Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54866.1
JCVISYN3A_0604
Uncharacterized protein.
M. mycoides homolog: NA.
TIGRfam Classification: NA.
Category: Nonessential.
Statistics
Total GO Annotation: 15
Unique PROST Go: 12
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 41
Unique PROST Homologs: 36
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A8AVK0
(Protein LemA) with a FATCAT P-Value: 0 and RMSD of 2.09 angstrom. The sequence alignment identity is 23.0%.
Structural alignment shown in left. Query protein AVX54866.1 colored as red in alignment, homolog A8AVK0 colored as blue.
Query protein AVX54866.1 is also shown in right top, homolog A8AVK0 showed in right bottom. They are colored based on secondary structures.
AVX54866.1 MANQLDEMNDPILEQGRQVNVINKQIPITVGKGSLVFEILLWILGIIPGIIFTFIKIKAKNHLAQLEQKVQHNASQIDNYLDQRAVVMQNLASLLSKSI- 99 A8AVK0 ------------------------------------MSFIITIAVIV--VIVLFV-ISVYNSLVRARMQTQEAWSQIDVQLKRRNDLLPNLIETV-KGYG 60 AVX54866.1 ELDKDVMKTVAAYRSGINVNDENR-SDV--ASQLDT-T--IRGLHLQIENYPDLKAHES-IKQALQQNL-YLQKEITAARDIYNDTVFQWNRSINEWPAK 191 A8AVK0 KYEQATLEKVTQLRA--QVASASSPADAMKAS--DALTRQISGIFAVAESYPDLKANENYLK--LQEELTNTENKISYSRQLYNSVAGNYNVKLQAFPSN 154 AVX54866.1 MIVAAKMHYTTRIP--FAAS-AETKKLASQDFFK----- 222 A8AVK0 VI--AGM-FAFR-PADFLSTPEEEKAVPKVDFGSNGLGE 189
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0016021 | integral component of membrane |
| 2. PF | GO:0110146 | magnetosome membrane |
| 5. P | GO:0071944 | cell periphery |
| 5. P | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
| 5. P | GO:0008817 | cob(I)yrinic acid a,c-diamide adenosyltransferase activity |
| 5. P | GO:0031207 | Sec62/Sec63 complex |
| 5. P | GO:0009535 | chloroplast thylakoid membrane |
| 5. P | GO:0031204 | posttranslational protein targeting to membrane, translocation |
| 5. P | GO:0042717 | plasma membrane-derived chromatophore membrane |
| 5. P | GO:0006779 | porphyrin-containing compound biosynthetic process |
| 5. P | GO:0046686 | response to cadmium ion |
| 5. P | GO:0030447 | filamentous growth |
| 5. P | GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) |
| 5. P | GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A8AVK0 | Protein LemA | 0.00e+00 | 4.52e-14 | 7.10e-04 | 0.8017 |
| 1. PBF | P43054 | Protein LemA | 5.02e-13 | 1.65e-41 | 1.10e-05 | 0.6341 |
| 2. PF | Q2W8P9 | Magnetosome protein MamQ 1 | 1.49e-10 | 1.09e-27 | NA | 0.5542 |
| 2. PF | Q2W8L6 | Magnetosome protein MamQ 2 | 4.94e-10 | 1.09e-27 | NA | 0.4883 |
| 4. PB | Q58971 | Protein LemA | 1.33e-14 | 2.03e-23 | 3.66e-05 | NA |
| 5. P | Q6ENW7 | ATP synthase subunit b, chloroplastic | 7.05e-06 | 3.39e-02 | NA | NA |
| 5. P | Q50327 | ATP synthase subunit b | 1.18e-05 | 4.18e-02 | NA | NA |
| 5. P | Q5V4H8 | Probable sensory rhodopsin transducer | 1.26e-04 | 2.32e-02 | NA | NA |
| 5. P | O05332 | ATP synthase subunit b' | 5.21e-05 | 1.76e-02 | NA | NA |
| 5. P | O34460 | Sporulation membrane protein YtrI | 3.28e-03 | 8.81e-03 | NA | NA |
| 5. P | P44043 | Uncharacterized protein HI_0725 | 5.36e-06 | 3.89e-02 | NA | NA |
| 5. P | Q8Y9T5 | Listeria nuclear targeted protein A | 1.01e-04 | 4.32e-03 | NA | NA |
| 5. P | P51700 | Uncharacterized 23.2 kDa protein in int-C1 intergenic region | NA | 3.12e-04 | NA | NA |
| 5. P | B6IX46 | ATP synthase subunit b 2 | 8.59e-05 | 4.34e-02 | NA | NA |
| 5. P | P07049 | Cryptic plasmid protein B | 6.21e-05 | 4.40e-03 | NA | NA |
| 5. P | P45515 | Corrinoid adenosyltransferase | 9.52e-04 | 1.81e-02 | NA | NA |
| 5. P | A0A321 | ATP synthase subunit b, chloroplastic | 4.01e-05 | 2.16e-02 | NA | NA |
| 5. P | P44773 | Uncharacterized protein HI_0603 | 1.66e-04 | 5.27e-06 | NA | NA |
| 5. P | O67901 | Uncharacterized protein aq_2145 | 2.84e-03 | 3.30e-05 | NA | NA |
| 5. P | P47643 | ATP synthase subunit b | 8.22e-06 | 6.67e-03 | NA | NA |
| 5. P | A1E9S0 | ATP synthase subunit b, chloroplastic | 1.35e-05 | 2.28e-02 | NA | NA |
| 5. P | P33754 | Translocation protein SEC66 | 1.51e-04 | 1.92e-07 | NA | NA |
| 5. P | Q58828 | Uncharacterized protein MJ1433 | 7.47e-05 | 3.89e-02 | NA | NA |
| 5. P | P21884 | Uncharacterized lipoprotein YkyA | 2.40e-05 | 1.05e-03 | NA | NA |
| 5. P | Q44582 | Nickel-cobalt-cadmium resistance protein NccX | 5.27e-04 | 1.31e-02 | NA | NA |
| 5. P | P0C156 | ATP synthase subunit b, chloroplastic | 1.37e-05 | 3.39e-02 | NA | NA |
| 5. P | Q5UNX0 | Uncharacterized protein L717 | NA | 3.15e-03 | NA | NA |
| 5. P | Q93DY8 | Magnetosome protein MamQ | 1.43e-05 | 4.05e-29 | NA | NA |
| 5. P | P22403 | Protein KilB | 2.63e-05 | 9.31e-04 | NA | NA |
| 5. P | B2XTP4 | ATP synthase subunit b, chloroplastic | 8.83e-06 | 7.86e-06 | NA | NA |
| 5. P | O64363 | Protein gp55 | NA | 1.57e-02 | NA | NA |
| 5. P | P76158 | Uncharacterized protein RzpQ | 3.05e-07 | 2.32e-02 | NA | NA |
| 5. P | P37467 | Protein XpaC | 3.47e-05 | 1.03e-07 | NA | NA |
| 5. P | O29338 | Uncharacterized protein AF_0924 | 2.67e-04 | 2.59e-05 | NA | NA |
| 5. P | A1EA04 | ATP synthase subunit b, chloroplastic | 4.77e-05 | 4.88e-02 | NA | NA |
| 5. P | P38477 | ATP synthase protein MI25 | 9.27e-05 | 1.87e-03 | NA | NA |
| 5. P | B7T1R8 | ATP synthase subunit b, chloroplastic | 9.07e-06 | 9.70e-03 | NA | NA |
| 5. P | O67701 | Uncharacterized protein aq_1849 | 1.93e-05 | 2.48e-02 | NA | NA |
| 5. P | Q06J69 | ATP synthase subunit b, chloroplastic | 1.72e-05 | 2.78e-04 | NA | NA |
| 5. P | B2XT88 | ATP synthase subunit b, chloroplastic | 7.23e-06 | 7.86e-06 | NA | NA |
| 5. P | P37975 | Nickel and cobalt resistance protein CnrR | 2.85e-05 | 1.51e-02 | NA | NA |