent protease ATPase subunit HslU | 1.54e-03 | NA | 4.05e-05 | 0.4346 |
| 3. BF | B5YFG2 | Lon protease | 1.33e-04 | NA | 1.90e-05 | 0.398 |
| 3. BF | B2TFQ5 | Lon protease | 7.97e-05 | NA | 0.001 | 0.4197 |
| 3. BF | B2HSU9 | ESX-5 secretion system protein EccA5 | 5.25e-04 | NA | 0.046 | 0.2741 |
| 3. BF | Q3JBB6 | Lon protease | 6.66e-05 | NA | 4.07e-04 | 0.3842 |
| 4. PB | P63284 | Chaperone protein ClpB | 0.00e+00 | 9.48e-12 | 0.0 | NA |
| 4. PB | Q9LF37 | Chaperone protein ClpB3, chloroplastic | 0.00e+00 | 1.54e-07 | 0.0 | NA |
| 4. PB | P0ABH9 | ATP-dependent Clp protease ATP-binding subunit ClpA | 0.00e+00 | 2.08e-13 | 8.41e-84 | NA |
| 4. PB | P42730 | Chaperone protein ClpB1 | 0.00e+00 | 4.26e-18 | 0.0 | NA |
| 4. PB | Q96UX5 | Heat shock protein 78, mitochondrial | 0.00e+00 | 2.33e-26 | 0.0 | NA |
| 4. PB | Q0E3C8 | Chaperone protein ClpB3, mitochondrial | 0.00e+00 | 2.34e-04 | 0.0 | NA |
| 4. PB | Q6F2Y7 | Chaperone protein ClpB1 | 0.00e+00 | 3.00e-17 | 0.0 | NA |
| 4. PB | Q75GT3 | Chaperone protein ClpB2, chloroplastic | 0.00e+00 | 3.21e-07 | 0.0 | NA |
| 4. PB | O87444 | Chaperone protein ClpB | NA | 1.05e-13 | 0.0 | NA |
| 4. PB | Q2G0P5 | ATP-dependent Clp protease ATP-binding subunit ClpC | 0.00e+00 | 5.62e-14 | 0.0 | NA |
| 4. PB | O94641 | Heat shock protein 104 | 0.00e+00 | 3.32e-13 | 0.0 | NA |
| 4. PB | O74402 | Heat shock protein 78, mitochondrial | 0.00e+00 | 2.24e-26 | 0.0 | NA |
| 4. PB | P33416 | Heat shock protein 78, mitochondrial | 0.00e+00 | 9.44e-23 | 0.0 | NA |
| 4. PB | Q9FI56 | Chaperone protein ClpC1, chloroplastic | 0.00e+00 | 2.48e-02 | 0.0 | NA |
| 4. PB | P9WPD1 | Chaperone protein ClpB | 0.00e+00 | 9.21e-12 | 0.0 | NA |
| 4. PB | Q2FV74 | ATP-dependent Clp protease ATP-binding subunit ClpL | 0.00e+00 | 3.91e-20 | 3.18e-163 | NA |
| 4. PB | P31539 | Heat shock protein 104 | 0.00e+00 | 3.71e-16 | 0.0 | NA |
| 4. PB | Q6H795 | Chaperone protein ClpD1, chloroplastic | 0.00e+00 | 9.94e-03 | 0.0 | NA |
| 4. PB | P9WPC9 | ATP-dependent Clp protease ATP-binding subunit ClpC1 | 0.00e+00 | 5.24e-12 | 0.0 | NA |
| 4. PB | Q7XL03 | Chaperone protein ClpD2, chloroplastic | 0.00e+00 | 5.85e-05 | 0.0 | NA |
| 4. PB | Q8VYJ7 | Chaperone protein ClpB4, mitochondrial | 0.00e+00 | 7.27e-05 | 0.0 | NA |
| 5. P | Q07844 | Ribosome biogenesis ATPase RIX7 | 2.36e-05 | 3.59e-02 | NA | NA |
| 6. F | A0PQT9 | Proteasome-associated ATPase | 1.16e-03 | NA | NA | 0.4842 |
| 6. F | C9Z319 | Proteasome-associated ATPase | 5.13e-04 | NA | NA | 0.5463 |
| 6. F | Q6A7F1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.10e-06 | NA | NA | 0.5798 |
| 6. F | A9NE17 | ATP-dependent zinc metalloprotease FtsH | 1.95e-03 | NA | NA | 0.5099 |
| 6. F | Q9RH29 | Gas vesicle protein GvpN | 9.29e-04 | NA | NA | 0.4022 |
| 6. F | Q6NVR9 | ATPase family AAA domain-containing protein 3 | 1.98e-03 | NA | NA | 0.2858 |
| 6. F | P29570 | ORC1-type DNA replication protein | 4.57e-04 | NA | NA | 0.4846 |
| 6. F | Q6BJJ8 | Lon protease homolog 2, peroxisomal | 2.51e-03 | NA | NA | 0.267 |
| 6. F | P63346 | Proteasome-associated ATPase | 1.73e-03 | NA | NA | 0.513 |
| 6. F | P9WQN4 | Proteasome-associated ATPase | 1.06e-03 | NA | NA | 0.5146 |
| 6. F | A0JWY3 | Proteasome-associated ATPase | 2.16e-03 | NA | NA | 0.5091 |
| 6. F | Q9TLY2 | Protein CfxQ homolog | 7.86e-04 | NA | NA | 0.5635 |
| 6. F | Q5FUU1 | Chromosomal replication initiator protein DnaA | 3.06e-03 | NA | NA | 0.3589 |
| 6. F | B4SYA8 | Chromosomal replication initiator protein DnaA | 3.77e-03 | NA | NA | 0.3525 |
| 6. F | A7N926 | Chromosomal replication initiator protein DnaA | 4.41e-03 | NA | NA | 0.3251 |
| 6. F | B3PNH3 | ATP-dependent zinc metalloprotease FtsH | 1.65e-02 | NA | NA | 0.576 |
| 6. F | O33089 | ESX-1 secretion system protein EccA1 | 1.39e-03 | NA | NA | 0.3022 |
| 6. F | P54788 | Origin recognition complex subunit 1 | 2.87e-02 | NA | NA | 0.3287 |
| 6. F | P29569 | ORC1-type DNA replication protein | 5.08e-04 | NA | NA | 0.4575 |
| 6. F | P55530 | Uncharacterized AAA family ATPase y4kL | 1.91e-03 | NA | NA | 0.4388 |
| 6. F | A8FP46 | Chromosomal replication initiator protein DnaA | 4.80e-03 | NA | NA | 0.348 |
| 6. F | Q8Z2N6 | Chromosomal replication initiator protein DnaA | 1.14e-02 | NA | NA | 0.3408 |
| 6. F | C7MWW2 | Proteasome-associated ATPase | 1.11e-03 | NA | NA | 0.5087 |
| 6. F | O22034 | Protein CfxQ homolog | 6.88e-04 | NA | NA | 0.5763 |
| 6. F | Q9HN34 | ORC1-type DNA replication protein 6 | 2.84e-03 | NA | NA | 0.3954 |
| 6. F | Q21PW4 | Chromosomal replication initiator protein DnaA | 7.52e-03 | NA | NA | 0.3399 |
| 6. F | A3CYH5 | Chromosomal replication initiator protein DnaA | 3.48e-03 | NA | NA | 0.3349 |
| 6. F | Q7MAS4 | ATP-dependent Clp protease ATP-binding subunit ClpX 1 | 5.39e-06 | NA | NA | 0.5522 |
| 6. F | A0QNI9 | ESX-1 secretion system protein EccA1 | 7.08e-04 | NA | NA | 0.3185 |
| 6. F | Q8G3E7 | Chromosomal replication initiator protein DnaA | 4.75e-03 | NA | NA | 0.3465 |
| 6. F | Q9HI16 | Gas vesicle protein GvpN 1 | 1.00e-03 | NA | NA | 0.376 |
| 6. F | Q97WM8 | ORC1-type DNA replication protein 3 | 6.09e-04 | NA | NA | 0.4624 |
| 6. F | A9FDV9 | ATP-dependent zinc metalloprotease FtsH 2 | 1.26e-03 | NA | NA | 0.5718 |
| 6. F | Q9ZJL8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.39e-05 | NA | NA | 0.4814 |
| 6. F | C6DPU6 | Proteasome-associated ATPase | 1.52e-03 | NA | NA | 0.5132 |
| 6. F | B7NR04 | Chromosomal replication initiator protein DnaA | 5.03e-03 | NA | NA | 0.3208 |
| 6. F | Q9UZE8 | Uncharacterized ATP-binding protein PYRAB12000 | 4.07e-03 | NA | NA | 0.4041 |
| 6. F | O27463 | ORC1-type DNA replication protein 1 | 2.38e-03 | NA | NA | 0.4326 |
| 6. F | C7PVU9 | Proteasome-associated ATPase | 9.68e-05 | NA | NA | 0.5352 |
| 6. F | B6J8S3 | Chromosomal replication initiator protein DnaA | 5.33e-03 | NA | NA | 0.3599 |
| 6. F | P49541 | Uncharacterized AAA domain-containing protein ycf46 | 5.90e-06 | NA | NA | 0.4294 |
| 6. F | Q9CD28 | ESX-3 secretion system protein EccA3 | 5.42e-04 | NA | NA | 0.2908 |
| 6. F | Q5V883 | ORC1-type DNA replication protein 17 | 1.25e-03 | NA | NA | 0.5149 |
| 6. F | C0ZZV2 | Proteasome-associated ATPase | 8.33e-04 | NA | NA | 0.5048 |
| 6. F | C1AQ31 | Proteasome-associated ATPase | 2.41e-03 | NA | NA | 0.5124 |
| 6. F | D1A2S5 | Proteasome-associated ATPase | 1.19e-03 | NA | NA | 0.5358 |
| 6. F | D3K5L7 | Pachytene checkpoint protein 2 homolog | 5.79e-03 | NA | NA | 0.4962 |
| 6. F | Q5V7B0 | ORC1-type DNA replication protein 13 | 1.23e-03 | NA | NA | 0.4911 |
| 6. F | Q9HHR1 | ORC1-type DNA replication protein 5 | 1.23e-03 | NA | NA | 0.5086 |
| 6. F | Q0I0U8 | Chromosomal replication initiator protein DnaA | 3.96e-03 | NA | NA | 0.3455 |
| 6. F | B0TWF7 | Chromosomal replication initiator protein DnaA | 6.10e-03 | NA | NA | 0.339 |
| 6. F | P9WPI0 | ESX-5 secretion system protein EccA5 | 5.14e-04 | NA | NA | 0.2712 |
| 6. F | Q9MS99 | Protein CfxQ homolog | 7.88e-04 | NA | NA | 0.5501 |
| 6. F | B7IBH7 | Chromosomal replication initiator protein DnaA | 5.29e-03 | NA | NA | 0.3562 |
| 6. F | O83521 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.30e-04 | NA | NA | 0.5568 |
| 6. F | P46507 | 26S proteasome regulatory subunit 6B | 1.66e-04 | NA | NA | 0.5679 |
| 6. F | Q9HHZ9 | ORC1-type DNA replication protein 1 | 6.71e-04 | NA | NA | 0.4089 |
| 6. F | D5H7Z5 | ATP-dependent zinc metalloprotease FtsH 1 | 1.94e-03 | NA | NA | 0.5811 |
| 6. F | Q9HNP9 | Proteasome-activating nucleotidase 2 | 5.47e-05 | NA | NA | 0.4964 |
| 6. F | C1D6I2 | Chromosomal replication initiator protein DnaA | 1.27e-03 | NA | NA | 0.3168 |
| 6. F | O26824 | Proteasome-activating nucleotidase | 5.14e-04 | NA | NA | 0.4982 |
| 6. F | A8GYE3 | Chromosomal replication initiator protein DnaA | 4.72e-03 | NA | NA | 0.3477 |
| 6. F | Q48U22 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.02e-06 | NA | NA | 0.5837 |
| 6. F | Q59549 | Chromosomal replication initiator protein DnaA | 6.24e-03 | NA | NA | 0.414 |
| 6. F | A3LUF7 | Lon protease homolog 2, peroxisomal | 1.60e-02 | NA | NA | 0.4602 |
| 6. F | D2Q4G5 | Proteasome-associated ATPase | 1.76e-03 | NA | NA | 0.5394 |
| 6. F | D0LDS6 | Proteasome-associated ATPase | 2.80e-03 | NA | NA | 0.5017 |
| 6. F | Q8YED5 | Chromosomal replication initiator protein DnaA | 5.01e-03 | NA | NA | 0.3554 |
| 6. F | Q9L7L7 | Chromosomal replication initiator protein DnaA | 3.36e-03 | NA | NA | 0.4169 |
| 6. F | Q2A640 | Chromosomal replication initiator protein DnaA | 5.40e-03 | NA | NA | 0.3192 |
| 6. F | Q1B795 | Proteasome-associated ATPase | 2.17e-03 | NA | NA | 0.4829 |
| 6. F | A6STW2 | Chromosomal replication initiator protein DnaA | 9.16e-03 | NA | NA | 0.3429 |
| 6. F | Q8XBZ3 | Chromosomal replication initiator protein DnaA | 3.94e-03 | NA | NA | 0.3126 |
| 6. F | Q2YD61 | Chromosomal replication initiator protein DnaA | 5.17e-03 | NA | NA | 0.3415 |
| 6. F | B0TLA4 | Chromosomal replication initiator protein DnaA | 6.34e-03 | NA | NA | 0.3427 |
| 6. F | A1K1B4 | Chromosomal replication initiator protein DnaA | 4.43e-03 | NA | NA | 0.4924 |
| 6. F | Q57G10 | Chromosomal replication initiator protein DnaA | 4.68e-03 | NA | NA | 0.3438 |
| 6. F | P27643 | Stage V sporulation protein K | 1.37e-03 | NA | NA | 0.511 |
| 6. F | Q6KI22 | Lon protease | 1.35e-04 | NA | NA | 0.3863 |
| 6. F | P40118 | Protein CbxX, chromosomal | 1.70e-04 | NA | NA | 0.5401 |
| 6. F | A6VR65 | Chromosomal replication initiator protein DnaA | 2.14e-02 | NA | NA | 0.2989 |
| 6. F | Q980N4 | ORC1-type DNA replication protein 1 | 3.91e-03 | NA | NA | 0.4872 |
| 6. F | Q8TUI2 | ORC1-type DNA replication protein 2 | 2.28e-03 | NA | NA | 0.403 |
| 6. F | A1TAQ3 | Proteasome-associated ATPase | 9.43e-04 | NA | NA | 0.495 |
| 6. F | Q1J741 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.00e-07 | NA | NA | 0.5864 |
| 6. F | B5FN10 | Chromosomal replication initiator protein DnaA | 3.78e-03 | NA | NA | 0.3523 |
| 6. F | P63745 | ESX-5 secretion system protein EccA5 | 4.53e-04 | NA | NA | 0.2767 |
| 6. F | A0L516 | Lon protease | 1.48e-04 | NA | NA | 0.3445 |
| 6. F | Q0BPB6 | Chromosomal replication initiator protein DnaA | 5.36e-03 | NA | NA | 0.3314 |
| 6. F | Q5H432 | Lon protease | 2.97e-04 | NA | NA | 0.417 |
| 6. F | P95648 | Protein CbbX | 3.45e-04 | NA | NA | 0.5424 |
| 6. F | B0T135 | Chromosomal replication initiator protein DnaA | 7.71e-03 | NA | NA | 0.3564 |
| 6. F | C5BKL9 | Chromosomal replication initiator protein DnaA | 1.09e-02 | NA | NA | 0.3108 |
| 6. F | Q6PAX2 | ATPase family AAA domain-containing protein 3-B | 4.23e-03 | NA | NA | 0.2789 |
| 6. F | A0RYN2 | ORC1-type DNA replication protein | 1.55e-03 | NA | NA | 0.4805 |
| 6. F | Q04540 | Protein CbxX, plasmid | 1.77e-04 | NA | NA | 0.5315 |
| 6. F | Q1GN68 | Chromosomal replication initiator protein DnaA | 5.80e-03 | NA | NA | 0.3521 |
| 6. F | B8H8L3 | Proteasome-associated ATPase | 1.92e-03 | NA | NA | 0.513 |
| 6. F | B7GUX5 | Chromosomal replication initiator protein DnaA | 5.55e-03 | NA | NA | 0.3708 |
| 6. F | A3M0Q4 | Chromosomal replication initiator protein DnaA | 5.86e-03 | NA | NA | 0.3592 |
| 6. F | Q9HHS9 | Gas vesicle protein GvpN 2 | 1.79e-03 | NA | NA | 0.3608 |
| 6. F | C7LYP4 | Proteasome-associated ATPase | 6.43e-04 | NA | NA | 0.5254 |
| 6. F | D4GUJ7 | Proteasome-activating nucleotidase 1 | 5.94e-05 | NA | NA | 0.5 |
| 6. F | Q6P4W8 | Pachytene checkpoint protein 2 homolog | 4.85e-03 | NA | NA | 0.4853 |
| 6. F | A1KKF8 | Proteasome-associated ATPase | 1.50e-03 | NA | NA | 0.5032 |
| 6. F | Q97BC2 | Replication factor C large subunit | 7.51e-04 | NA | NA | 0.4907 |
| 6. F | Q8E4L8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.30e-06 | NA | NA | 0.6127 |
| 6. F | A1A0U4 | AAA ATPase forming ring-shaped complexes | 1.23e-03 | NA | NA | 0.5502 |
| 6. F | Q96YK7 | ORC1-type DNA replication protein 3 | 6.53e-04 | NA | NA | 0.4764 |
| 6. F | Q31UV5 | Chromosomal replication initiator protein DnaA | 4.67e-03 | NA | NA | 0.3465 |
| 6. F | Q0HPD4 | Chromosomal replication initiator protein DnaA | 4.88e-03 | NA | NA | 0.3397 |
| 6. F | L8FMA1 | ESX-1 secretion system protein EccA1 | 1.48e-03 | NA | NA | 0.3165 |
| 6. F | Q47NX7 | Proteasome-associated ATPase | 2.13e-03 | NA | NA | 0.5199 |
| 6. F | O27092 | Putative 26S proteasome regulatory subunit homolog MTH_1011 | 2.80e-03 | NA | NA | 0.5341 |
| 6. F | E2R222 | Pachytene checkpoint protein 2 homolog | 7.15e-03 | NA | NA | 0.4751 |
| 6. F | Q6KZL0 | ORC1-type DNA replication protein | 3.42e-03 | NA | NA | 0.4877 |
| 6. F | Q58E76 | ATPase family AAA domain-containing protein 3-A | 3.64e-03 | NA | NA | 0.273 |
| 6. F | D2ATX1 | Proteasome-associated ATPase | 1.17e-03 | NA | NA | 0.5302 |
| 6. F | C6DGH7 | Chromosomal replication initiator protein DnaA | 3.86e-03 | NA | NA | 0.3281 |
| 6. F | Q5V7E8 | ORC1-type DNA replication protein 14 | 1.48e-03 | NA | NA | 0.5009 |
| 6. F | A6WH85 | Chromosomal replication initiator protein DnaA | 5.26e-03 | NA | NA | 0.3359 |
| 6. F | Q2NKC5 | Chromosomal replication initiator protein DnaA | 2.31e-03 | NA | NA | 0.3713 |
| 6. F | Q5P4P0 | Chromosomal replication initiator protein DnaA | 5.57e-03 | NA | NA | 0.4698 |
| 6. F | B2S3A2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.25e-06 | NA | NA | 0.5493 |
| 6. F | P9WPH8 | ESX-1 secretion system protein EccA1 | 1.06e-03 | NA | NA | 0.316 |
| 6. F | Q02441 | Denitrification regulatory protein NirQ | 8.45e-04 | NA | NA | 0.5459 |
| 6. F | Q4JAB4 | ORC1-type DNA replication protein 2 | 2.91e-03 | NA | NA | 0.4503 |
| 6. F | P56369 | ATP-dependent zinc metalloprotease FtsH homolog | 3.17e-01 | NA | NA | 0.3813 |
| 6. F | Q5GT09 | Chromosomal replication initiator protein DnaA | 3.68e-03 | NA | NA | 0.3727 |
| 6. F | P49826 | Protein CfxQ homolog | 1.55e-03 | NA | NA | 0.5649 |
| 6. F | P55150 | Gas vesicle protein GvpN | 1.42e-04 | NA | NA | 0.394 |
| 6. F | A8GVN1 | Chromosomal replication initiator protein DnaA | 1.12e-02 | NA | NA | 0.3649 |
| 6. F | O78450 | Protein CfxQ homolog | 1.42e-03 | NA | NA | 0.5755 |
| 6. F | A0KR35 | Chromosomal replication initiator protein DnaA | 5.06e-03 | NA | NA | 0.3354 |
| 6. F | B0VMK0 | Chromosomal replication initiator protein DnaA | 5.57e-03 | NA | NA | 0.3606 |
| 6. F | Q9HKG3 | ORC1-type DNA replication protein 2 | 1.59e-03 | NA | NA | 0.5324 |
| 6. F | A9KU72 | Chromosomal replication initiator protein DnaA | 4.20e-03 | NA | NA | 0.3352 |
| 6. F | Q7P259 | Chromosomal replication initiator protein DnaA | 2.61e-03 | NA | NA | 0.3318 |
| 6. F | A1S1G9 | Chromosomal replication initiator protein DnaA | 5.14e-03 | NA | NA | 0.3427 |
| 6. F | Q5NIQ8 | Chromosomal replication initiator protein DnaA | 5.37e-03 | NA | NA | 0.3175 |
| 6. F | B8CH71 | Chromosomal replication initiator protein DnaA | 3.58e-03 | NA | NA | 0.3231 |
| 6. F | Q1GC43 | Chromosomal replication initiator protein DnaA | 3.91e-03 | NA | NA | 0.3704 |
| 6. F | Q2GE60 | Lon protease | 1.03e-04 | NA | NA | 0.393 |
| 6. F | B3R0R7 | ATP-dependent zinc metalloprotease FtsH 3 | 1.35e-03 | NA | NA | 0.4747 |
| 6. F | A4IVR6 | Chromosomal replication initiator protein DnaA | 5.28e-03 | NA | NA | 0.3251 |
| 6. F | A0QZ54 | Proteasome-associated ATPase | 1.17e-03 | NA | NA | 0.498 |
| 6. F | P33289 | Peroxisomal biogenesis factor 6 | 3.90e-04 | NA | NA | 0.4149 |
| 6. F | Q2IIK1 | Lon protease | 9.26e-05 | NA | NA | 0.4448 |
| 6. F | Q1XDQ9 | Protein CfxQ homolog | 2.13e-04 | NA | NA | 0.5382 |
| 6. F | B2G4Y5 | Chromosomal replication initiator protein DnaA | 5.24e-03 | NA | NA | 0.3748 |
| 6. F | Q9Z8M9 | Chromosomal replication initiator protein DnaA 1 | 6.10e-03 | NA | NA | 0.3422 |
| 6. F | Q8FTE3 | AAA ATPase forming ring-shaped complexes | 7.04e-04 | NA | NA | 0.4946 |
| 6. F | D2NT89 | AAA ATPase forming ring-shaped complexes | 4.91e-03 | NA | NA | 0.461 |
| 6. F | B0VAF3 | Chromosomal replication initiator protein DnaA | 3.20e-03 | NA | NA | 0.4282 |
| 6. F | A0QFB2 | Proteasome-associated ATPase | 8.87e-04 | NA | NA | 0.5033 |
| 6. F | P03974 | Transitional endoplasmic reticulum ATPase | 1.06e-05 | NA | NA | 0.3049 |
| 6. F | Q1JHC2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.28e-07 | NA | NA | 0.5937 |
| 6. F | B7NF19 | Chromosomal replication initiator protein DnaA | 5.38e-03 | NA | NA | 0.3406 |
| 6. F | Q828J2 | Proteasome-associated ATPase | 4.91e-04 | NA | NA | 0.5261 |
| 6. F | P34028 | Chromosomal replication initiator protein DnaA | 7.25e-03 | NA | NA | 0.3831 |
| 6. F | A2XUN8 | Pachytene checkpoint protein 2 homolog | 9.01e-03 | NA | NA | 0.4802 |
| 6. F | A0Q3U7 | Chromosomal replication initiator protein DnaA | 5.15e-03 | NA | NA | 0.3196 |
| 6. F | E1C6Q1 | Pachytene checkpoint protein 2 homolog | 6.40e-03 | NA | NA | 0.5004 |
| 6. F | Q6ML73 | Lon protease 1 | 8.60e-05 | NA | NA | 0.4182 |
| 6. F | M1UXG8 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 6.15e-05 | NA | NA | 0.5438 |
| 6. F | Q12TC8 | Chromosomal replication initiator protein DnaA | 4.89e-03 | NA | NA | 0.3535 |
| 6. F | A7FPB7 | Chromosomal replication initiator protein DnaA | 3.81e-03 | NA | NA | 0.352 |
| 6. F | A7YWC4 | ATPase family AAA domain-containing protein 3 | 1.46e-05 | NA | NA | 0.2682 |
| 6. F | A3Q8S6 | Chromosomal replication initiator protein DnaA | 5.13e-03 | NA | NA | 0.3379 |
| 6. F | Q6BSE2 | Origin recognition complex subunit 1 | 2.04e-02 | NA | NA | 0.4536 |
| 6. F | P61243 | Protein Ycf2 | 2.21e-01 | NA | NA | 0.2988 |
| 6. F | Q1CCJ8 | Chromosomal replication initiator protein DnaA | 5.30e-03 | NA | NA | 0.3439 |
| 6. F | A9N9F8 | ATP-dependent protease ATPase subunit HslU | 3.35e-03 | NA | NA | 0.4493 |
| 6. F | D1BS23 | Proteasome-associated ATPase | 2.39e-03 | NA | NA | 0.4828 |
| 6. F | P23013 | Protein CfxQ | 1.87e-04 | NA | NA | 0.5431 |
| 6. F | Q6YRL3 | Chromosomal replication initiator protein DnaA | 3.44e-03 | NA | NA | 0.3843 |
| 6. F | C7R400 | Proteasome-associated ATPase | 2.29e-03 | NA | NA | 0.4554 |
| 6. F | Q04HR6 | Chromosomal replication initiator protein DnaA | 1.50e-02 | NA | NA | 0.384 |
| 6. F | P9WPI2 | ESX-3 secretion system protein EccA3 | 5.07e-04 | NA | NA | 0.3054 |
| 6. F | B2HZA7 | Chromosomal replication initiator protein DnaA | 5.73e-03 | NA | NA | 0.3784 |
| 6. F | B1KCX3 | Chromosomal replication initiator protein DnaA | 3.88e-03 | NA | NA | 0.3369 |
| 6. F | Q74M34 | Chromosomal replication initiator protein DnaA | 3.41e-03 | NA | NA | 0.3754 |
| 6. F | D2Q9C6 | AAA ATPase forming ring-shaped complexes | 2.38e-04 | NA | NA | 0.5212 |
| 6. F | Q1XDU8 | Uncharacterized AAA domain-containing protein ycf46 | 8.36e-06 | NA | NA | 0.3995 |
| 6. F | O25926 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.61e-03 | NA | NA | 0.4726 |
| 6. F | Q4JCP8 | ORC1-type DNA replication protein 3 | 7.20e-04 | NA | NA | 0.4666 |
| 6. F | Q97AP1 | ORC1-type DNA replication protein | 2.24e-03 | NA | NA | 0.4826 |
| 6. F | A1RDX7 | Chromosomal replication initiator protein DnaA | 5.45e-03 | NA | NA | 0.3348 |
| 6. F | Q6NDV3 | Chromosomal replication initiator protein DnaA | 6.87e-03 | NA | NA | 0.3798 |
| 6. F | A0L3I7 | Chromosomal replication initiator protein DnaA | 1.30e-03 | NA | NA | 0.3509 |
| 6. F | Q0AWF3 | Lon protease | 7.92e-05 | NA | NA | 0.4281 |
| 6. F | O50202 | Proteasome-associated ATPase | 3.22e-03 | NA | NA | 0.5049 |
| 6. F | Q8A5U5 | Chromosomal replication initiator protein DnaA | 4.48e-03 | NA | NA | 0.3559 |
| 6. F | O83047 | Chromosomal replication initiator protein DnaA | 4.43e-03 | NA | NA | 0.3947 |
| 6. F | A9KEU8 | Chromosomal replication initiator protein DnaA | 5.28e-03 | NA | NA | 0.3398 |
| 6. F | Q51481 | Denitrification regulatory protein NirQ | 6.93e-04 | NA | NA | 0.5902 |
| 6. F | Q1JM77 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.85e-06 | NA | NA | 0.586 |
| 6. F | A5U4E1 | Proteasome-associated ATPase | 2.93e-03 | NA | NA | 0.4973 |
| 6. F | A5WP89 | Proteasome-associated ATPase | 2.37e-03 | NA | NA | 0.4937 |
| 6. F | Q8VVE4 | Putative chaperone BssE | 2.40e-03 | NA | NA | 0.4752 |
| 6. F | B0JL96 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.10e-06 | NA | NA | 0.5622 |
| 6. F | P51228 | Protein CfxQ homolog | 6.60e-04 | NA | NA | 0.5329 |
| 6. F | Q9HHJ7 | ORC1-type DNA replication protein 4 | 1.85e-03 | NA | NA | 0.4943 |
| 6. F | B6J287 | Chromosomal replication initiator protein DnaA | 5.20e-03 | NA | NA | 0.3609 |
| 6. F | O22025 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | 8.63e-04 | NA | NA | 0.5531 |
| 7. B | B5YG00 | ATP-dependent protease ATPase subunit HslU | 7.45e-03 | NA | 0.002 | NA |
| 7. B | Q1G9V4 | ATP-dependent protease ATPase subunit HslU | 2.41e-03 | NA | 3.07e-05 | NA |
| 7. B | A0Q2L0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.95e-06 | NA | 0.019 | NA |
| 7. B | A4S6Y4 | Lon protease homolog, mitochondrial | 3.88e-03 | NA | 0.037 | NA |
| 7. B | O64948 | Lon protease homolog 2, peroxisomal | 9.01e-05 | NA | 3.60e-04 | NA |
| 7. B | Q1B601 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.65e-06 | NA | 0.003 | NA |
| 7. B | C6DHM6 | ATP-dependent protease ATPase subunit HslU | 8.05e-03 | NA | 0.001 | NA |
| 7. B | A1WRK1 | ATP-dependent protease ATPase subunit HslU | 8.59e-03 | NA | 0.023 | NA |
| 7. B | B0BX22 | ATP-dependent protease ATPase subunit HslU | 2.87e-02 | NA | 0.008 | NA |
| 7. B | Q9M9L7 | Lon protease homolog 4, chloroplastic/mitochondrial | 4.36e-04 | NA | 0.002 | NA |
| 7. B | Q47JL8 | ATP-dependent protease ATPase subunit HslU | 9.27e-03 | NA | 0.001 | NA |
| 7. B | B8EMF2 | Lon protease | 6.99e-05 | NA | 0.001 | NA |
| 7. B | C1AVQ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.01e-06 | NA | 0.004 | NA |
| 7. B | B7IUI8 | ATP-dependent protease ATPase subunit HslU | 7.98e-03 | NA | 0.012 | NA |
| 7. B | Q44772 | ATP-dependent protease ATPase subunit HslU | 1.98e-03 | NA | 0.001 | NA |
| 7. B | B0US05 | ATP-dependent protease ATPase subunit HslU | 1.15e-02 | NA | 0.005 | NA |
| 7. B | A8AKZ1 | ATP-dependent protease ATPase subunit HslU | 8.80e-03 | NA | 8.43e-04 | NA |
| 7. B | Q8EV77 | Lon protease | 8.72e-05 | NA | 0.002 | NA |
| 7. B | Q146X0 | ATP-dependent protease ATPase subunit HslU | 1.58e-03 | NA | 0.001 | NA |
| 7. B | C0QJ36 | ATP-dependent protease ATPase subunit HslU | 8.80e-03 | NA | 0.049 | NA |
| 7. B | B1GZQ6 | Lon protease | 6.78e-05 | NA | 0.008 | NA |
| 7. B | Q68X52 | ATP-dependent protease ATPase subunit HslU | 6.56e-03 | NA | 0.002 | NA |
| 7. B | B8J198 | Lon protease | 2.23e-04 | NA | 0.007 | NA |
| 7. B | Q6Z517 | Protein SMAX1-like | 1.10e-03 | NA | 4.77e-12 | NA |
| 7. B | Q2L1D0 | ATP-dependent protease ATPase subunit HslU | 1.40e-02 | NA | 2.88e-04 | NA |
| 7. B | A1SQW3 | ATP-dependent protease ATPase subunit HslU | 1.06e-02 | NA | 3.49e-04 | NA |
| 7. B | Q043R3 | ATP-dependent protease ATPase subunit HslU | 3.57e-03 | NA | 3.35e-04 | NA |
| 7. B | A0AI82 | ATP-dependent protease ATPase subunit HslU | 3.38e-03 | NA | 0.040 | NA |
| 7. B | Q1MS21 | Lon protease | 8.21e-04 | NA | 0.014 | NA |
| 7. B | P36776 | Lon protease homolog, mitochondrial | 2.50e-04 | NA | 0.014 | NA |
| 7. B | B7JJA7 | ATP-dependent protease ATPase subunit HslU | 1.91e-03 | NA | 0.010 | NA |
| 7. B | Q9LML2 | Protein SMAX1-LIKE 6 | 5.85e-04 | NA | 1.45e-08 | NA |
| 7. B | P37945 | Lon protease 1 | 5.01e-05 | NA | 0.009 | NA |
| 7. B | B3QSJ7 | Lon protease | 1.18e-04 | NA | 0.005 | NA |
| 7. B | Q0VQ89 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.65e-06 | NA | 0.027 | NA |
| 7. B | A5VQN3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.43e-06 | NA | 0.009 | NA |
| 7. B | Q5F8W5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.25e-06 | NA | 0.040 | NA |
| 7. B | Q2Y5Y6 | ATP-dependent protease ATPase subunit HslU | 2.73e-03 | NA | 0.002 | NA |
| 7. B | C3L704 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.61e-06 | NA | 0.021 | NA |
| 7. B | B4RY96 | ATP-dependent protease ATPase subunit HslU | 8.28e-03 | NA | 0.005 | NA |
| 7. B | Q2W3I0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.74e-06 | NA | 0.041 | NA |
| 7. B | Q59185 | Lon protease 1 | 2.93e-04 | NA | 0.002 | NA |
| 7. B | A4YJU7 | ATP-dependent protease ATPase subunit HslU | 7.92e-03 | NA | 0.034 | NA |
| 7. B | P39778 | ATP-dependent protease ATPase subunit ClpY | 5.39e-03 | NA | 0.009 | NA |
| 7. B | A1WC16 | ATP-dependent protease ATPase subunit HslU | 1.22e-02 | NA | 0.019 | NA |
| 7. B | Q8UFY5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.00e-06 | NA | 0.041 | NA |
| 7. B | Q3YV47 | ATP-dependent protease ATPase subunit HslU | 6.89e-03 | NA | 0.001 | NA |
| 7. B | Q8DCP4 | ATP-dependent protease ATPase subunit HslU | 2.44e-03 | NA | 0.003 | NA |
| 7. B | B2ICL8 | ATP-dependent protease ATPase subunit HslU | 5.73e-03 | NA | 0.014 | NA |
| 7. B | A6LD45 | Lon protease | 6.61e-03 | NA | 0.007 | NA |
| 7. B | O30911 | ATP-dependent protease ATPase subunit HslU | 9.83e-03 | NA | 0.001 | NA |
| 7. B | Q5AZT7 | Lon protease homolog, mitochondrial | 3.36e-02 | NA | 0.002 | NA |
| 7. B | B7N2S2 | ATP-dependent protease ATPase subunit HslU | 3.24e-03 | NA | 0.001 | NA |
| 7. B | Q53N47 | Chaperone protein ClpC4, chloroplastic | 0.00e+00 | NA | 0.0 | NA |
| 7. B | B2VES3 | ATP-dependent protease ATPase subunit HslU | 8.89e-03 | NA | 0.001 | NA |
| 7. B | C3LSA3 | ATP-dependent protease ATPase subunit HslU | 7.81e-03 | NA | 6.17e-04 | NA |
| 7. B | B8ZRP1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.67e-06 | NA | 0.031 | NA |
| 7. B | Q7W216 | ATP-dependent protease ATPase subunit HslU | 1.13e-02 | NA | 5.24e-04 | NA |
| 7. B | B7VLM7 | ATP-dependent protease ATPase subunit HslU | 7.02e-03 | NA | 0.002 | NA |
| 7. B | A1K2I6 | ATP-dependent protease ATPase subunit HslU | 9.73e-03 | NA | 1.04e-04 | NA |
| 7. B | Q5PIR9 | ATP-dependent protease ATPase subunit HslU | 2.29e-03 | NA | 0.001 | NA |
| 7. B | C1DHS0 | ATP-dependent protease ATPase subunit HslU | 1.30e-02 | NA | 0.009 | NA |
| 7. B | A8ZW65 | ATP-dependent protease ATPase subunit HslU | 3.54e-03 | NA | 0.022 | NA |
| 7. B | B0SEC2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.32e-06 | NA | 0.009 | NA |
| 7. B | B3E1Z3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.21e-06 | NA | 0.010 | NA |
| 7. B | B4T0T8 | ATP-dependent protease ATPase subunit HslU | 2.43e-03 | NA | 0.001 | NA |
| 7. B | C5A098 | ATP-dependent protease ATPase subunit HslU | 7.99e-03 | NA | 0.001 | NA |
| 7. B | B8I8F6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.71e-06 | NA | 0.009 | NA |
| 7. B | B1WUD2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.97e-06 | NA | 2.68e-04 | NA |
| 7. B | Q1IPZ8 | Lon protease | 9.98e-05 | NA | 0.037 | NA |
| 7. B | P55995 | Lon protease | 7.81e-05 | NA | 0.027 | NA |
| 7. B | A4T2N8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.73e-06 | NA | 5.15e-04 | NA |
| 7. B | B8FVI0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.93e-06 | NA | 0.004 | NA |
| 7. B | Q21H71 | ATP-dependent protease ATPase subunit HslU | 1.25e-02 | NA | 0.006 | NA |
| 7. B | Q92C73 | ATP-dependent protease ATPase subunit HslU | 6.13e-03 | NA | 0.048 | NA |
| 7. B | Q636J7 | ATP-dependent protease ATPase subunit HslU | 6.56e-03 | NA | 0.010 | NA |
| 7. B | Q9CBY6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.00e-06 | NA | 0.031 | NA |
| 7. B | B2U7X3 | ATP-dependent protease ATPase subunit HslU | 2.36e-02 | NA | 0.003 | NA |
| 7. B | Q8XKK2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.50e-06 | NA | 0.001 | NA |
| 7. B | B8EIL3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.70e-06 | NA | 0.028 | NA |
| 7. B | Q1WTJ0 | ATP-dependent protease ATPase subunit HslU | 3.44e-03 | NA | 2.09e-05 | NA |
| 7. B | Q821L9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.03e-06 | NA | 0.020 | NA |
| 7. B | Q2QYW5 | Protein DWARF 53-LIKE | 7.62e-04 | NA | 6.67e-05 | NA |
| 7. B | Q4UM53 | ATP-dependent protease ATPase subunit HslU | 4.50e-03 | NA | 0.013 | NA |
| 7. B | Q9PD94 | ATP-dependent protease ATPase subunit HslU | 4.63e-03 | NA | 0.014 | NA |
| 7. B | A0LG61 | Lon protease 2 | 4.45e-05 | NA | 0.004 | NA |
| 7. B | A1S2P4 | ATP-dependent protease ATPase subunit HslU | 4.46e-03 | NA | 0.004 | NA |
| 7. B | A4VGE9 | ATP-dependent protease ATPase subunit HslU | 9.24e-03 | NA | 0.004 | NA |
| 7. B | Q8KFC3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.45e-06 | NA | 0.025 | NA |
| 7. B | Q9WYZ2 | ATP-dependent protease ATPase subunit HslU | 2.79e-03 | NA | 0.004 | NA |
| 7. B | Q2QVG9 | Chaperone protein ClpC2, chloroplastic | 0.00e+00 | NA | 0.0 | NA |
| 7. B | P0A6H6 | ATP-dependent protease ATPase subunit HslU | 6.51e-03 | NA | 0.001 | NA |
| 7. B | Q4X0Z7 | Lon protease homolog, mitochondrial | 3.71e-03 | NA | 0.024 | NA |
| 7. B | Q2LVS9 | Lon protease | 1.23e-04 | NA | 2.02e-04 | NA |
| 7. B | Q819X7 | ATP-dependent protease ATPase subunit HslU | 7.62e-03 | NA | 0.010 | NA |
| 7. B | B7J8H7 | ATP-dependent protease ATPase subunit HslU | 3.77e-03 | NA | 1.07e-04 | NA |
| 7. B | C5D8V9 | ATP-dependent protease ATPase subunit HslU | 4.23e-03 | NA | 0.037 | NA |
| 7. B | A6TM62 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.79e-06 | NA | 0.029 | NA |
| 7. B | P0A6H5 | ATP-dependent protease ATPase subunit HslU | 5.80e-03 | NA | 0.001 | NA |
| 7. B | Q9H078 | Caseinolytic peptidase B protein homolog | 9.05e-07 | NA | 1.73e-57 | NA |
| 7. B | B1L8X3 | ATP-dependent protease ATPase subunit HslU | 2.49e-03 | NA | 0.004 | NA |
| 7. B | A4WG67 | ATP-dependent protease ATPase subunit HslU | 6.53e-03 | NA | 0.001 | NA |
| 7. B | Q7KUT2 | Lon protease homolog, mitochondrial | 5.66e-02 | NA | 0.003 | NA |
| 7. B | B8CY73 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.06e-06 | NA | 0.001 | NA |
| 7. B | A8GN00 | ATP-dependent protease ATPase subunit HslU | 6.88e-03 | NA | 0.005 | NA |
| 7. B | B2JJX7 | ATP-dependent protease ATPase subunit HslU | 5.90e-03 | NA | 1.77e-04 | NA |
| 7. B | B5BJK8 | ATP-dependent protease ATPase subunit HslU | 8.45e-03 | NA | 0.001 | NA |
| 7. B | Q4QN49 | ATP-dependent protease ATPase subunit HslU | 8.60e-03 | NA | 0.005 | NA |
| 7. B | Q1LTT5 | ATP-dependent protease ATPase subunit HslU | 7.90e-03 | NA | 0.003 | NA |
| 7. B | B7HLG2 | ATP-dependent protease ATPase subunit HslU | 1.06e-02 | NA | 0.010 | NA |
| 7. B | P50866 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.01e-06 | NA | 0.011 | NA |
| 7. B | Q026Q2 | Lon protease | 6.57e-05 | NA | 0.001 | NA |
| 7. B | Q88W26 | ATP-dependent protease ATPase subunit HslU | 3.74e-03 | NA | 6.42e-04 | NA |
| 7. B | P42762 | Chaperone protein ClpD, chloroplastic | 1.81e-14 | NA | 0.0 | NA |
| 7. B | O44952 | Lon protease homolog, mitochondrial | 2.76e-02 | NA | 0.009 | NA |
| 7. B | B8F690 | ATP-dependent protease ATPase subunit HslU | 4.54e-03 | NA | 0.008 | NA |
| 7. B | Q6MBE8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.55e-06 | NA | 0.008 | NA |
| 7. B | Q5E2H3 | ATP-dependent protease ATPase subunit HslU | 9.01e-03 | NA | 0.005 | NA |
| 7. B | Q0VMA5 | ATP-dependent protease ATPase subunit HslU | 2.73e-03 | NA | 0.003 | NA |
| 7. B | B9JG71 | ATP-dependent protease ATPase subunit HslU | 3.26e-03 | NA | 0.035 | NA |
| 7. B | A8GRL8 | ATP-dependent protease ATPase subunit HslU | 5.74e-03 | NA | 0.008 | NA |
| 7. B | Q5L0N1 | ATP-dependent protease ATPase subunit HslU | 6.30e-03 | NA | 0.038 | NA |
| 7. B | B2V6N0 | Lon protease | 7.27e-04 | NA | 0.001 | NA |
| 7. B | P43686 | 26S proteasome regulatory subunit 6B | 2.20e-04 | NA | 0.002 | NA |
| 7. B | A8YV51 | ATP-dependent protease ATPase subunit HslU | 2.26e-03 | NA | 0.004 | NA |
| 7. B | A1TCB3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.76e-06 | NA | 8.15e-04 | NA |
| 7. B | Q72C17 | ATP-dependent protease ATPase subunit HslU | 3.67e-03 | NA | 0.018 | NA |
| 7. B | Q9YBS5 | Replication factor C large subunit | 8.37e-04 | NA | 0.025 | NA |
| 7. B | Q2T277 | ATP-dependent protease ATPase subunit HslU | 7.99e-03 | NA | 2.70e-04 | NA |
| 7. B | B4F171 | ATP-dependent protease ATPase subunit HslU | 9.23e-03 | NA | 2.23e-04 | NA |
| 7. B | Q6LVI3 | ATP-dependent protease ATPase subunit HslU | 6.51e-03 | NA | 2.66e-04 | NA |
| 7. B | Q8Y7J8 | ATP-dependent protease ATPase subunit HslU | 3.34e-03 | NA | 0.023 | NA |
| 7. B | B5YZ71 | ATP-dependent protease ATPase subunit HslU | 3.05e-03 | NA | 0.004 | NA |
| 7. B | B0RNK7 | ATP-dependent protease ATPase subunit HslU | 5.64e-03 | NA | 0.006 | NA |
| 7. B | A7GTF1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.44e-06 | NA | 0.019 | NA |
| 7. B | Q12019 | Midasin | NA | NA | 4.84e-05 | NA |
| 7. B | C3L798 | ATP-dependent protease ATPase subunit HslU | 1.13e-02 | NA | 0.010 | NA |
| 7. B | A0KQI8 | ATP-dependent protease ATPase subunit HslU | 8.34e-03 | NA | 0.009 | NA |
| 7. B | O74894 | 26S proteasome regulatory subunit 6B homolog | 2.11e-04 | NA | 0.027 | NA |
| 7. B | C4K5T0 | ATP-dependent protease ATPase subunit HslU | 3.03e-03 | NA | 0.004 | NA |
| 7. B | A9IMR3 | ATP-dependent protease ATPase subunit HslU | 4.90e-03 | NA | 0.043 | NA |
| 7. B | Q6AJQ6 | ATP-dependent protease ATPase subunit HslU | 4.25e-03 | NA | 0.009 | NA |
| 7. B | A0QDF5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.22e-06 | NA | 0.025 | NA |
| 7. B | Q32AA4 | ATP-dependent protease ATPase subunit HslU | 2.45e-03 | NA | 5.37e-04 | NA |
| 7. B | Q5WFQ1 | ATP-dependent protease ATPase subunit HslU | 5.40e-03 | NA | 0.008 | NA |
| 7. B | Q8F353 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.30e-06 | NA | 0.044 | NA |
| 7. B | O34528 | Uncharacterized AAA domain-containing protein YrvN | 2.81e-04 | NA | 0.020 | NA |
| 7. B | B9IZ47 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.68e-06 | NA | 0.021 | NA |
| 7. B | A8F187 | ATP-dependent protease ATPase subunit HslU | 7.43e-03 | NA | 0.005 | NA |
| 7. B | Q0ST54 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.81e-06 | NA | 0.001 | NA |
| 7. B | B5FPU0 | ATP-dependent protease ATPase subunit HslU | 2.62e-03 | NA | 0.001 | NA |
| 7. B | C4ZGF5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.59e-06 | NA | 0.017 | NA |
| 7. B | B5RF80 | ATP-dependent protease ATPase subunit HslU | 9.91e-03 | NA | 0.001 | NA |
| 7. B | Q97FT7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.48e-06 | NA | 0.004 | NA |
| 7. B | Q12IT8 | ATP-dependent protease ATPase subunit HslU | 8.35e-03 | NA | 0.003 | NA |
| 7. B | A5EWF3 | Lon protease | 6.34e-05 | NA | 0.005 | NA |
| 7. B | A1VDW3 | ATP-dependent protease ATPase subunit HslU | 6.62e-03 | NA | 0.017 | NA |
| 7. B | A4J7L6 | Lon protease | 7.47e-05 | NA | 0.003 | NA |
| 7. B | Q8CPH0 | ATP-dependent protease ATPase subunit HslU | 1.09e-02 | NA | 0.025 | NA |
| 7. B | Q7MH56 | ATP-dependent protease ATPase subunit HslU | 2.74e-03 | NA | 0.003 | NA |
| 7. B | Q9HUC5 | ATP-dependent protease ATPase subunit HslU | 1.07e-02 | NA | 0.003 | NA |
| 7. B | Q3BXT9 | ATP-dependent protease ATPase subunit HslU | 1.03e-03 | NA | 0.007 | NA |
| 7. B | Q81WK6 | ATP-dependent protease ATPase subunit HslU | 7.48e-03 | NA | 0.010 | NA |
| 7. B | B3GYW2 | ATP-dependent protease ATPase subunit HslU | 9.57e-03 | NA | 0.003 | NA |
| 7. B | B2A337 | ATP-dependent protease ATPase subunit HslU | 5.28e-03 | NA | 0.014 | NA |
| 7. B | P78578 | 26S proteasome regulatory subunit 6B homolog | 1.97e-04 | NA | 0.026 | NA |
| 7. B | Q9Z617 | ATP-dependent protease ATPase subunit HslU | 2.72e-03 | NA | 1.64e-05 | NA |
| 7. B | Q606K1 | ATP-dependent protease ATPase subunit HslU | 1.67e-02 | NA | 0.003 | NA |
| 7. B | Q88D27 | ATP-dependent protease ATPase subunit HslU | 1.13e-02 | NA | 0.004 | NA |
| 7. B | A8XFM8 | Lon protease homolog, mitochondrial | 2.18e-02 | NA | 0.005 | NA |
| 7. B | B4RCN8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.49e-06 | NA | 0.005 | NA |
| 7. B | Q5KWJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.60e-06 | NA | 0.006 | NA |
| 7. B | C1A1N6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.62e-06 | NA | 8.36e-04 | NA |
| 7. B | C3K8V3 | ATP-dependent protease ATPase subunit HslU | 1.09e-02 | NA | 0.001 | NA |
| 7. B | B5XZ37 | ATP-dependent protease ATPase subunit HslU | 1.01e-02 | NA | 0.001 | NA |
| 7. B | Q47XL9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.45e-06 | NA | 0.019 | NA |
| 7. B | Q1QRX6 | ATP-dependent protease ATPase subunit HslU | 4.15e-03 | NA | 0.011 | NA |
| 7. B | Q0AKC9 | ATP-dependent protease ATPase subunit HslU | 5.61e-03 | NA | 0.042 | NA |
| 7. B | B2RII6 | Lon protease | 1.08e-04 | NA | 0.008 | NA |
| 7. B | A5E8F5 | ATP-dependent protease ATPase subunit HslU | 7.41e-03 | NA | 0.012 | NA |
| 7. B | Q1MRI6 | ATP-dependent protease ATPase subunit HslU | 1.59e-02 | NA | 2.51e-04 | NA |
| 7. B | A5GFA1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.17e-06 | NA | 0.019 | NA |
| 7. B | Q1QVW2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.78e-06 | NA | 0.026 | NA |
| 7. B | Q9FHH2 | Protein SUPPRESSOR OF MAX2 1 | 1.76e-03 | NA | 8.11e-08 | NA |
| 7. B | Q72JM6 | Lon protease 2 | 1.84e-04 | NA | 1.53e-04 | NA |
| 7. B | Q0BM40 | ATP-dependent protease ATPase subunit HslU | 4.83e-03 | NA | 0.008 | NA |
| 7. B | A5EX25 | ATP-dependent protease ATPase subunit HslU | 1.23e-02 | NA | 6.97e-05 | NA |
| 7. B | P33298 | 26S proteasome regulatory subunit 6B homolog | 3.62e-04 | NA | 0.022 | NA |
| 7. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 1.26e-07 | NA | 3.73e-58 | NA |
| 7. B | B3PI65 | ATP-dependent protease ATPase subunit HslU | 5.86e-03 | NA | 0.002 | NA |
| 7. B | B9JXW4 | ATP-dependent protease ATPase subunit HslU | 1.38e-03 | NA | 0.031 | NA |
| 7. B | Q47W03 | ATP-dependent protease ATPase subunit HslU | 8.60e-03 | NA | 0.008 | NA |
| 7. B | A4TS84 | ATP-dependent protease ATPase subunit HslU | 7.58e-03 | NA | 0.001 | NA |
| 7. B | Q11CL4 | ATP-dependent protease ATPase subunit HslU | 8.22e-03 | NA | 0.029 | NA |
| 7. B | A7FCY4 | ATP-dependent protease ATPase subunit HslU | 1.10e-02 | NA | 0.001 | NA |
| 7. B | Q7WQZ4 | ATP-dependent protease ATPase subunit HslU | 1.49e-03 | NA | 5.97e-04 | NA |
| 7. B | A1AN84 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.14e-06 | NA | 0.002 | NA |
| 7. B | Q0AD37 | ATP-dependent protease ATPase subunit HslU | 6.90e-03 | NA | 0.008 | NA |
| 7. B | Q5HPT8 | ATP-dependent protease ATPase subunit HslU | 8.81e-03 | NA | 0.025 | NA |
| 7. B | C0ZAG3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.77e-06 | NA | 0.037 | NA |
| 7. B | B7HEA4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.41e-06 | NA | 0.023 | NA |
| 7. B | Q04TR3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.16e-06 | NA | 0.025 | NA |
| 7. B | Q5X7B0 | ATP-dependent protease ATPase subunit HslU | 7.57e-03 | NA | 0.001 | NA |
| 7. B | B7IIY3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.79e-06 | NA | 0.023 | NA |
| 7. B | A1TKC1 | ATP-dependent protease ATPase subunit HslU | 1.17e-02 | NA | 0.024 | NA |
| 7. B | Q3A1V6 | ATP-dependent protease ATPase subunit HslU | 9.67e-03 | NA | 0.009 | NA |
| 7. B | B7NFN0 | ATP-dependent protease ATPase subunit HslU | 2.61e-03 | NA | 0.001 | NA |
| 7. B | B2IGP2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.75e-06 | NA | 0.049 | NA |
| 7. B | A6VDH5 | ATP-dependent protease ATPase subunit HslU | 1.04e-02 | NA | 0.003 | NA |
| 7. B | Q633X2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.86e-06 | NA | 0.021 | NA |
| 7. B | A6WIH5 | ATP-dependent protease ATPase subunit HslU | 1.02e-02 | NA | 0.018 | NA |
| 7. B | Q9SEI4 | 26S proteasome regulatory subunit 6B homolog | 2.59e-04 | NA | 0.031 | NA |
| 7. B | O94248 | Midasin | NA | NA | 0.012 | NA |
| 7. B | Q8FBC0 | ATP-dependent protease ATPase subunit HslU | 2.57e-03 | NA | 0.001 | NA |
| 7. B | A7Z4N6 | ATP-dependent protease ATPase subunit ClpY | 5.69e-03 | NA | 0.015 | NA |
| 7. B | B5EDX8 | Lon protease | 8.36e-05 | NA | 0.010 | NA |
| 7. B | Q01357 | ATP-dependent protease ATP-binding subunit-like protein | 1.82e-12 | NA | 1.82e-41 | NA |
| 7. B | P93648 | Lon protease homolog, mitochondrial | 5.30e-04 | NA | 0.041 | NA |
| 7. B | Q48735 | ATP-dependent protease ATPase subunit HslU | 1.67e-03 | NA | 3.26e-05 | NA |
| 7. B | B1MMV6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.57e-06 | NA | 6.56e-04 | NA |
| 7. B | C4K1X4 | ATP-dependent protease ATPase subunit HslU | 5.96e-03 | NA | 0.008 | NA |
| 7. B | A3N333 | ATP-dependent protease ATPase subunit HslU | 9.52e-03 | NA | 0.003 | NA |
| 7. B | A5F4X3 | ATP-dependent protease ATPase subunit HslU | 7.72e-03 | NA | 5.86e-04 | NA |
| 7. B | B2T1N8 | ATP-dependent protease ATPase subunit HslU | 8.30e-03 | NA | 0.002 | NA |
| 7. B | Q975U2 | Proteasome-activating nucleotidase | 6.39e-04 | NA | 0.035 | NA |
| 7. B | B7MI63 | ATP-dependent protease ATPase subunit HslU | 2.65e-03 | NA | 0.001 | NA |
| 7. B | B8DG52 | ATP-dependent protease ATPase subunit HslU | 4.73e-03 | NA | 0.046 | NA |
| 7. B | B8IZJ2 | ATP-dependent protease ATPase subunit HslU | 3.00e-03 | NA | 0.005 | NA |
| 7. B | A8GL96 | ATP-dependent protease ATPase subunit HslU | 9.49e-03 | NA | 0.001 | NA |
| 7. B | C1ETR8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.05e-06 | NA | 0.021 | NA |
| 7. B | A9IH53 | ATP-dependent protease ATPase subunit HslU | 1.17e-02 | NA | 9.67e-05 | NA |
| 7. B | B0TFI7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.05e-06 | NA | 0.024 | NA |
| 7. B | Q052U5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.29e-06 | NA | 0.025 | NA |
| 7. B | Q5FKD8 | ATP-dependent protease ATPase subunit HslU | 2.00e-03 | NA | 0.003 | NA |
| 7. B | A9WGB5 | Lon protease | 3.87e-04 | NA | 0.041 | NA |
| 7. B | P57981 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.12e-06 | NA | 0.019 | NA |
| 7. B | A9ETZ9 | Lon protease 1 | 2.66e-03 | NA | 1.03e-04 | NA |
| 7. B | Q8R9Y3 | ATP-dependent protease ATPase subunit HslU | 8.10e-03 | NA | 0.027 | NA |
| 7. B | B7V3E7 | ATP-dependent protease ATPase subunit HslU | 1.25e-02 | NA | 0.003 | NA |
| 7. B | P57968 | ATP-dependent protease ATPase subunit HslU | 1.29e-02 | NA | 0.006 | NA |
| 7. B | B1LNN6 | ATP-dependent protease ATPase subunit HslU | 2.79e-03 | NA | 0.001 | NA |
| 7. B | Q3A334 | Lon protease 2 | 1.22e-04 | NA | 0.009 | NA |
| 7. B | Q476Y3 | ATP-dependent protease ATPase subunit HslU | 1.80e-02 | NA | 0.001 | NA |
| 7. B | Q92HZ1 | Lon protease | 5.06e-04 | NA | 0.022 | NA |
| 7. B | B5Y8Q8 | Lon protease | 5.31e-05 | NA | 0.014 | NA |
| 7. B | B1JQ76 | ATP-dependent protease ATPase subunit HslU | 9.60e-03 | NA | 0.001 | NA |
| 7. B | P93647 | Lon protease homolog 2, peroxisomal | 8.57e-04 | NA | 3.42e-04 | NA |
| 7. B | Q1IWD8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.27e-06 | NA | 0.001 | NA |
| 7. B | B9KBC9 | ATP-dependent protease ATPase subunit HslU | 3.71e-03 | NA | 0.003 | NA |
| 7. B | P59976 | ESX-2 secretion system protein EccA2 | 1.24e-03 | NA | 0.020 | NA |
| 7. B | Q8KD63 | ATP-dependent protease ATPase subunit HslU | 5.39e-03 | NA | 0.017 | NA |
| 7. B | B6IWI0 | ATP-dependent protease ATPase subunit HslU | 9.60e-03 | NA | 0.019 | NA |
| 7. B | Q7MYC1 | ATP-dependent protease ATPase subunit HslU | 1.03e-02 | NA | 3.11e-04 | NA |
| 7. B | A5IYF2 | Lon protease | 4.08e-04 | NA | 0.033 | NA |
| 7. B | Q5L4W6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.34e-06 | NA | 0.018 | NA |
| 7. B | Q5QV36 | ATP-dependent protease ATPase subunit HslU | 5.61e-03 | NA | 0.002 | NA |
| 7. B | B0KM26 | ATP-dependent protease ATPase subunit HslU | 1.18e-02 | NA | 0.004 | NA |
| 7. B | Q2YPX2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.56e-06 | NA | 0.009 | NA |
| 7. B | B8DPH7 | ATP-dependent protease ATPase subunit HslU | 5.17e-03 | NA | 0.018 | NA |
| 7. B | A7Z7B2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.63e-06 | NA | 0.020 | NA |
| 7. B | Q8CGK3 | Lon protease homolog, mitochondrial | 5.33e-04 | NA | 0.015 | NA |
| 7. B | Q74C83 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.53e-06 | NA | 4.81e-04 | NA |
| 7. B | A6TGC1 | ATP-dependent protease ATPase subunit HslU | 3.62e-03 | NA | 0.001 | NA |
| 7. B | A4XJL4 | Lon protease | 9.68e-05 | NA | 0.016 | NA |
| 7. B | Q6CNR9 | Lon protease homolog, mitochondrial | 3.29e-03 | NA | 2.47e-04 | NA |
| 7. B | B7M6Y2 | ATP-dependent protease ATPase subunit HslU | 2.89e-03 | NA | 0.001 | NA |
| 7. B | Q7F9I1 | Chaperone protein ClpC1, chloroplastic | 0.00e+00 | NA | 0.0 | NA |
| 7. B | Q0BSJ8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.54e-06 | NA | 0.011 | NA |
| 7. B | Q02EW3 | ATP-dependent protease ATPase subunit HslU | 1.76e-03 | NA | 0.003 | NA |
| 7. B | Q2RL30 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.77e-06 | NA | 0.005 | NA |
| 7. B | Q11QT3 | ATP-dependent protease ATPase subunit HslU | 5.04e-03 | NA | 0.016 | NA |
| 7. B | Q81LB9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.63e-06 | NA | 0.021 | NA |
| 7. B | B9M0Y2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.21e-06 | NA | 0.002 | NA |
| 7. B | P9WPH7 | ESX-2 secretion system protein EccA2 | 1.24e-03 | NA | 0.018 | NA |
| 7. B | B7IE26 | ATP-dependent protease ATPase subunit HslU | 2.81e-03 | NA | 0.002 | NA |
| 7. B | Q9K8F4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.87e-06 | NA | 0.034 | NA |
| 7. B | A4XPN6 | ATP-dependent protease ATPase subunit HslU | 1.22e-02 | NA | 0.003 | NA |
| 7. B | Q5SKM7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.38e-06 | NA | 0.013 | NA |
| 7. B | B7KBH7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.90e-06 | NA | 0.012 | NA |
| 7. B | A7GRF9 | ATP-dependent protease ATPase subunit HslU | 6.04e-03 | NA | 0.008 | NA |
| 7. B | Q6HEY6 | ATP-dependent protease ATPase subunit HslU | 1.05e-02 | NA | 0.010 | NA |
| 7. B | Q65RF7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.44e-06 | NA | 0.018 | NA |
| 7. B | Q2S9P3 | ATP-dependent protease ATPase subunit HslU | 1.27e-02 | NA | 6.16e-04 | NA |
| 7. B | B1IVE8 | ATP-dependent protease ATPase subunit HslU | 8.52e-03 | NA | 0.001 | NA |
| 7. B | Q30ZT5 | ATP-dependent protease ATPase subunit HslU | 2.44e-02 | NA | 0.006 | NA |
| 7. B | Q720E2 | ATP-dependent protease ATPase subunit HslU | 8.52e-03 | NA | 0.046 | NA |
| 7. B | B0KBA3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.68e-06 | NA | 0.022 | NA |
| 7. B | B5RL78 | Lon protease | 5.94e-04 | NA | 4.66e-04 | NA |
| 7. B | Q69UZ3 | Lon protease homolog, mitochondrial | 5.12e-04 | NA | 0.017 | NA |
| 7. B | A1TYU5 | ATP-dependent protease ATPase subunit HslU | 3.02e-03 | NA | 0.003 | NA |
| 7. B | A8A737 | ATP-dependent protease ATPase subunit HslU | 1.01e-02 | NA | 0.001 | NA |
| 7. B | Q87V00 | ATP-dependent protease ATPase subunit HslU | 8.42e-03 | NA | 0.001 | NA |
| 7. B | Q24SJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.55e-06 | NA | 0.004 | NA |
| 7. B | B0TZG2 | ATP-dependent protease ATPase subunit HslU | 7.44e-03 | NA | 0.008 | NA |
| 7. B | Q0KF69 | ATP-dependent protease ATPase subunit HslU | 4.62e-03 | NA | 0.001 | NA |
| 7. B | B8BDV1 | Lon protease homolog 2, peroxisomal | 1.27e-04 | NA | 3.81e-04 | NA |
| 7. B | Q72L14 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.36e-06 | NA | 0.015 | NA |
| 7. B | B5F0S2 | ATP-dependent protease ATPase subunit HslU | 2.70e-03 | NA | 0.001 | NA |
| 7. B | Q9RSZ6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.41e-06 | NA | 1.17e-04 | NA |
| 7. B | B8D8E2 | ATP-dependent protease ATPase subunit HslU | 1.25e-03 | NA | 4.25e-04 | NA |
| 7. B | Q056X2 | ATP-dependent protease ATPase subunit HslU | 6.66e-03 | NA | 1.06e-05 | NA |
| 7. B | Q9SXJ7 | Chaperone protein ClpC2, chloroplastic | 0.00e+00 | NA | 0.0 | NA |
| 7. B | Q6FPE6 | Lon protease homolog, mitochondrial | 3.25e-02 | NA | 5.80e-06 | NA |
| 7. B | Q4ULN0 | Lon protease | 1.00e-03 | NA | 0.029 | NA |
| 7. B | Q0SGZ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.01e-06 | NA | 0.004 | NA |
| 7. B | Q1I3T9 | ATP-dependent protease ATPase subunit HslU | 1.25e-02 | NA | 0.002 | NA |
| 7. B | Q6CZ91 | ATP-dependent protease ATPase subunit HslU | 1.05e-02 | NA | 8.73e-04 | NA |
| 7. B | B3QWK0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.58e-06 | NA | 0.012 | NA |
| 7. B | Q48PI5 | ATP-dependent protease ATPase subunit HslU | 9.65e-03 | NA | 0.004 | NA |
| 7. B | Q9M0C5 | Protein SMAX1-LIKE 2 | 1.08e-04 | NA | 1.81e-12 | NA |
| 7. B | Q9PK50 | Lon protease | 1.53e-04 | NA | 2.91e-07 | NA |
| 7. B | Q54YV4 | Lon protease homolog, mitochondrial 1 | 1.26e-03 | NA | 0.022 | NA |
| 7. B | Q59HJ6 | Lon protease homolog, mitochondrial | 2.70e-04 | NA | 0.005 | NA |
| 7. B | Q3KJB6 | ATP-dependent protease ATPase subunit HslU | 8.86e-03 | NA | 8.75e-04 | NA |
| 7. B | B7NU74 | ATP-dependent protease ATPase subunit HslU | 2.39e-03 | NA | 0.001 | NA |
| 7. B | Q4UYX6 | ATP-dependent protease ATPase subunit HslU | 1.38e-03 | NA | 0.006 | NA |
| 7. B | Q9M9L8 | Lon protease homolog 3, mitochondrial | 1.02e-03 | NA | 8.16e-05 | NA |
| 7. B | A8MIS7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.87e-06 | NA | 0.011 | NA |
| 7. B | Q817Q2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.99e-06 | NA | 0.023 | NA |
| 7. B | Q72SG5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.45e-06 | NA | 0.044 | NA |
| 7. B | Q65VY1 | ATP-dependent protease ATPase subunit HslU | 7.33e-03 | NA | 0.004 | NA |
| 7. B | Q2V573 | Lon protease homolog 2, peroxisomal | 5.85e-04 | NA | 0.001 | NA |
| 7. B | Q2J346 | ATP-dependent protease ATPase subunit HslU | 5.59e-03 | NA | 0.039 | NA |
| 7. B | Q31FD3 | Lon protease 2 | 1.20e-04 | NA | 0.012 | NA |
| 7. B | Q9ZDK8 | ATP-dependent protease ATPase subunit HslU | 6.93e-03 | NA | 0.002 | NA |
| 7. B | A4IRH2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.33e-06 | NA | 0.014 | NA |
| 7. B | A9R6C7 | ATP-dependent protease ATPase subunit HslU | 8.37e-03 | NA | 0.001 | NA |
| 7. B | B2SH45 | ATP-dependent protease ATPase subunit HslU | 7.73e-03 | NA | 0.008 | NA |
| 7. B | A1JI08 | ATP-dependent protease ATPase subunit HslU | 7.23e-03 | NA | 3.34e-04 | NA |
| 7. B | Q6HD54 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.33e-06 | NA | 0.021 | NA |
| 7. B | B1XB97 | ATP-dependent protease ATPase subunit HslU | 6.58e-03 | NA | 0.001 | NA |
| 7. B | A4SHM1 | ATP-dependent protease ATPase subunit HslU | 6.37e-03 | NA | 0.010 | NA |
| 7. B | Q7S8C4 | Lon protease homolog, mitochondrial | 2.09e-03 | NA | 0.005 | NA |
| 7. B | P57116 | ATP-dependent protease ATPase subunit HslU | 1.75e-03 | NA | 4.40e-04 | NA |
| 7. B | Q3SI99 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.86e-06 | NA | 0.001 | NA |
| 7. B | A8ZX50 | Lon protease | 3.07e-04 | NA | 0.002 | NA |
| 7. B | B5ENS6 | ATP-dependent protease ATPase subunit HslU | 9.17e-03 | NA | 1.07e-04 | NA |
| 7. B | B0K532 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.03e-05 | NA | 0.023 | NA |
| 7. B | B7FSL4 | Lon protease homolog, mitochondrial | 1.10e-04 | NA | 0.036 | NA |
| 7. B | O80875 | Protein SMAX1-LIKE 7 | 1.65e-03 | NA | 1.34e-04 | NA |
| 7. B | C1EP53 | ATP-dependent protease ATPase subunit HslU | 2.00e-03 | NA | 0.010 | NA |
| 7. B | P36773 | Lon protease 1 | 4.86e-05 | NA | 0.005 | NA |
| 7. B | B7HDV2 | ATP-dependent protease ATPase subunit HslU | 6.34e-03 | NA | 0.010 | NA |
| 7. B | A9MZI1 | ATP-dependent protease ATPase subunit HslU | 7.02e-03 | NA | 0.001 | NA |
| 7. B | B7GH25 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.14e-06 | NA | 0.001 | NA |
| 7. B | P54775 | 26S proteasome regulatory subunit 6B | 5.78e-05 | NA | 0.002 | NA |
| 7. B | Q869L3 | Midasin | NA | NA | 0.003 | NA |
| 7. B | P36775 | Lon protease homolog, mitochondrial | 1.55e-03 | NA | 3.58e-05 | NA |
| 7. B | B2A159 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.63e-06 | NA | 1.38e-06 | NA |
| 7. B | Q51416 | ATP-dependent protease ATP-binding subunit-like protein AmiB | 3.32e-10 | NA | 1.31e-51 | NA |
| 7. B | Q8Y3D8 | ATP-dependent protease ATPase subunit HslU | 2.27e-02 | NA | 0.004 | NA |
| 7. B | Q1RIB7 | ATP-dependent protease ATPase subunit HslU | 7.39e-03 | NA | 0.008 | NA |
| 7. B | B3QZS3 | ATP-dependent zinc metalloprotease FtsH 2 | 2.97e-03 | NA | 0.012 | NA |
| 7. B | B7LUS3 | ATP-dependent protease ATPase subunit HslU | 2.69e-03 | NA | 0.001 | NA |
| 7. B | B0K1T6 | ATP-dependent protease ATPase subunit HslU | 5.56e-03 | NA | 0.033 | NA |
| 7. B | B8GTA1 | ATP-dependent protease ATPase subunit HslU | 1.07e-02 | NA | 0.017 | NA |
| 7. B | Q834K4 | ATP-dependent protease ATPase subunit HslU | 9.95e-04 | NA | 0.003 | NA |
| 7. B | B3QPN4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.69e-06 | NA | 0.049 | NA |
| 7. B | Q1CBE8 | ATP-dependent protease ATPase subunit HslU | 1.03e-02 | NA | 0.001 | NA |
| 7. B | C0RJ80 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.60e-06 | NA | 0.009 | NA |
| 7. B | Q15N47 | ATP-dependent protease ATPase subunit HslU | 9.15e-03 | NA | 0.002 | NA |
| 7. B | Q8YHC7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.31e-06 | NA | 0.009 | NA |
| 7. B | Q74JJ5 | ATP-dependent protease ATPase subunit HslU | 3.17e-03 | NA | 3.75e-04 | NA |
| 7. B | Q7P112 | ATP-dependent protease ATPase subunit HslU | 4.50e-03 | NA | 0.012 | NA |
| 7. B | Q72ZV4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.42e-06 | NA | 0.021 | NA |
| 7. B | C5D5L4 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.07e-06 | NA | 0.015 | NA |
| 7. B | Q2A3M7 | ATP-dependent protease ATPase subunit HslU | 8.36e-03 | NA | 0.008 | NA |
| 7. B | C3P5N1 | ATP-dependent protease ATPase subunit HslU | 6.06e-03 | NA | 0.010 | NA |
| 7. B | A1SUW8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.34e-06 | NA | 0.014 | NA |
| 7. B | Q9XTT9 | 26S proteasome regulatory subunit 8 | 1.04e-04 | NA | 0.049 | NA |
| 7. B | C5BB81 | ATP-dependent protease ATPase subunit HslU | 7.36e-03 | NA | 0.002 | NA |
| 7. B | D5HA94 | ATP-dependent zinc metalloprotease FtsH 2 | 2.22e-03 | NA | 0.026 | NA |
| 7. B | Q57VB1 | ATP-dependent protease ATPase subunit HslU1 | 8.11e-03 | NA | 0.004 | NA |
| 7. B | Q4ZZF8 | ATP-dependent protease ATPase subunit HslU | 1.66e-02 | NA | 0.001 | NA |
| 7. B | O66605 | Lon protease | 3.08e-04 | NA | 1.50e-04 | NA |
| 7. B | B1J2T7 | ATP-dependent protease ATPase subunit HslU | 1.24e-02 | NA | 0.004 | NA |
| 7. B | Q0TAD3 | ATP-dependent protease ATPase subunit HslU | 2.61e-03 | NA | 0.001 | NA |
| 7. B | Q9KNQ7 | ATP-dependent protease ATPase subunit HslU | 7.18e-03 | NA | 0.001 | NA |
| 7. B | A2YQ56 | Lon protease homolog, mitochondrial | 8.43e-04 | NA | 0.017 | NA |
| 7. B | Q8KG79 | Probable chaperone protein ClpB 1 | 0.00e+00 | NA | 2.31e-121 | NA |
| 7. B | Q469F5 | Lon protease | 1.90e-04 | NA | 0.040 | NA |
| 7. B | B2S5W0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.39e-06 | NA | 0.021 | NA |
| 7. B | A4IM89 | ATP-dependent protease ATPase subunit HslU | 2.49e-03 | NA | 0.042 | NA |
| 7. B | Q8CXH1 | ATP-dependent protease ATPase subunit HslU | 5.32e-03 | NA | 0.003 | NA |
| 7. B | A6VL81 | ATP-dependent protease ATPase subunit HslU | 6.97e-03 | NA | 0.001 | NA |
| 7. B | Q0C0L1 | ATP-dependent protease ATPase subunit HslU | 4.09e-03 | NA | 0.018 | NA |
| 7. B | C0Q441 | ATP-dependent protease ATPase subunit HslU | 8.06e-03 | NA | 0.001 | NA |
| 7. B | B2IA20 | ATP-dependent protease ATPase subunit HslU | 1.43e-03 | NA | 0.015 | NA |
| 7. B | A1UJ35 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.82e-06 | NA | 0.003 | NA |
| 7. B | Q73M37 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.42e-06 | NA | 0.049 | NA |
| 7. B | C3P9F7 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.54e-06 | NA | 0.021 | NA |
| 7. B | Q7VKB3 | ATP-dependent protease ATPase subunit HslU | 7.04e-03 | NA | 0.035 | NA |
| 7. B | Q9C5U3 | 26S proteasome regulatory subunit 8 homolog A | 1.07e-04 | NA | 0.014 | NA |
| 7. B | B2JZC5 | ATP-dependent protease ATPase subunit HslU | 1.14e-02 | NA | 0.001 | NA |
| 7. B | O84348 | Lon protease | 1.52e-04 | NA | 6.67e-08 | NA |
| 7. B | A8EZD2 | ATP-dependent protease ATPase subunit HslU | 1.99e-03 | NA | 0.004 | NA |
| 7. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 4.07e-07 | NA | 1.07e-56 | NA |
| 7. B | Q0SY58 | ATP-dependent protease ATPase subunit HslU | 8.16e-03 | NA | 0.001 | NA |
| 7. B | O15885 | Heat shock protein 100 (Fragment) | 1.33e-05 | NA | 2.70e-16 | NA |
| 7. B | Q0J032 | Lon protease homolog 2, peroxisomal | 8.88e-05 | NA | 3.75e-04 | NA |
| 7. B | C5BRL0 | ATP-dependent protease ATPase subunit HslU | 3.42e-03 | NA | 1.09e-04 | NA |
| 7. B | B0BSG4 | ATP-dependent protease ATPase subunit HslU | 9.23e-03 | NA | 0.004 | NA |
| 7. B | Q2RBP2 | Protein DWARF 53 | 2.87e-03 | NA | 6.79e-05 | NA |
| 7. B | Q0TQK3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.76e-06 | NA | 0.001 | NA |
| 7. B | B3PWI7 | ATP-dependent protease ATPase subunit HslU | 1.73e-03 | NA | 0.042 | NA |
| 7. B | Q8Z2Z0 | ATP-dependent protease ATPase subunit HslU | 8.35e-03 | NA | 0.001 | NA |
| 7. B | Q9L7X5 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.35e-06 | NA | 0.009 | NA |
| 7. B | Q3JAJ9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.55e-06 | NA | 0.007 | NA |
| 7. B | Q92II6 | ATP-dependent protease ATPase subunit HslU | 3.52e-03 | NA | 0.008 | NA |
| 7. B | B2V6B0 | ATP-dependent protease ATPase subunit HslU | 9.03e-03 | NA | 0.001 | NA |
| 7. B | Q2Y6J1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.89e-06 | NA | 0.048 | NA |
| 7. B | Q2NQY1 | ATP-dependent protease ATPase subunit HslU | 7.52e-03 | NA | 0.002 | NA |
| 7. B | B5FBL8 | ATP-dependent protease ATPase subunit HslU | 6.88e-03 | NA | 0.005 | NA |
| 7. B | Q57HC6 | ATP-dependent protease ATPase subunit HslU | 2.38e-03 | NA | 0.001 | NA |
| 7. B | Q1R3Y6 | ATP-dependent protease ATPase subunit HslU | 2.40e-03 | NA | 0.001 | NA |
| 7. B | Q755E4 | Lon protease homolog 2, peroxisomal | 2.23e-04 | NA | 0.002 | NA |
| 7. B | A7ZEJ3 | Lon protease | 1.88e-04 | NA | 0.004 | NA |
| 7. B | B0SMF0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.16e-05 | NA | 0.009 | NA |
| 7. B | Q21CK9 | ATP-dependent protease ATPase subunit HslU | 9.78e-03 | NA | 0.049 | NA |
| 7. B | Q6MTF4 | Lon protease | 6.67e-05 | NA | 0.003 | NA |
| 7. B | Q924S5 | Lon protease homolog, mitochondrial | 2.31e-04 | NA | 0.012 | NA |
| 7. B | Q6CWS4 | Lon protease homolog 2, peroxisomal | 1.38e-03 | NA | 2.15e-04 | NA |
| 7. B | Q87T21 | ATP-dependent protease ATPase subunit HslU | 8.33e-03 | NA | 0.002 | NA |
| 7. B | A9VT67 | ATP-dependent protease ATPase subunit HslU | 6.98e-03 | NA | 0.006 | NA |
| 7. B | B9MFS2 | ATP-dependent protease ATPase subunit HslU | 8.05e-03 | NA | 0.020 | NA |
| 7. B | B4TCM8 | ATP-dependent protease ATPase subunit HslU | 2.39e-03 | NA | 0.001 | NA |
| 7. B | Q8P552 | ATP-dependent protease ATPase subunit HslU | 1.24e-03 | NA | 0.006 | NA |
| 7. B | Q07WM2 | ATP-dependent protease ATPase subunit HslU | 7.52e-03 | NA | 0.016 | NA |
| 7. B | Q8SQK0 | 26S proteasome regulatory subunit 8 homolog | 8.60e-05 | NA | 0.023 | NA |
| 7. B | B4TPV2 | ATP-dependent protease ATPase subunit HslU | 2.66e-03 | NA | 0.001 | NA |
| 7. B | C4L9W9 | ATP-dependent protease ATPase subunit HslU | 8.99e-03 | NA | 0.005 | NA |
| 7. B | Q53LY0 | Chaperone protein ClpC3, chloroplastic | 0.00e+00 | NA | 0.0 | NA |
| 7. B | A6X117 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.02e-06 | NA | 0.019 | NA |
| 7. B | A9B5N1 | Lon protease 1 | 1.12e-04 | NA | 1.63e-05 | NA |
| 7. B | Q89A31 | ATP-dependent protease ATPase subunit HslU | 2.51e-03 | NA | 0.018 | NA |
| 7. B | Q4KJK3 | ATP-dependent protease ATPase subunit HslU | 1.89e-03 | NA | 0.002 | NA |
| 7. B | Q8G5R1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 2.71e-05 | NA | 0.049 | NA |
| 7. B | Q1QZZ7 | ATP-dependent protease ATPase subunit HslU | 1.69e-03 | NA | 0.044 | NA |
| 7. B | F4JVJ1 | Putative chaperone protein ClpB2, chloroplastic | 0.00e+00 | NA | 1.19e-172 | NA |
| 7. B | A5U9Z5 | ATP-dependent protease ATPase subunit HslU | 1.43e-02 | NA | 0.006 | NA |
| 7. B | A6LSV5 | Lon protease | 4.62e-05 | NA | 0.001 | NA |
| 7. B | A3D9C6 | ATP-dependent protease ATPase subunit HslU | 9.50e-03 | NA | 0.016 | NA |
| 7. B | Q2NDC1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 6.56e-06 | NA | 0.033 | NA |
| 7. B | B7LA28 | ATP-dependent protease ATPase subunit HslU | 2.43e-03 | NA | 0.001 | NA |
| 7. B | P36772 | Lon protease | 5.12e-05 | NA | 0.004 | NA |
| 7. B | Q1D801 | ATP-dependent protease ATPase subunit HslU | 1.39e-02 | NA | 0.019 | NA |
| 7. B | Q94BQ2 | 26S proteasome regulatory subunit 8 homolog B | 3.41e-04 | NA | 0.021 | NA |
| 7. B | F4IAE9 | ATPase family AAA domain-containing protein At1g05910 | 3.93e-03 | NA | 0.033 | NA |
| 7. B | B8D899 | ATP-dependent protease ATPase subunit HslU | 1.22e-03 | NA | 4.40e-04 | NA |
| 7. B | B6EML9 | ATP-dependent protease ATPase subunit HslU | 6.87e-03 | NA | 0.005 | NA |
| 7. B | A7ZUE6 | ATP-dependent protease ATPase subunit HslU | 2.67e-03 | NA | 0.001 | NA |
| 7. B | A4JIR3 | ATP-dependent protease ATPase subunit HslU | 8.34e-03 | NA | 0.002 | NA |
| 7. B | A7HSH7 | ATP-dependent protease ATPase subunit HslU | 3.43e-03 | NA | 0.028 | NA |
| 7. B | Q63570 | 26S proteasome regulatory subunit 6B | 6.40e-05 | NA | 0.002 | NA |
| 7. B | Q8RC24 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.00e-06 | NA | 0.007 | NA |
| 7. B | A9KYP8 | ATP-dependent protease ATPase subunit HslU | 9.04e-03 | NA | 0.016 | NA |
| 7. B | B6I4S4 | ATP-dependent protease ATPase subunit HslU | 2.48e-03 | NA | 0.001 | NA |
| 7. B | Q72UP9 | Lon protease | 1.07e-04 | NA | 0.017 | NA |
| 7. B | Q11QT1 | Lon protease | 2.51e-04 | NA | 0.029 | NA |
| 7. B | A7NBY8 | ATP-dependent protease ATPase subunit HslU | 7.38e-03 | NA | 0.008 | NA |
| 7. B | Q8ZJJ5 | ATP-dependent protease ATPase subunit HslU | 1.03e-02 | NA | 0.001 | NA |
| 7. B | A7ML81 | ATP-dependent protease ATPase subunit HslU | 8.03e-03 | NA | 0.001 | NA |
| 7. B | F4IGZ2 | Protein SMAX1-LIKE 8 | 2.48e-02 | NA | 5.42e-09 | NA |
| 7. B | A0L3K1 | ATP-dependent protease ATPase subunit HslU | 5.77e-03 | NA | 0.038 | NA |
| 7. B | A1AIA6 | ATP-dependent protease ATPase subunit HslU | 2.73e-03 | NA | 0.001 | NA |
| 7. B | Q5NGY9 | ATP-dependent protease ATPase subunit HslU | 5.60e-03 | NA | 0.008 | NA |
| 7. B | B8E6E3 | ATP-dependent protease ATPase subunit HslU | 9.65e-03 | NA | 0.016 | NA |
| 7. B | P43773 | ATP-dependent protease ATPase subunit HslU | 9.20e-03 | NA | 0.005 | NA |
| 7. B | A2QCJ2 | Lon protease homolog, mitochondrial | 1.10e-03 | NA | 0.002 | NA |
| 7. B | Q9WXZ3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 3.83e-06 | NA | 0.002 | NA |
| 7. B | A7MWJ3 | ATP-dependent protease ATPase subunit HslU | 9.00e-03 | NA | 0.002 | NA |
| 7. B | O04979 | Lon protease homolog 2, peroxisomal | 5.92e-04 | NA | 4.93e-04 | NA |
| 7. B | Q0I5E0 | ATP-dependent protease ATPase subunit HslU | 1.10e-02 | NA | 0.005 | NA |
| 7. B | P9WPH6 | ESX-2 secretion system protein EccA2 | 1.18e-03 | NA | 0.020 | NA |
| 7. B | C1L2I7 | ATP-dependent protease ATPase subunit HslU | 4.53e-03 | NA | 0.046 | NA |
| 7. B | O66574 | ATP-dependent protease ATPase subunit HslU | 5.28e-03 | NA | 9.11e-05 | NA |
| 7. B | Q1CD55 | ATP-dependent protease ATPase subunit HslU | 6.62e-03 | NA | 0.001 | NA |
| 7. B | Q73NE3 | ATP-dependent protease ATPase subunit HslU | 3.51e-03 | NA | 0.001 | NA |
| 7. B | Q7VUJ9 | ATP-dependent protease ATPase subunit HslU | 1.16e-02 | NA | 6.08e-04 | NA |
| 7. B | Q66G85 | ATP-dependent protease ATPase subunit HslU | 3.55e-03 | NA | 0.001 | NA |
| 7. B | A0Q6L9 | ATP-dependent protease ATPase subunit HslU | 4.69e-03 | NA | 0.008 | NA |
| 7. B | A5IJQ2 | ATP-dependent protease ATPase subunit HslU | 5.22e-03 | NA | 0.004 | NA |
| 7. B | B8FRG8 | ATP-dependent protease ATPase subunit HslU | 4.42e-03 | NA | 0.002 | NA |
| 7. B | Q9Z9F4 | Lon protease | 1.63e-04 | NA | 6.37e-05 | NA |
| 7. B | A3Q2I1 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.49e-06 | NA | 0.003 | NA |
| 7. B | A5WA35 | ATP-dependent protease ATPase subunit HslU | 1.11e-02 | NA | 0.004 | NA |
| 7. B | B2AGB7 | ATP-dependent protease ATPase subunit HslU | 1.98e-02 | NA | 0.002 | NA |
| 7. B | B8CY71 | Lon protease | 7.51e-05 | NA | 0.004 | NA |
| 7. B | Q3KKY9 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.26e-05 | NA | 0.037 | NA |
| 7. B | P93655 | Lon protease homolog 1, mitochondrial | 2.60e-04 | NA | 0.003 | NA |
| 7. B | Q8DUI0 | ATP-dependent Clp protease ATP-binding subunit ClpX | 9.03e-07 | NA | 0.044 | NA |
| 7. B | A3DJ11 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.33e-06 | NA | 0.006 | NA |
| 7. B | Q82SP6 | ATP-dependent protease ATPase subunit HslU | 3.81e-03 | NA | 3.41e-05 | NA |
| 7. B | B7UNQ1 | ATP-dependent protease ATPase subunit HslU | 2.38e-03 | NA | 0.001 | NA |
| 7. B | Q00WL5 | Lon protease homolog, mitochondrial | 1.32e-02 | NA | 0.004 | NA |
| 7. B | Q3SWE4 | ATP-dependent protease ATPase subunit HslU | 1.16e-02 | NA | 0.009 | NA |
| 7. B | Q5P503 | ATP-dependent protease ATPase subunit HslU | 1.10e-02 | NA | 4.61e-05 | NA |
| 7. B | B7HQN2 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.19e-06 | NA | 0.021 | NA |
| 7. B | B0U6U9 | ATP-dependent protease ATPase subunit HslU | 4.05e-03 | NA | 0.022 | NA |
| 7. B | Q31U59 | ATP-dependent protease ATPase subunit HslU | 6.19e-03 | NA | 0.001 | NA |
| 7. B | Q8CXB8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 7.66e-05 | NA | 0.003 | NA |
| 7. B | P32180 | ATP-dependent protease ATPase subunit HslU | 5.89e-03 | NA | 0.011 | NA |
| 7. B | B9IVB8 | ATP-dependent protease ATPase subunit HslU | 2.05e-03 | NA | 0.010 | NA |
| 7. B | Q14IE1 | ATP-dependent protease ATPase subunit HslU | 7.87e-03 | NA | 0.008 | NA |
| 7. B | A5D2W8 | ATP-dependent protease ATPase subunit HslU | 3.43e-03 | NA | 0.009 | NA |
| 7. B | A8F811 | Lon protease | 4.69e-04 | NA | 0.025 | NA |
| 7. B | B5QXM0 | ATP-dependent protease ATPase subunit HslU | 2.65e-03 | NA | 0.001 | NA |
| 7. B | Q8D2S7 | ATP-dependent protease ATPase subunit HslU | 8.51e-03 | NA | 0.014 | NA |
| 7. B | B7JQ65 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.29e-06 | NA | 0.021 | NA |
| 7. B | A4XIX0 | ATP-dependent protease ATPase subunit HslU | 3.24e-03 | NA | 0.001 | NA |
| 7. B | A4IY57 | ATP-dependent protease ATPase subunit HslU | 6.01e-03 | NA | 0.008 | NA |
| 7. B | C0QUM2 | ATP-dependent protease ATPase subunit HslU | 9.48e-03 | NA | 0.002 | NA |
| 7. B | A0A1P8AUY4 | Midasin | NA | NA | 0.011 | NA |
| 7. B | Q5UPT0 | Lon protease homolog | NA | NA | 0.015 | NA |
| 7. B | C3PN30 | ATP-dependent protease ATPase subunit HslU | 5.93e-03 | NA | 0.009 | NA |
| 7. B | Q60649 | Caseinolytic peptidase B protein homolog | 6.76e-07 | NA | 2.53e-57 | NA |
| 7. B | Q0ACL3 | ATP-dependent protease ATPase subunit HslU | 5.48e-03 | NA | 0.002 | NA |
| 7. B | A9MI34 | ATP-dependent protease ATPase subunit HslU | 2.55e-03 | NA | 0.001 | NA |
| 7. B | B2TWC7 | ATP-dependent protease ATPase subunit HslU | 2.58e-03 | NA | 0.001 | NA |
| 7. B | Q2NYV9 | ATP-dependent protease ATPase subunit HslU | 1.43e-03 | NA | 0.006 | NA |
| 7. B | A6W2U6 | ATP-dependent protease ATPase subunit HslU | 7.79e-03 | NA | 0.010 | NA |
| 7. B | Q891J8 | ATP-dependent Clp protease ATP-binding subunit ClpX | 5.71e-06 | NA | 0.003 | NA |
| 7. B | P0A6H7 | ATP-dependent protease ATPase subunit HslU | 5.84e-03 | NA | 0.001 | NA |
| 7. B | A4J5Z5 | ATP-dependent protease ATPase subunit HslU | 4.87e-03 | NA | 0.002 | NA |
| 7. B | Q39UH3 | ATP-dependent Clp protease ATP-binding subunit ClpX | 1.64e-06 | NA | 0.003 | NA |
| 7. B | Q6C0B5 | Lon protease homolog, mitochondrial | 1.74e-03 | NA | 0.012 | NA |
| 7. B | B8CRF6 | ATP-dependent Clp protease ATP-binding subunit ClpX | 4.03e-06 | NA | 0.045 | NA |