Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54865.1
JCVISYN3A_0601

Uncharacterized protein.
M. mycoides homolog: Q6MSU7.
TIGRfam Classification: 2=Generic.
Category: Nonessential.

Statistics

Total GO Annotation: 56
Unique PROST Go: 56
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 136
Unique PROST Homologs: 136
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
Antczak et al. [3]: Anion/Cation transmembrane transporter
Zhang et al. [4]: GO:0051307|meiotic chromosome separation
Bianchi et al. [5]: "Membrane protein, possibly rapE-like?"

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q9UTP5 (Meiotically up-regulated gene 162 protein) with a FATCAT P-Value: 1.08e-06 and RMSD of 2.76 angstrom. The sequence alignment identity is 19.7%.
Structural alignment shown in left. Query protein AVX54865.1 colored as red in alignment, homolog Q9UTP5 colored as blue. Query protein AVX54865.1 is also shown in right top, homolog Q9UTP5 showed in right bottom. They are colored based on secondary structures. 

  AVX54865.1 MKNNNSSFFSSPRTQIKVFQWVGTIFAVIGMLISLYFLSKINPQQLDQPKQVLLSLGYATMGYMFWKTIISAVIILRFVKKSTDEELVANRYILASLSLN 100
      Q9UTP5 ------------------------------------------------------------MDDEVYKQRLTALNNLRIV-------IFFD--ILIIL--- 28

  AVX54865.1 LG--GFLTPWILTSLPNVTTQS--TIKPK-WFLSRSFAI----ITTIGSA---------IF-L-GILFWQL--KIIGPNTNWFDQTKEWYWILLGFIIGN 178
      Q9UTP5 LGYIG--T-WNLKTL-QLVNPSLWSFSPSLWIYIRGTVLCADCIFTAGSANEYSAVQNSVFQVSSLMFYGLMMEFFGYS---FDR--------VG----- 108

  AVX54865.1 GVLLVVGLLAF--ILFFN----KN-S-KERFEGN-TFTSFLMKTIAVFYLVIVTVELILLMI-YS--ILRLIGNI-LNTARRVLQADNMFIGV-L----- 259
      Q9UTP5 --CMELAFISFSAACYFNIRSIKSLSLKNK---NWTIISIIEIPIKLHFILNV-----LLFLKFSEYMLPLLGRVHLSYHLFALWVINLYIWIKLIDSKD 198

  AVX54865.1 YLL-F--G----LLST--FFQ----IYYVIFLT--IMISQTIKGIWRKDGVITIKVY--DKIQDN-KN-KY---DLR--- 314
      Q9UTP5 FVLGFLAGLSVLLLNTGSLITAKPLISYFNLLTSCLII---FPSIW---------IYAIEK--KNFKNLSYEDDDYRNYW 264

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
5. P GO:0051912 CoB--CoM heterodisulfide reductase activity
5. P GO:0042158 lipoprotein biosynthetic process
5. P GO:0016117 carotenoid biosynthetic process
5. P GO:0005887 integral component of plasma membrane
5. P GO:0055036 virion membrane
5. P GO:0005886 plasma membrane
5. P GO:0019645 anaerobic electron transport chain
5. P GO:0048017 inositol lipid-mediated signaling
5. P GO:0051082 unfolded protein binding
5. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
5. P GO:0007602 phototransduction
5. P GO:0044201 host cell nuclear inner membrane
5. P GO:0051321 meiotic cell cycle
5. P GO:0042574 retinal metabolic process
5. P GO:0016767 geranylgeranyl-diphosphate geranylgeranyltransferase activity
5. P GO:0015031 protein transport
5. P GO:0018298 protein-chromophore linkage
5. P GO:1900429 negative regulation of filamentous growth of a population of unicellular organisms
5. P GO:0016829 lyase activity
5. P GO:0009881 photoreceptor activity
5. P GO:0060257 negative regulation of flocculation
5. P GO:0006784 heme A biosynthetic process
5. P GO:0044178 host cell Golgi membrane
5. P GO:0005216 ion channel activity
5. P GO:0006276 plasmid maintenance
5. P GO:0006038 cell wall chitin biosynthetic process
5. P GO:0030269 tetrahydromethanopterin S-methyltransferase activity
5. P GO:0009325 nitrate reductase complex
5. P GO:0034221 fungal-type cell wall chitin biosynthetic process
5. P GO:0016653 oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor
5. P GO:0044175 host cell endosome membrane
5. P GO:0016021 integral component of membrane
5. P GO:1990862 nuclear membrane complex Bqt3-Bqt4
5. P GO:0045436 lycopene beta cyclase activity
5. P GO:0071555 cell wall organization
5. P GO:0061093 negative regulation of phospholipid translocation
5. P GO:0034257 nicotinamide riboside transmembrane transporter activity
5. P GO:0051223 regulation of protein transport
5. P GO:0034258 nicotinamide riboside transport
5. P GO:0016872 intramolecular lyase activity
5. P GO:0000128 flocculation
5. P GO:0032259 methylation
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0032200 telomere organization
5. P GO:0044182 filamentous growth of a population of unicellular organisms
5. P GO:0044799 NarGHI complex
5. P GO:0062239 heterochromatin-nuclear membrane anchor activity
5. P GO:0044423 virion component
5. P GO:0007033 vacuole organization
5. P GO:0019031 viral envelope
5. P GO:0006730 one-carbon metabolic process
5. P GO:0008961 phosphatidylglycerol-prolipoprotein diacylglyceryl transferase activity
5. P GO:0019386 methanogenesis, from carbon dioxide
5. P GO:0045141 meiotic telomere clustering
5. P GO:0015948 methanogenesis
5. P GO:0016120 carotene biosynthetic process

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
5. P A0ALG6 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 5.35e-04 1.51e-02 NA NA
5. P Q58259 Tetrahydromethanopterin S-methyltransferase subunit C 1.98e-04 2.28e-06 NA NA
5. P Q8SVF5 UPF0328 protein ECU06_0070 1.87e-05 4.68e-09 NA NA
5. P Q1DKX4 Chitin synthase export chaperone 6.86e-05 5.65e-04 NA NA
5. P Q48315 Halorhodopsin 1.39e-05 5.31e-04 NA NA
5. P Q8STY8 UPF0328 protein ECU09_0020 6.63e-06 2.88e-02 NA NA
5. P P80185 Tetrahydromethanopterin S-methyltransferase subunit C 2.51e-04 1.63e-05 NA NA
5. P P24520 Nicotinamide riboside transporter PnuC 8.48e-04 5.83e-04 NA NA
5. P O10361 Uncharacterized 26.5 kDa protein NA 6.39e-03 NA NA
5. P J7FIP9 Indole-diterpene biosynthesis cluster protein S 6.20e-04 3.69e-02 NA NA
5. P Q8ST65 UPF0328 protein ECU05_1690/ECU11_0040 2.69e-05 2.54e-07 NA NA
5. P Q5UXY6 Bacteriorhodopsin-I 2.26e-05 1.72e-05 NA NA
5. P Q01017 Envelope glycoprotein M NA 1.42e-03 NA NA
5. P P60966 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 1.08e-03 4.31e-02 NA NA
5. P P0DMH8 Sensory rhodopsin-1 7.05e-06 1.96e-03 NA NA
5. P P75603 Uncharacterized protein MPN_090 2.50e-06 1.61e-10 NA NA
5. P Q9UTP5 Meiotically up-regulated gene 162 protein 1.08e-06 4.89e-04 NA NA
5. P Q8ER78 Heme A synthase 5.04e-06 4.81e-02 NA NA
5. P P0AFK2 Nicotinamide riboside transporter PnuC 2.41e-04 4.59e-04 NA NA
5. P P75910 Uncharacterized protein YcdU 7.23e-05 3.81e-12 NA NA
5. P P75501 Uncharacterized protein MG135 homolog 6.83e-04 3.66e-02 NA NA
5. P Q96IK0 Transmembrane protein 101 4.63e-05 2.46e-02 NA NA
5. P O59638 Tetrahydromethanopterin S-methyltransferase subunit C 7.90e-05 3.85e-07 NA NA
5. P Q91VP7 Transmembrane protein 101 4.29e-05 1.76e-02 NA NA
5. P Q9PR70 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 1.20e-03 1.26e-02 NA NA
5. P Q8SUI0 UPF0328 protein ECU08_2060 5.66e-06 2.88e-06 NA NA
5. P B0BMG8 Transmembrane protein 82 7.17e-05 2.06e-02 NA NA
5. P O32865 Tetrahydromethanopterin S-methyltransferase subunit C 1.44e-04 1.36e-05 NA NA
5. P Q5V5V3 Sensory rhodopsin II 1.94e-06 1.26e-02 NA NA
5. P O83297 Uncharacterized protein TP_0273 5.38e-05 1.27e-03 NA NA
5. P Q8TSV8 Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E 2.35e-04 7.17e-03 NA NA
5. P Q6LWZ2 Tetrahydromethanopterin S-methyltransferase subunit C 2.34e-04 9.84e-04 NA NA
5. P Q0UDX8 Chitin synthase export chaperone 4.05e-05 2.23e-03 NA NA
5. P O93743 Sensory rhodopsin 2.48e-05 2.46e-03 NA NA
5. P Q8SUS0 Uncharacterized membrane protein ECU08_0540 1.72e-05 3.56e-02 NA NA
5. P Q5RFN8 Transmembrane protein 101 3.42e-05 4.94e-02 NA NA
5. P Q8STF1 UPF0328 protein ECU05_1640/ECU11_0090 4.48e-06 2.04e-03 NA NA
5. P Q8STJ1 UPF0328 protein ECU07_1870/ECU10_0030 2.41e-05 4.09e-04 NA NA
5. P A9JPE3 Terpene cyclase atmB 3.22e-05 9.04e-03 NA NA
5. P Q8Y4G2 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 4.72e-04 1.06e-02 NA NA
5. P O30065 Uncharacterized protein AF_0172 7.46e-05 2.89e-03 NA NA
5. P Q57685 Uncharacterized protein MJ0233 2.89e-06 2.91e-02 NA NA
5. P Q5UPE7 Uncharacterized protein L68 NA 6.95e-04 NA NA
5. P Q5UXM9 Sensory rhodopsin I 2.06e-05 4.00e-03 NA NA
5. P Q57425 Nicotinamide riboside transporter PnuC 5.00e-05 2.69e-04 NA NA
5. P O67008 Uncharacterized protein aq_836 3.29e-04 1.91e-02 NA NA
5. P Q4IJ79 Chitin synthase export chaperone 3.78e-05 1.55e-02 NA NA
5. P O27229 Tetrahydromethanopterin S-methyltransferase subunit C 1.84e-04 3.24e-06 NA NA
5. P P0DMH7 Halorhodopsin 4.41e-05 7.51e-05 NA NA
5. P Q2UNJ0 Chitin synthase export chaperone 4.25e-05 2.39e-04 NA NA
5. P Q8SW83 UPF0328 protein ECU03_0040 2.93e-06 3.90e-07 NA NA
5. P B8DBM9 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 4.51e-04 2.24e-02 NA NA
5. P O36388 Envelope glycoprotein M NA 7.12e-05 NA NA
5. P Q53496 Cruxrhodopsin-2 2.40e-05 3.52e-06 NA NA
5. P Q8TU01 Tetrahydromethanopterin S-methyltransferase subunit C 7.50e-05 3.76e-07 NA NA
5. P Q8SVF2 UPF0328 protein ECU06_0100 6.80e-06 2.08e-02 NA NA
5. P A0A0A1GNF2 Bisanhydrobacterioruberin hydratase 8.07e-04 3.48e-03 NA NA
5. P Q8SU92 UPF0328 protein ECU10_1850 5.82e-06 2.79e-08 NA NA
5. P P52371 Envelope glycoprotein M NA 6.45e-03 NA NA
5. P O67662 Uncharacterized protein aq_1793 4.36e-05 2.45e-04 NA NA
5. P O29750 Hdr-like menaquinol oxidoreductase integral membrane subunit 2.69e-03 2.19e-03 NA NA
5. P P71411 Sensory rhodopsin-2 4.91e-05 8.89e-04 NA NA
5. P Q8ST81 UPF0328 protein ECU06_0020/ECU06_1700 8.32e-06 3.02e-06 NA NA
5. P Q6UDH4 Envelope glycoprotein M NA 6.96e-05 NA NA
5. P Q8CMK8 Membrane protein insertase YidC 1 4.66e-04 3.73e-02 NA NA
5. P Q5AA40 Chitin synthase export chaperone 3.26e-05 2.61e-03 NA NA
5. P Q8PVW4 Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E 2.89e-04 1.62e-03 NA NA
5. P O54089 Cytochrome b558/566 subunit B 1.48e-04 1.21e-06 NA NA
5. P P42197 Sensory rhodopsin-2 5.51e-05 1.26e-02 NA NA
5. P Q5YCW8 Chitin synthase export chaperone 3.81e-05 8.05e-03 NA NA
5. P Q6MYT0 Chitin synthase export chaperone 5.75e-05 8.53e-04 NA NA
5. P Q57101 Cruxrhodopsin-1 1.24e-05 1.78e-05 NA NA
5. P P0AFK3 Nicotinamide riboside transporter PnuC 1.62e-04 4.59e-04 NA NA
5. P B1AI60 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 3.69e-04 1.26e-02 NA NA
5. P Q48334 Bacterial rhodopsin CSR3 2.98e-05 2.58e-02 NA NA
5. P P52370 Envelope glycoprotein M NA 2.10e-03 NA NA
5. P O34535 Uncharacterized protein YoaT 2.77e-04 5.47e-05 NA NA
5. P Q8ST97 UPF0328 protein ECU01_0070/ECU01_1540/ECU02_1570/ECU04_0080/ECU08_2100 7.60e-05 6.78e-10 NA NA
5. P Q9E6Q6 Envelope glycoprotein M NA 3.28e-03 NA NA
5. P B0R2U4 Halorhodopsin 4.55e-05 7.51e-05 NA NA
5. P Q71WU5 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 4.87e-04 1.27e-02 NA NA
5. P Q8STG4 UPF0328 protein ECU05_1660/ECU11_0070 5.17e-06 1.39e-04 NA NA
5. P P15647 Halorhodopsin 6.66e-05 3.46e-04 NA NA
5. P Q8SW84 UPF0328 protein ECU03_0020 9.05e-06 4.40e-07 NA NA
5. P Q8ST35 UPF0328 protein ECU02_0020/ECU04_1700 2.74e-06 7.60e-03 NA NA
5. P Q85041 Envelope glycoprotein M NA 6.14e-04 NA NA
5. P P94853 Cruxhalorhodopsin-3 2.77e-05 3.42e-03 NA NA
5. P O28703 Uncharacterized protein AF_1569 7.84e-05 5.85e-03 NA NA
5. P Q48314 Halorhodopsin 1.44e-05 1.55e-03 NA NA
5. P O74870 Meiotically up-regulated gene 73 protein 1.61e-05 1.40e-03 NA NA
5. P Q5BEG1 Chitin synthase export chaperone 7.25e-05 1.28e-03 NA NA
5. P A0A0E3NFS5 Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit E 3.62e-04 3.16e-02 NA NA
5. P Q2H7Q1 Chitin synthase export chaperone 4.30e-05 5.06e-03 NA NA
5. P P58030 Cytochrome b558/566 subunit B 9.06e-05 7.79e-09 NA NA
5. P Q8SWH3 UPF0328 protein ECU02_0090 2.25e-06 1.22e-05 NA NA
5. P A4FVW3 Tetrahydromethanopterin S-methyltransferase subunit C 2.87e-04 8.29e-05 NA NA
5. P Q8SW76 UPF0328 protein ECU03_0110 5.29e-06 7.60e-05 NA NA
5. P C1KYP9 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 4.43e-04 1.27e-02 NA NA
5. P P9WEQ3 Terpene cyclase olcD 3.94e-05 2.31e-05 NA NA
5. P Q9UUJ8 UPF0658 Golgi apparatus membrane protein C1952.10c 1.25e-06 4.00e-03 NA NA
5. P Q5V1N0 Halorhodopsin 1.24e-05 1.19e-03 NA NA
5. P Q03GY4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 3.75e-04 2.19e-03 NA NA
5. P Q9HNE5 Lycopene beta-cyclase 4.57e-04 1.32e-03 NA NA
5. P P16733 Envelope glycoprotein M NA 3.01e-02 NA NA
5. P P33742 Halorhodopsin 2.78e-05 1.00e-02 NA NA
5. P B0R753 Lycopene beta-cyclase 4.50e-04 1.32e-03 NA NA
5. P Q8SVY8 UPF0328 protein ECU03_1620 1.80e-05 3.48e-05 NA NA
5. P B1HPV0 Heme A synthase 3.62e-06 7.38e-03 NA NA
5. P Q928B1 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 4.52e-04 8.95e-03 NA NA
5. P Q7ZVW1 Transmembrane protein 117 5.40e-03 7.09e-04 NA NA
5. P Q8SVN9 UPF0328 protein ECU05_0050 6.66e-05 9.39e-07 NA NA
5. P A6VHF0 Tetrahydromethanopterin S-methyltransferase subunit C 2.71e-04 1.59e-05 NA NA
5. P Q5UQI2 Uncharacterized protein R809 NA 9.30e-03 NA NA
5. P O94440 Uncharacterized protein C637.03 5.89e-06 3.65e-04 NA NA
5. P Q9Y8K2 Tetrahydromethanopterin S-methyltransferase subunit C 6.83e-05 7.19e-06 NA NA
5. P A0A1B7YCX1 Terpene cyclase dpchB 6.13e-05 1.57e-02 NA NA
5. P P0CS99 UPF0328 protein ECU09_2030 6.87e-06 1.06e-08 NA NA
5. P B0R633 Sensory rhodopsin-1 7.01e-06 1.96e-03 NA NA
5. P Q6SW43 Envelope glycoprotein M NA 1.05e-02 NA NA
5. P Q8SV55 UPF0328 protein ECU07_0060 1.46e-06 2.39e-04 NA NA
5. P A1CPR8 Chitin synthase export chaperone 7.03e-05 1.86e-03 NA NA
5. P Q8SW74 UPF0328 protein ECU03_0130 1.11e-05 5.11e-03 NA NA
5. P P41679 Protein AC124 NA 3.42e-03 NA NA
5. P Q6BUS8 Chitin synthase export chaperone 1.10e-05 4.01e-02 NA NA
5. P P35735 Protein SFK1 8.20e-05 3.16e-02 NA NA
5. P P18015 Copy number protein 6.24e-06 3.73e-04 NA NA
5. P P11350 Respiratory nitrate reductase 1 gamma chain 8.42e-04 4.73e-02 NA NA
5. P P94854 Cruxrhodopsin-3 6.55e-06 5.72e-05 NA NA
5. P P33392 Protein DVU_0532 5.75e-04 1.75e-03 NA NA
5. P P42196 Sensory rhodopsin-2 1.31e-05 8.02e-04 NA NA
5. P B5ZAQ4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 5.58e-04 4.33e-03 NA NA
5. P Q5V4H7 Sensory rhodopsin III 1.33e-05 1.26e-02 NA NA
5. P P28948 Envelope glycoprotein M NA 3.66e-03 NA NA
5. P O74510 Bouquet formation protein 3 2.29e-05 1.50e-02 NA NA
5. P A0A2I6PJ07 Terpene cyclase nodB 1.10e-04 1.13e-02 NA NA
5. P Q98PL0 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 2.26e-04 3.66e-03 NA NA