Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54864.1

JCVISYN3A_0600

Ribonuclease J.
M. mycoides homolog: Q6MSU8.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 69
Unique PROST Go: 12
Unique BLAST Go: 4
Unique Foldseek Go: 23

Total Homologs: 327
Unique PROST Homologs: 45
Unique BLAST Homologs: 27
Unique Foldseek Homologs: 169

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rnj; Ribonuclease J
Zhang et al. [4]: GO:0004534|5'-3' exoribonuclease activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P47385 (Ribonuclease J) with a FATCAT P-Value: 0 and RMSD of 1.71 angstrom. The sequence alignment identity is 39.2%.
Structural alignment shown in left. Query protein AVX54864.1 colored as red in alignment, homolog P47385 colored as blue. Query protein AVX54864.1 is also shown in right top, homolog P47385 showed in right bottom. They are colored based on secondary structures.

  AVX54864.1 MSNIDKKDLDILNEENENLINTFDDDGDQLNISIDEKEFKP--YVFKQKEVKRQYQKTNIPTKIFALGGLEEVGKNTYCIEYDNELIMIDAGVKFPESTM 98
      P47385 --------------------------------MI--KDFNPGDFIGK-K-----------PTKIYAFGGIQEVGKNMYGIEYDDEIIIIDCGIKFASDDL 54

  AVX54864.1 LGVSAVIPDYSYLAENQKKIKALFITHGHEDHIGGIQYLVQQVKIPVIYAPKLAAMLIRDRLKEYKIEDKTIVKEYDADDV--WKTKNFKVSYAALNHSI 196
      P47385 LGINGIIPSFEHLIENQSKVKALFITHGHEDHIGGVPYLLKQVDIPVIYAPRIAASLILKKVNEHK--DAKLNKIVTFDDFSEFQTKHFKIDFYRVNHSI 152

  AVX54864.1 PDAFGILVQTPNGNIFSTGDYKFDWSPLG-HFAELTKLASMGENGVELLMADSTNSEVEGYTQGEKSIISNIDKLFLQAKGRIFLTTFASNVHRIQHIIE 295
      P47385 PDAFGICVQTPNGNIVQSGDYRFDFA-AGSEMLDVHKVVKIAERNVHVFMSESTNAEVPGFSQSEKLIYRNIQKILKEARGRVILTTFASNITRINEIIE 251

  AVX54864.1 TAHKYNRKIVILGRSFERIIKIIRQIGHLKISEKEFIKSTDIDKYKPEE-LMILTTGSQGEPMAALSRIANNKH--LSINIIPGDTVVFSSSPIPGNRAD 392
      P47385 IALNNKRKICLLGKSMDVNVNISRKIGLMAIDSNDIVEVRDIKNY-PDRNILILCTGSQGEEAAALNTMARGKHNWVSLK--STDTIIMSSNPIPGNYAA 348

  AVX54864.1 VEKLVNKLTRVGAIVIENTSDNKIHTSGHASQEEQKLLFSLIRPKYFMPMHGEYRMLK--KHV--ETG-ESVNLEKGNGFIMANGDVLELLQGKAKIGKR 487
      P47385 VENLLNELSKFGVAIYENSSQLKLHASGHATQQELQLMLNLMFPKYLIPIHGEFKMMRTIKNIANECGIKSEDVA-----LLSNGQVMYLIDEELYYSNE 443

  AVX54864.1 -VEADAVYVDGKDMTGKASNVIREREILSKDGLIAVVISLDSQTNKLISQPRIISRGSFYVKDAGSI---ISDSIQIITNAVNEVLMSSKPTF------- 576
      P47385 IINADPIYIESHNSSPDLARIIKQRQILSRDGMFAVIVVFDKN-NNIIGIPTLITRGCFFALDSNPLMTKIAHSVK---RTLESVIQSKK--FNSHEQLT 537

  AVX54864.1 AAIKKAIKSSLSPYIFRVKRRNPLIIPVI--LNKKS 610
      P47385 KELKRVCKETVSYFIWKNKNRNPLISTVLSWI---- 569

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0006379	mRNA cleavage
1. PBF	GO:0006397	mRNA processing
1. PBF	GO:0004521	endoribonuclease activity
1. PBF	GO:0006398	mRNA 3'-end processing by stem-loop binding and cleavage
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0008409	5'-3' exonuclease activity
1. PBF	GO:0008270	zinc ion binding
1. PBF	GO:0006378	mRNA polyadenylation
1. PBF	GO:0016180	snRNA processing
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0006364	rRNA processing
1. PBF	GO:0004534	5'-3' exoribonuclease activity
1. PBF	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
2. PF	GO:0016966	nitric oxide reductase activity
2. PF	GO:0032039	integrator complex
2. PF	GO:0009055	electron transfer activity
2. PF	GO:0010181	FMN binding
2. PF	GO:0016787	hydrolase activity
2. PF	GO:0005506	iron ion binding
3. BF	GO:0031126	sno(s)RNA 3'-end processing
3. BF	GO:0035312	5'-3' exodeoxyribonuclease activity
3. BF	GO:0042781	3'-tRNA processing endoribonuclease activity
3. BF	GO:0004416	hydroxyacylglutathione hydrolase activity
3. BF	GO:0098789	pre-mRNA cleavage required for polyadenylation
3. BF	GO:0006369	termination of RNA polymerase II transcription
3. BF	GO:0046872	metal ion binding
3. BF	GO:0031848	protection from non-homologous end joining at telomere
3. BF	GO:0019243	methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
3. BF	GO:0034247	snoRNA splicing
4. PB	GO:0006401	RNA catabolic process
5. P	GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
5. P	GO:0047421	N-acyl-D-glutamate deacylase activity
5. P	GO:0010197	polar nucleus fusion
5. P	GO:0000034	adenine deaminase activity
5. P	GO:0016661	oxidoreductase activity, acting on other nitrogenous compounds as donors
5. P	GO:0046210	nitric oxide catabolic process
5. P	GO:0071731	response to nitric oxide
5. P	GO:0006146	adenine catabolic process
5. P	GO:0043419	urea catabolic process
5. P	GO:0016151	nickel cation binding
5. P	GO:0034472	snRNA 3'-end processing
5. P	GO:0009039	urease activity
6. F	GO:0031627	telomeric loop formation
6. F	GO:0016788	hydrolase activity, acting on ester bonds
6. F	GO:0004527	exonuclease activity
6. F	GO:0005886	plasma membrane
6. F	GO:0072684	mitochondrial tRNA 3'-trailer cleavage, endonucleolytic
6. F	GO:0050664	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
6. F	GO:0031860	telomeric 3' overhang formation
6. F	GO:0006198	cAMP catabolic process
6. F	GO:0046069	cGMP catabolic process
6. F	GO:0042645	mitochondrial nucleoid
6. F	GO:0030338	CMP-N-acetylneuraminate monooxygenase activity
6. F	GO:0016021	integral component of membrane
6. F	GO:0042779	tRNA 3'-trailer cleavage
6. F	GO:1900815	monodictyphenone biosynthetic process
6. F	GO:0070813	hydrogen sulfide metabolic process
6. F	GO:0006303	double-strand break repair via nonhomologous end joining
6. F	GO:0018189	pyrroloquinoline quinone biosynthetic process
6. F	GO:0050313	sulfur dioxygenase activity
6. F	GO:1902660	negative regulation of glucose mediated signaling pathway
6. F	GO:0016891	endoribonuclease activity, producing 5'-phosphomonoesters
6. F	GO:0006054	N-acetylneuraminate metabolic process
6. F	GO:0051537	2 iron, 2 sulfur cluster binding
6. F	GO:0036297	interstrand cross-link repair
7. B	GO:0044550	secondary metabolite biosynthetic process
7. B	GO:0009942	longitudinal axis specification
7. B	GO:0060918	auxin transport
7. B	GO:0004519	endonuclease activity

Uniprot GO Annotations

GO	Description
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
GO:0004521	endoribonuclease activity
GO:0003723	RNA binding
GO:0006396	RNA processing
GO:0004527	exonuclease activity
GO:0008270	zinc ion binding
GO:0005737	cytoplasm
GO:0004518	nuclease activity
GO:0006364	rRNA processing
GO:0090501	RNA phosphodiester bond hydrolysis
GO:0004519	endonuclease activity
GO:0046872	metal ion binding
GO:0016787	hydrolase activity
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0004534	5'-3' exoribonuclease activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q5HQ80	Ribonuclease J 1	0.00e+00	9.56e-36	0.0	0.9351
1. PBF	Q9V076	Ribonuclease J	0.00e+00	1.78e-16	3.39e-60	0.8319
1. PBF	Q49X63	Ribonuclease J 2	0.00e+00	1.44e-41	1.16e-124	0.9
1. PBF	P47385	Ribonuclease J	0.00e+00	3.22e-45	6.13e-152	0.9504
1. PBF	Q7A682	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9266
1. PBF	Q99UJ7	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.8983
1. PBF	Q6GHG0	Ribonuclease J 2	0.00e+00	1.87e-41	1.76e-124	0.8973
1. PBF	P0CM88	Endoribonuclease YSH1	4.49e-06	4.89e-03	0.022	0.5163
1. PBF	Q5HGZ5	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9334
1. PBF	P0CM89	Endoribonuclease YSH1	4.11e-06	4.89e-03	0.022	0.5195
1. PBF	A0QVT2	Ribonuclease J	0.00e+00	6.68e-43	7.17e-103	0.9068
1. PBF	P75497	Ribonuclease J	0.00e+00	3.30e-45	7.10e-156	0.9367
1. PBF	Q7A115	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.9002
1. PBF	Q5HPR6	Ribonuclease J 2	0.00e+00	2.83e-41	1.12e-120	0.8906
1. PBF	Q4L5X8	Ribonuclease J 2	0.00e+00	1.64e-40	3.54e-122	0.89
1. PBF	Q49WL3	Ribonuclease J 1	0.00e+00	2.31e-17	0.0	0.9217
1. PBF	Q4L5A3	Ribonuclease J 1	0.00e+00	5.41e-37	0.0	0.9288
1. PBF	Q9HQI4	Ribonuclease J	0.00e+00	9.14e-15	1.43e-34	0.8369
1. PBF	P54122	Ribonuclease J	0.00e+00	2.74e-18	2.48e-113	0.8277
1. PBF	Q6GAC5	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9338
1. PBF	Q2YXP1	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.8944
1. PBF	Q72JJ7	Ribonuclease J	0.00e+00	6.70e-49	6.97e-113	0.8937
1. PBF	Q7A171	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9352
1. PBF	Q8CST0	Ribonuclease J 2	0.00e+00	2.83e-41	1.12e-120	0.896
1. PBF	Q8CT16	Ribonuclease J 1	0.00e+00	9.56e-36	0.0	0.9327
1. PBF	Q7A5X6	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.9
1. PBF	Q2FHG3	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.9019
1. PBF	Q8K5W8	Ribonuclease J 1	0.00e+00	2.00e-38	5.29e-172	0.9221
1. PBF	P9WGZ8	Ribonuclease J	0.00e+00	4.11e-45	1.45e-108	0.9173
1. PBF	Q99V09	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9352
1. PBF	M4MR97	Ribonuclease J	0.00e+00	3.55e-42	5.62e-85	0.8876
1. PBF	P56185	Ribonuclease J	0.00e+00	1.69e-30	5.94e-111	0.9176
1. PBF	Q6GHZ6	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.9285
1. PBF	P54123	Ribonuclease J	0.00e+00	9.95e-16	4.09e-141	0.8946
1. PBF	Q6G9T8	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.8912
1. PBF	Q45493	Ribonuclease J1	0.00e+00	7.13e-40	0.0	0.9366
1. PBF	Q9ZJI6	Ribonuclease J	0.00e+00	1.35e-29	1.93e-111	0.9148
1. PBF	O31760	Ribonuclease J2	0.00e+00	8.45e-42	2.79e-149	0.9209
1. PBF	Q2FHZ1	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	0.935
1. PBF	B9XZG7	Ribonuclease J	0.00e+00	4.93e-29	1.76e-111	0.9122
1. PBF	Q5HGF6	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	0.9017
1. PBF	Q2YX35	Ribonuclease J 1	0.00e+00	1.92e-34	0.0	0.9346
1. PBF	P47662	Uncharacterized protein MG423	0.00e+00	5.88e-28	7.93e-43	0.8792
1. PBF	P75174	Uncharacterized protein MG423 homolog	0.00e+00	8.75e-29	3.69e-38	0.8633
1. PBF	Q8K7S6	Ribonuclease J 2	0.00e+00	1.41e-35	6.81e-101	0.8884
2. PF	A1AEQ0	Anaerobic nitric oxide reductase flavorubredoxin	3.37e-03	3.23e-02	NA	0.2397
2. PF	Q5NVE6	Integrator complex subunit 11	9.08e-08	9.61e-08	NA	0.6008
2. PF	Q5ZIH0	Integrator complex subunit 11	6.56e-07	9.05e-08	NA	0.6319
2. PF	Q0T1D5	Anaerobic nitric oxide reductase flavorubredoxin	3.29e-03	4.59e-02	NA	0.2397
2. PF	Q4R5Z4	Integrator complex subunit 9	1.39e-04	3.92e-02	NA	0.4379
2. PF	P79101	Cleavage and polyadenylation specificity factor subunit 3	3.83e-06	7.56e-05	NA	0.5135
2. PF	Q55470	Uncharacterized protein sll0514	3.58e-06	1.87e-05	NA	0.5557
2. PF	P59405	Anaerobic nitric oxide reductase flavorubredoxin	8.47e-03	4.59e-02	NA	0.2398
2. PF	A7SBF0	Integrator complex subunit 9 homolog	5.12e-05	1.87e-04	NA	0.4888
2. PF	Q1R7Z0	Anaerobic nitric oxide reductase flavorubredoxin	3.57e-03	3.23e-02	NA	0.2397
2. PF	D5ARY8	Type A flavoprotein fprA	1.22e-03	1.59e-05	NA	0.2692
2. PF	B1LQ28	Anaerobic nitric oxide reductase flavorubredoxin	4.32e-03	4.39e-02	NA	0.2397
2. PF	A7ZQD9	Anaerobic nitric oxide reductase flavorubredoxin	7.16e-03	4.67e-02	NA	0.2391
2. PF	Q3YYF4	Anaerobic nitric oxide reductase flavorubredoxin	2.49e-03	4.35e-02	NA	0.2424
2. PF	Q0TEH0	Anaerobic nitric oxide reductase flavorubredoxin	2.74e-03	3.23e-02	NA	0.2397
2. PF	Q31X74	Anaerobic nitric oxide reductase flavorubredoxin	5.14e-03	4.28e-02	NA	0.2397
2. PF	Q5SLP1	Ribonuclease TTHA0252	1.25e-14	2.15e-05	NA	0.6959
2. PF	Q2YDM2	Integrator complex subunit 11	6.06e-08	3.47e-07	NA	0.6025
2. PF	P0CY93	Type A flavoprotein fprA	9.16e-04	1.45e-04	NA	0.2777
2. PF	A8A3I7	Anaerobic nitric oxide reductase flavorubredoxin	7.25e-03	4.35e-02	NA	0.2423
2. PF	P59404	Anaerobic nitric oxide reductase flavorubredoxin	5.36e-03	4.55e-02	NA	0.2397
2. PF	Q6DFF4	Integrator complex subunit 9	8.50e-05	2.27e-02	NA	0.4669
3. BF	Q6FUA5	Endoribonuclease YSH1	8.35e-06	NA	6.99e-04	0.6295
3. BF	Q4WRC2	Endoribonuclease ysh1	5.00e-06	NA	0.030	0.5909
3. BF	Q74ZC0	Endoribonuclease YSH1	2.50e-06	NA	9.00e-05	0.5851
3. BF	Q6C2Z7	Endoribonuclease YSH1	1.71e-05	NA	5.80e-04	0.6175
3. BF	Q6BMW3	Endoribonuclease YSH1	1.54e-06	NA	4.83e-07	0.5936
3. BF	Q5BEP0	Endoribonuclease ysh1	1.70e-05	NA	0.034	0.5383
3. BF	A2C116	Hydroxyacylglutathione hydrolase	7.93e-03	NA	8.99e-05	0.4539
3. BF	Q4IPN9	Endoribonuclease YSH1	1.20e-05	NA	0.023	0.5918
3. BF	Q8WZS6	Endoribonuclease ysh-1	6.95e-05	NA	0.029	0.5831
3. BF	Q31BX5	Hydroxyacylglutathione hydrolase	2.13e-02	NA	0.016	0.424
3. BF	Q6CUI5	Endoribonuclease YSH1	2.07e-06	NA	2.88e-04	0.6277
4. PB	Q2FZ19	Ribonuclease J 2	0.00e+00	1.91e-41	3.36e-124	NA
4. PB	Q60355	Uncharacterized protein MJ0047	4.44e-16	2.65e-06	1.22e-07	NA
4. PB	Q58271	Ribonuclease J	0.00e+00	4.78e-15	2.55e-50	NA
4. PB	Q503E1	Integrator complex subunit 11	5.87e-08	3.32e-09	0.018	NA
4. PB	Q2FZG9	Ribonuclease J 1	0.00e+00	3.01e-34	0.0	NA
4. PB	O13794	Endoribonuclease ysh1	6.04e-06	1.03e-02	3.16e-04	NA
4. PB	P9WGZ9	Ribonuclease J	0.00e+00	4.11e-45	1.45e-108	NA
4. PB	Q59P50	Endoribonuclease YSH1	3.80e-05	5.97e-06	1.63e-06	NA
5. P	Q8GUU3	Cleavage and polyadenylation specificity factor subunit 3-II	1.22e-07	1.15e-08	NA	NA
5. P	Q58158	Type A flavoprotein FprA	1.68e-02	1.82e-04	NA	NA
5. P	B0JKA1	Urease subunit alpha	5.98e-01	2.46e-02	NA	NA
5. P	P16122	Urease subunit alpha	4.02e-01	1.91e-02	NA	NA
5. P	Q95TS5	Integrator complex subunit 9	2.06e-05	1.22e-02	NA	NA
5. P	Q9C952	Cleavage and polyadenylation specificity factor subunit 3-I	7.30e-07	2.81e-05	NA	NA
5. P	Q07397	Urease subunit alpha	3.56e-01	1.81e-02	NA	NA
5. P	Q5KYM1	Urease subunit alpha	3.98e-01	3.32e-02	NA	NA
5. P	Q3MHC2	Integrator complex subunit 11	1.11e-07	2.12e-07	NA	NA
5. P	P42873	Urease subunit alpha	4.75e-01	3.20e-02	NA	NA
5. P	Q9CWS4	Integrator complex subunit 11	7.68e-08	1.96e-07	NA	NA
5. P	Q9QXK7	Cleavage and polyadenylation specificity factor subunit 3	3.63e-06	9.21e-05	NA	NA
5. P	Q50497	Type A flavoprotein FprA	3.68e-02	3.38e-02	NA	NA
5. P	Q7CUX4	Adenine deaminase 2	3.14e-01	3.44e-02	NA	NA
5. P	Q54SH0	Integrator complex subunit 9 homolog	2.71e-05	2.58e-05	NA	NA
5. P	Q46877	Anaerobic nitric oxide reductase flavorubredoxin	5.45e-03	4.21e-02	NA	NA
5. P	Q1MCF8	Adenine deaminase 2	2.65e-01	1.11e-02	NA	NA
5. P	Q11VN3	Urease subunit alpha	4.73e-01	2.52e-02	NA	NA
5. P	Q32CL8	Anaerobic nitric oxide reductase flavorubredoxin	4.92e-03	4.35e-02	NA	NA
5. P	Q9F0J6	Rubredoxin-oxygen oxidoreductase	3.76e-03	8.72e-04	NA	NA
5. P	B1XCN7	Anaerobic nitric oxide reductase flavorubredoxin	6.21e-03	4.21e-02	NA	NA
5. P	Q9VE51	Cleavage and polyadenylation specificity factor 73	2.62e-06	2.25e-04	NA	NA
5. P	Q9VAH9	Integrator complex subunit 11	9.53e-07	1.23e-09	NA	NA
5. P	Q2YYQ6	Urease subunit alpha	4.51e-01	4.84e-02	NA	NA
5. P	B1Y3V1	Urease subunit alpha	4.75e-01	4.59e-02	NA	NA
5. P	Q9UKF6	Cleavage and polyadenylation specificity factor subunit 3	2.59e-06	7.80e-05	NA	NA
5. P	A1B5X6	Adenine deaminase	2.38e-01	1.80e-02	NA	NA
5. P	Q2KJA6	Integrator complex subunit 9	8.67e-05	4.92e-02	NA	NA
5. P	B5FBC6	Urease subunit alpha	4.07e-01	2.96e-02	NA	NA
5. P	B1IUW9	Anaerobic nitric oxide reductase flavorubredoxin	2.00e-03	4.21e-02	NA	NA
5. P	Q5E728	Urease subunit alpha	4.07e-01	3.38e-02	NA	NA
5. P	Q58142	Uncharacterized protein MJ0732	1.45e-03	4.73e-04	NA	NA
5. P	Q9FDN7	Nitric oxide reductase	3.66e-03	1.56e-03	NA	NA
5. P	P17086	Urease subunit alpha	3.75e-01	1.58e-02	NA	NA
5. P	Q57954	Uncharacterized protein MJ0534	4.55e-03	5.88e-04	NA	NA
5. P	O27404	Type A flavoprotein FprA	1.17e-02	2.31e-02	NA	NA
5. P	Q8K114	Integrator complex subunit 9	6.78e-05	3.69e-02	NA	NA
5. P	P94211	N-acyl-D-glutamate deacylase	2.44e-01	2.25e-02	NA	NA
5. P	Q57626	Uncharacterized protein MJ0162	4.52e-14	4.28e-06	NA	NA
5. P	Q5TA45	Integrator complex subunit 11	1.06e-07	1.72e-07	NA	NA
5. P	Q47G55	Urease subunit alpha	4.40e-01	4.79e-02	NA	NA
5. P	Q92VC6	Adenine deaminase 2	3.10e-01	4.47e-02	NA	NA
5. P	B8HW50	Urease subunit alpha	5.87e-01	3.04e-02	NA	NA
5. P	Q5ZKK2	Integrator complex subunit 9	9.27e-05	1.36e-02	NA	NA
5. P	Q117Z3	Urease subunit alpha	6.40e-01	2.19e-02	NA	NA
6. F	B7N5N4	Ribonuclease BN	3.06e-03	NA	NA	0.4104
6. F	Q4PEJ3	Endoribonuclease YSH1	2.12e-05	NA	NA	0.5311
6. F	A5VSR1	Hydroxyacylglutathione hydrolase	5.88e-03	NA	NA	0.4543
6. F	B1JBN3	Hydroxyacylglutathione hydrolase	2.73e-02	NA	NA	0.4366
6. F	P60195	Ribonuclease BN	3.17e-03	NA	NA	0.4067
6. F	B0RQ28	Coenzyme PQQ synthesis protein B	3.85e-03	NA	NA	0.4338
6. F	B1MZQ4	Ribonuclease Z	3.53e-03	NA	NA	0.4121
6. F	Q5QJC4	DNA cross-link repair 1A protein	1.78e-03	NA	NA	0.5505
6. F	C0Q055	Ribonuclease BN	3.17e-03	NA	NA	0.4074
6. F	Q57M43	Ribonuclease BN	3.13e-03	NA	NA	0.4065
6. F	Q49XV1	Ribonuclease Z	7.27e-03	NA	NA	0.4262
6. F	Q9YAV8	Ribonuclease Z	1.29e-02	NA	NA	0.4417
6. F	Q608P3	Coenzyme PQQ synthesis protein B	9.09e-03	NA	NA	0.5128
6. F	C3P7S4	Ribonuclease Z	4.17e-03	NA	NA	0.3983
6. F	Q818V3	Ribonuclease Z	3.79e-03	NA	NA	0.3606
6. F	Q8FFK8	Ribonuclease BN	2.84e-03	NA	NA	0.4876
6. F	Q5ZLY2	Hydroxyacylglutathione hydrolase-like protein	6.95e-03	NA	NA	0.6184
6. F	B0UE10	Coenzyme PQQ synthesis protein B	3.19e-03	NA	NA	0.4955
6. F	P60197	Ribonuclease Z	7.49e-03	NA	NA	0.4257
6. F	Q8AVF5	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase	2.69e-02	NA	NA	0.3284
6. F	B8DBV5	Ribonuclease Z	3.09e-03	NA	NA	0.4375
6. F	Q8P6N0	Coenzyme PQQ synthesis protein B	4.35e-03	NA	NA	0.4336
6. F	C0SP91	Putative metallo-hydrolase YycJ	4.85e-05	NA	NA	0.4983
6. F	Q051W5	Hydroxyacylglutathione hydrolase	2.08e-02	NA	NA	0.4871
6. F	Q38WT6	Ribonuclease Z	4.42e-03	NA	NA	0.4865
6. F	B2VHF1	Ribonuclease BN	4.25e-03	NA	NA	0.4202
6. F	Q4ZVL3	Hydroxyacylglutathione hydrolase	1.34e-02	NA	NA	0.3811
6. F	Q8XCZ0	Ribonuclease BN	3.61e-03	NA	NA	0.5034
6. F	A8GG94	Anaerobic nitric oxide reductase flavorubredoxin	3.89e-03	NA	NA	0.2385
6. F	A8Z2D7	Ribonuclease Z	7.48e-03	NA	NA	0.4353
6. F	B2TW54	Ribonuclease BN	3.02e-03	NA	NA	0.503
6. F	Q635E2	Ribonuclease Z	3.75e-03	NA	NA	0.4186
6. F	A1ADC0	Ribonuclease BN	2.98e-03	NA	NA	0.3607
6. F	C0RFI1	Hydroxyacylglutathione hydrolase	5.44e-03	NA	NA	0.3993
6. F	B1YLU8	Ribonuclease Z	1.53e-02	NA	NA	0.4942
6. F	Q1R9E5	Ribonuclease BN	2.84e-03	NA	NA	0.5024
6. F	Q87YS8	Hydroxyacylglutathione hydrolase	1.45e-02	NA	NA	0.4072
6. F	A8ANR7	Anaerobic nitric oxide reductase flavorubredoxin	3.09e-03	NA	NA	0.2417
6. F	Q3T094	Persulfide dioxygenase ETHE1, mitochondrial	9.42e-03	NA	NA	0.4144
6. F	B9IXD7	Ribonuclease Z	4.14e-03	NA	NA	0.3982
6. F	Q8EQ58	Ribonuclease Z	9.08e-03	NA	NA	0.44
6. F	P0A8V1	Ribonuclease BN	3.01e-03	NA	NA	0.5035
6. F	P52700	Metallo-beta-lactamase L1 type 3	4.77e-03	NA	NA	0.4343
6. F	A4WCQ3	Ribonuclease BN	3.36e-03	NA	NA	0.4016
6. F	Q1WT50	Ribonuclease Z	4.30e-03	NA	NA	0.491
6. F	Q9WV23	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase (Fragment)	2.28e-02	NA	NA	0.3224
6. F	A9VG79	Ribonuclease Z	3.74e-03	NA	NA	0.422
6. F	B1LUE9	Coenzyme PQQ synthesis protein B	2.70e-03	NA	NA	0.4942
6. F	Q2SJ47	Hydroxyacylglutathione hydrolase	1.30e-02	NA	NA	0.4336
6. F	C6D9Q2	Anaerobic nitric oxide reductase flavorubredoxin	1.25e-02	NA	NA	0.2431
6. F	B7KXC8	Coenzyme PQQ synthesis protein B	2.63e-03	NA	NA	0.4565
6. F	Q2P4Y6	Coenzyme PQQ synthesis protein B	5.10e-03	NA	NA	0.4266
6. F	Q6N8F6	Coenzyme PQQ synthesis protein B	7.29e-03	NA	NA	0.4351
6. F	B2S889	Hydroxyacylglutathione hydrolase	5.37e-03	NA	NA	0.447
6. F	P74373	Putative diflavin flavoprotein A 3	9.18e-03	NA	NA	0.2563
6. F	A4STH4	Anaerobic nitric oxide reductase flavorubredoxin	9.09e-03	NA	NA	0.2358
6. F	Q1I7T2	Hydroxyacylglutathione hydrolase	2.38e-02	NA	NA	0.4442
6. F	Q8X852	Anaerobic nitric oxide reductase flavorubredoxin homolog	3.92e-02	NA	NA	0.5055
6. F	Q9W799	Cleavage and polyadenylation specificity factor subunit 2	1.03e-04	NA	NA	0.4986
6. F	A8XUS3	Probable cleavage and polyadenylation specificity factor subunit 2	5.19e-04	NA	NA	0.5619
6. F	Q65HN6	Ribonuclease Z	2.95e-03	NA	NA	0.372
6. F	Q95V11	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase	2.49e-02	NA	NA	0.3441
6. F	A9M8S2	Hydroxyacylglutathione hydrolase	5.50e-03	NA	NA	0.4475
6. F	A5IT32	Ribonuclease Z	7.11e-03	NA	NA	0.4289
6. F	B7LAT4	Ribonuclease BN	3.02e-03	NA	NA	0.361
6. F	Q8MJC8	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase (Fragment)	2.37e-02	NA	NA	0.3107
6. F	A6TCX5	Anaerobic nitric oxide reductase flavorubredoxin	5.87e-03	NA	NA	0.2424
6. F	Q2YYA2	Ribonuclease Z	7.82e-03	NA	NA	0.4249
6. F	Q4L6K4	Ribonuclease Z	6.71e-03	NA	NA	0.4408
6. F	Q8YJF4	Hydroxyacylglutathione hydrolase	5.29e-03	NA	NA	0.4253
6. F	B7MG36	Ribonuclease BN	2.90e-03	NA	NA	0.4898
6. F	A9N0D9	Anaerobic nitric oxide reductase flavorubredoxin	3.18e-03	NA	NA	0.2443
6. F	Q7MUY1	Octanoyltransferase	2.76e-02	NA	NA	0.3586
6. F	A9MFX6	Anaerobic nitric oxide reductase flavorubredoxin	1.28e-03	NA	NA	0.2397
6. F	A1KW76	Hydroxyacylglutathione hydrolase	1.26e-02	NA	NA	0.3798
6. F	Q2J429	Hydroxyacylglutathione hydrolase	3.74e-02	NA	NA	0.4578
6. F	Q9GL73	Zinc phosphodiesterase ELAC protein 2	9.76e-02	NA	NA	0.5228
6. F	Q8Z4C5	Anaerobic nitric oxide reductase flavorubredoxin	3.73e-03	NA	NA	0.2422
6. F	A0RYQ9	Ribonuclease Z	3.78e-03	NA	NA	0.5399
6. F	Q8PHY4	Coenzyme PQQ synthesis protein B	4.69e-03	NA	NA	0.4298
6. F	C4ZUB1	Ribonuclease BN	2.99e-03	NA	NA	0.4224
6. F	A9W3R2	Coenzyme PQQ synthesis protein B	2.66e-03	NA	NA	0.4565
6. F	Q5PN69	Ribonuclease BN	3.16e-03	NA	NA	0.4074
6. F	Q3JRV4	Probable metallo-hydrolase BURPS1710b_2304	4.65e-02	NA	NA	0.4874
6. F	Q9GL72	Zinc phosphodiesterase ELAC protein 2	1.25e-01	NA	NA	0.5207
6. F	Q5HP47	Ribonuclease Z	8.41e-03	NA	NA	0.436
6. F	Q2FGM9	Ribonuclease Z	7.87e-03	NA	NA	0.4258
6. F	Q71Y44	Ribonuclease Z	2.95e-03	NA	NA	0.4431
6. F	Q5HFR8	Ribonuclease Z	7.85e-03	NA	NA	0.4266
6. F	Q9JXK4	Hydroxyacylglutathione hydrolase	1.20e-02	NA	NA	0.4169
6. F	A7ZP87	Ribonuclease BN	3.01e-03	NA	NA	0.503
6. F	Q5H232	Coenzyme PQQ synthesis protein B	5.11e-03	NA	NA	0.4269
6. F	Q8MJC6	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase (Fragment)	1.53e-02	NA	NA	0.3211
6. F	B7UFT1	Ribonuclease BN	2.92e-03	NA	NA	0.5024
6. F	Q88FF3	Hydroxyacylglutathione hydrolase	3.01e-02	NA	NA	0.4337
6. F	Q139H4	Coenzyme PQQ synthesis protein B	5.33e-03	NA	NA	0.4186
6. F	A6U1X3	Ribonuclease Z	7.61e-03	NA	NA	0.4358
6. F	Q8YQD8	Putative diflavin flavoprotein A 3	3.10e-03	NA	NA	0.2732
6. F	Q8FYE7	Hydroxyacylglutathione hydrolase	5.28e-03	NA	NA	0.4042
6. F	A1U2M9	Ribonuclease Z	3.79e-03	NA	NA	0.4029
6. F	Q118J2	Ribonuclease Z	1.83e-02	NA	NA	0.479
6. F	Q9TUJ2	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase	2.32e-02	NA	NA	0.29
6. F	A8ABB4	Ribonuclease Z	4.50e-03	NA	NA	0.5282
6. F	O97598	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase	2.46e-02	NA	NA	0.2822
6. F	B0CIU0	Hydroxyacylglutathione hydrolase	5.52e-03	NA	NA	0.4474
6. F	B3QBS9	Coenzyme PQQ synthesis protein B	7.61e-03	NA	NA	0.439
6. F	B1IXR8	Ribonuclease BN	3.00e-03	NA	NA	0.5035
6. F	B1ZIB4	Coenzyme PQQ synthesis protein B	2.73e-03	NA	NA	0.4584
6. F	Q6G960	Ribonuclease Z	7.60e-03	NA	NA	0.4296
6. F	C5D428	Ribonuclease Z	3.02e-03	NA	NA	0.5058
6. F	A7MHT9	Ribonuclease BN	3.97e-03	NA	NA	0.435
6. F	A8A2D6	Ribonuclease BN	3.01e-03	NA	NA	0.5035
6. F	P60196	Ribonuclease Z	7.56e-03	NA	NA	0.4248
6. F	Q8MJD0	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase (Fragment)	2.40e-02	NA	NA	0.2828
6. F	A4WDR6	Anaerobic nitric oxide reductase flavorubredoxin	1.36e-03	NA	NA	0.2417
6. F	Q3J7X3	Coenzyme PQQ synthesis protein B	1.01e-02	NA	NA	0.4968
6. F	Q57AW2	Hydroxyacylglutathione hydrolase	5.24e-03	NA	NA	0.4041
6. F	B4RJC7	Hydroxyacylglutathione hydrolase	1.20e-02	NA	NA	0.4082
6. F	Q10568	Cleavage and polyadenylation specificity factor subunit 2	3.31e-05	NA	NA	0.5096
6. F	B8ITW0	Coenzyme PQQ synthesis protein B	2.98e-03	NA	NA	0.4899
6. F	B3R8D4	Coenzyme PQQ synthesis protein B	9.09e-03	NA	NA	0.4264
6. F	B0KN02	Hydroxyacylglutathione hydrolase	2.52e-02	NA	NA	0.4548
6. F	Q0TFH3	Ribonuclease BN	2.92e-03	NA	NA	0.5026
6. F	B7MXV1	Ribonuclease BN	2.86e-03	NA	NA	0.5024
6. F	Q97GC0	Flavo-diiron protein FprA2	3.11e-03	NA	NA	0.2745
6. F	Q8HY87	Zinc phosphodiesterase ELAC protein 2	1.66e-01	NA	NA	0.5358
6. F	Q5QJC3	5' exonuclease Apollo	4.80e-05	NA	NA	0.5674
6. F	Q4UXI1	Coenzyme PQQ synthesis protein B	3.77e-03	NA	NA	0.4403
6. F	A9M0M3	Hydroxyacylglutathione hydrolase	1.26e-02	NA	NA	0.4161
6. F	B5XNW7	Ribonuclease BN	7.34e-03	NA	NA	0.497
6. F	A0RID9	Ribonuclease Z	4.08e-03	NA	NA	0.4184
6. F	A7GSG2	Ribonuclease Z	3.72e-03	NA	NA	0.4548
6. F	A6VVZ9	Hydroxyacylglutathione hydrolase	1.27e-02	NA	NA	0.4292
6. F	Q8NWE6	Ribonuclease Z	7.56e-03	NA	NA	0.4258
6. F	B6I7L2	Ribonuclease BN	3.02e-03	NA	NA	0.5036
6. F	Q8ZMJ7	Anaerobic nitric oxide reductase flavorubredoxin	4.93e-03	NA	NA	0.2429
6. F	Q0K2D1	Coenzyme PQQ synthesis protein B	8.62e-03	NA	NA	0.4437
6. F	Q1H0N6	Coenzyme PQQ synthesis protein B	9.74e-03	NA	NA	0.4314
6. F	Q04RQ6	Hydroxyacylglutathione hydrolase	1.90e-02	NA	NA	0.4873
6. F	A6QH51	Ribonuclease Z	7.36e-03	NA	NA	0.4301
6. F	O19074	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase (Fragment)	2.07e-02	NA	NA	0.3068
6. F	Q81M88	Ribonuclease Z	3.96e-03	NA	NA	0.4114
6. F	A5W167	Hydroxyacylglutathione hydrolase	2.93e-02	NA	NA	0.4544
6. F	B5R2Z4	Ribonuclease BN	3.15e-03	NA	NA	0.4065
6. F	Q6GGJ4	Ribonuclease Z	7.83e-03	NA	NA	0.4292
6. F	B7M5V1	Ribonuclease BN	3.03e-03	NA	NA	0.5034
6. F	Q5BH31	Atrochrysone carboxyl ACP thioesterase	8.69e-03	NA	NA	0.3291
6. F	A7X2M2	Ribonuclease Z	7.52e-03	NA	NA	0.4327
6. F	A0KEJ1	Anaerobic nitric oxide reductase flavorubredoxin	7.07e-03	NA	NA	0.2363
6. F	C3LJR8	Ribonuclease Z	4.03e-03	NA	NA	0.4165
6. F	Q3BQI7	Coenzyme PQQ synthesis protein B	4.15e-03	NA	NA	0.4345
6. F	A1IPQ8	Hydroxyacylglutathione hydrolase	1.19e-02	NA	NA	0.4734
6. F	B5BCN2	Ribonuclease BN	3.17e-03	NA	NA	0.4074
6. F	Q8DJY2	Putative diflavin flavoprotein A 1	9.72e-03	NA	NA	0.2365
6. F	A6TBW1	Ribonuclease BN	3.23e-03	NA	NA	0.5007
6. F	Q07VA9	Hydroxyacylglutathione hydrolase	9.02e-03	NA	NA	0.4563
6. F	Q5WGC3	Ribonuclease Z	5.31e-03	NA	NA	0.396
6. F	Q48KX8	Hydroxyacylglutathione hydrolase	1.41e-02	NA	NA	0.3841
6. F	P60194	Ribonuclease BN	3.12e-03	NA	NA	0.4066
6. F	Q57KT3	Anaerobic nitric oxide reductase flavorubredoxin	5.54e-03	NA	NA	0.2422
6. F	A8ADW5	Ribonuclease BN	3.44e-03	NA	NA	0.4309
6. F	P0CU68	Atrochrysone carboxyl ACP thioesterase	9.38e-03	NA	NA	0.3683
6. F	B7JLZ5	Ribonuclease Z	3.81e-03	NA	NA	0.4183
6. F	B7NNU8	Ribonuclease BN	2.88e-03	NA	NA	0.5027
6. F	P54548	Ribonuclease Z	2.81e-03	NA	NA	0.5126
6. F	A2BL74	UPF0173 metal-dependent hydrolase Hbut_0886	2.04e-03	NA	NA	0.5176
6. F	B7IWQ5	Ribonuclease Z	3.63e-03	NA	NA	0.4223
6. F	Q5F7J0	Hydroxyacylglutathione hydrolase	1.24e-02	NA	NA	0.3865
6. F	Q8ZD92	Probable 3',5'-cyclic-nucleotide phosphodiesterase	4.60e-03	NA	NA	0.3675
7. B	A3MZD3	Hydroxyacylglutathione hydrolase	2.26e-02	NA	0.004	NA
7. B	Q06224	Endoribonuclease YSH1	6.88e-07	NA	1.25e-05	NA
7. B	Q9JIC3	DNA cross-link repair 1A protein	2.02e-03	NA	0.010	NA
7. B	A9A3X2	Ribonuclease Z	4.51e-03	NA	0.019	NA
7. B	A7MY07	Hydroxyacylglutathione hydrolase	6.78e-03	NA	0.034	NA
7. B	Q493H8	Hydroxyacylglutathione hydrolase	1.22e-02	NA	0.013	NA
7. B	Q4WA58	Lactamase-like protein nscB	9.45e-03	NA	0.045	NA
7. B	C5BEP2	Hydroxyacylglutathione hydrolase	1.08e-02	NA	0.006	NA
7. B	Q58633	Uncharacterized protein MJ1236	3.61e-09	NA	0.042	NA
7. B	B7VIP5	Hydroxyacylglutathione hydrolase	6.39e-03	NA	0.018	NA
7. B	Q55BS1	Cleavage and polyadenylation specificity factor subunit 2	3.29e-05	NA	0.019	NA
7. B	Q46GM1	Hydroxyacylglutathione hydrolase	7.97e-03	NA	8.99e-05	NA
7. B	Q2NVG1	Hydroxyacylglutathione hydrolase	7.37e-03	NA	0.040	NA
7. B	Q87MG0	Hydroxyacylglutathione hydrolase	7.96e-03	NA	0.043	NA
7. B	B5Y1G4	Hydroxyacylglutathione hydrolase	6.62e-03	NA	0.014	NA
7. B	A5F635	Hydroxyacylglutathione hydrolase	5.66e-03	NA	0.027	NA
7. B	C3LPP0	Hydroxyacylglutathione hydrolase	5.70e-03	NA	0.027	NA
7. B	B2S457	Ribonuclease Z	3.31e-03	NA	0.002	NA
7. B	B0BTR9	Hydroxyacylglutathione hydrolase	2.15e-02	NA	0.002	NA
7. B	Q84W56	Ribonuclease J	0.00e+00	NA	1.23e-79	NA
7. B	O07896	Ribonuclease Z	3.04e-03	NA	0.002	NA
7. B	Q54YL3	Integrator complex subunit 11 homolog	6.70e-06	NA	0.001	NA
7. B	B3H0S9	Hydroxyacylglutathione hydrolase	2.12e-02	NA	0.002	NA
7. B	A4G7G5	Hydroxyacylglutathione hydrolase	1.64e-02	NA	4.16e-04	NA
7. B	Q9KPX6	Hydroxyacylglutathione hydrolase	5.69e-03	NA	0.027	NA
7. B	A6T510	Hydroxyacylglutathione hydrolase	7.11e-03	NA	0.014	NA
7. B	Q5QZL0	Hydroxyacylglutathione hydrolase	2.02e-02	NA	0.002	NA