Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54876.1
JCVISYN3A_0614

Nicotinate phosphoribosyltransferase.
M. mycoides homolog: Q6MST2.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 59
Unique PROST Go: 46
Unique BLAST Go: 3
Unique Foldseek Go: 2

Total Homologs: 220
Unique PROST Homologs: 110
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: pncB; Nicotinate phosphoribosyltransferase
Zhang et al. [4]: GO:0004516|nicotinate phosphoribosyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P9WJI8 (Nicotinate phosphoribosyltransferase pncB1) with a FATCAT P-Value: 0 and RMSD of 2.74 angstrom. The sequence alignment identity is 20.2%.
Structural alignment shown in left. Query protein AVX54876.1 colored as red in alignment, homolog P9WJI8 colored as blue. Query protein AVX54876.1 is also shown in right top, homolog P9WJI8 showed in right bottom. They are colored based on secondary structures. 

  AVX54876.1 ---------------------------------------MQNK-TKFK-FDPRVKDG--Y-FIADYFKKTVEILKNFKHDQIITMQFFQRNDNVVLCGIS 56
      P9WJI8 MGPPPAARRREGEPDNQDPAGLLTDKYELTMLAAALRDGSANRPTTFEVFARRLPTGRRYGVVAG-TGRLLEALPQFRFDA----------D---AC--- 83

  AVX54876.1 EVIDLL-KFASP---NY-------DDLEIYALNDGDIINSKEPVLKITGRYQDFGWLEGMIDGILSRNTSIATNSKQIIDAANHKDVLNMLD-RADNYLT 144
      P9WJI8 ---ELLAQFLDPATVRYLREFRFRGDIDGYA--EGELYFPGSPVLSVRGSFAECVLLETLVLSIFNHDTAIASAAARMVSAAGGRPLIEMGSRRTHERAA 178

  AVX54876.1 LASDGYASYIGGF----RLFVTEASLEYIDDKTVLQPS-GTMPHA--LIQA-FNGDT-LKAADAFYKTY-----PNNKLVVLID-YD--NDCVNMAAKIG 227
      P9WJI8 VAA-ARAAYIAGFAASSNL---AAQRRY----GV--PAHGTAAHAFTMLHAQHGGPTEL-AERAAFRAQVEALGPGTTL--LVDTYDVTTGVANAVAAAG 265

  AVX54876.1 QHFKEKLYAVRLDTSENLVDKFFINNKEYTNQTNLNGVSEQLVREVRKALDNVGCNHTKIIVSSSFSANKIKEFESKNVPVDIYGVGSALAKINIHFTG- 326
      P9WJI8 ----AELGAIRIDSGE-L------------------GV---LARQAREQLDRLGATRTRIVVSGDLDEFSIAAL--RGEPVDSYGVGTSL------VTGS 331

  AVX54876.1 --------------DAVLINNQKQAKF-----GRENIENLRLKKVK------------------------------------------------------ 353
      P9WJI8 GAPTANMVYKLVEVDGVPV--QKRSSYKESPGGRK--EALRRSRATGTITEELVHPAGRPPVIVEPHRVLTLPLVRAGQPVADTSLAAARQLVASGLRSL 427

  AVX54876.1 --------------------- 353
      P9WJI8 PADGLKLAPGEPAIPTRTIPA 448

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0009435 NAD biosynthetic process
1. PBF GO:0047280 nicotinamide phosphoribosyltransferase activity
1. PBF GO:0004514 nicotinate-nucleotide diphosphorylase (carboxylating) activity
1. PBF GO:0004516 nicotinate phosphoribosyltransferase activity
1. PBF GO:0034355 NAD salvage
2. PF GO:1902494 catalytic complex
2. PF GO:0034213 quinolinate catabolic process
4. PB GO:0005829 cytosol
5. P GO:0090650 cellular response to oxygen-glucose deprivation
5. P GO:0032922 circadian regulation of gene expression
5. P GO:0015948 methanogenesis
5. P GO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway
5. P GO:0007623 circadian rhythm
5. P GO:1904646 cellular response to amyloid-beta
5. P GO:0070997 neuron death
5. P GO:0000015 phosphopyruvate hydratase complex
5. P GO:0044275 cellular carbohydrate catabolic process
5. P GO:1990663 dihydroorotate dehydrogenase (fumarate) activity
5. P GO:0070402 NADPH binding
5. P GO:0004853 uroporphyrinogen decarboxylase activity
5. P GO:0006979 response to oxidative stress
5. P GO:0034628 'de novo' NAD biosynthetic process from aspartate
5. P GO:0006085 acetyl-CoA biosynthetic process
5. P GO:0010507 negative regulation of autophagy
5. P GO:0015977 carbon fixation
5. P GO:2000773 negative regulation of cellular senescence
5. P GO:0004634 phosphopyruvate hydratase activity
5. P GO:0050096 methylaspartate ammonia-lyase activity
5. P GO:0014916 regulation of lung blood pressure
5. P GO:0010181 FMN binding
5. P GO:0005125 cytokine activity
5. P GO:0014070 response to organic cyclic compound
5. P GO:0001774 microglial cell activation
5. P GO:0016853 isomerase activity
5. P GO:0007568 aging
5. P GO:0000183 rDNA heterochromatin assembly
5. P GO:0019516 lactate oxidation
5. P GO:0008299 isoprenoid biosynthetic process
5. P GO:0009063 cellular amino acid catabolic process
5. P GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process
5. P GO:0046874 quinolinate metabolic process
5. P GO:0004457 lactate dehydrogenase activity
5. P GO:0050023 L-fuconate dehydratase activity
5. P GO:0008959 phosphate acetyltransferase activity
5. P GO:0007565 female pregnancy
5. P GO:0019553 glutamate catabolic process via L-citramalate
5. P GO:1990088 [methyl-Co(III) methanol-specific corrinoid protein]:coenzyme M methyltransferase
5. P GO:0006779 porphyrin-containing compound biosynthetic process
5. P GO:1905377 response to D-galactose
5. P GO:0004452 isopentenyl-diphosphate delta-isomerase activity
5. P GO:0030054 cell junction
5. P GO:0019358 nicotinate nucleotide salvage
5. P GO:0071479 cellular response to ionizing radiation
5. P GO:0048661 positive regulation of smooth muscle cell proliferation
6. F GO:0008218 bioluminescence
6. F GO:0006734 NADH metabolic process
7. B GO:0005618 cell wall
7. B GO:0075136 response to host
7. B GO:0001666 response to hypoxia

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0009435 NAD biosynthetic process
GO:0004516 nicotinate phosphoribosyltransferase activity
GO:0016874 ligase activity
GO:0019363 pyridine nucleotide biosynthetic process
GO:0016763 pentosyltransferase activity
GO:0016757 glycosyltransferase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9HJ28 Putative nicotinate phosphoribosyltransferase 0.00e+00 1.07e-17 1.66e-17 0.811
1. PBF P9WJI8 Nicotinate phosphoribosyltransferase pncB1 0.00e+00 6.10e-08 7.93e-07 0.7583
2. PF Q6F6W1 Nicotinate phosphoribosyltransferase 4.07e-06 1.67e-05 NA 0.4019
2. PF B7M860 Nicotinate phosphoribosyltransferase 4.92e-08 3.05e-05 NA 0.4021
2. PF Q5PGD8 Nicotinate phosphoribosyltransferase 4.31e-08 1.09e-05 NA 0.3954
2. PF Q8DA38 Nicotinate phosphoribosyltransferase 3.49e-07 1.09e-04 NA 0.4243
2. PF C6DFB8 Nicotinate phosphoribosyltransferase 4.00e-08 1.91e-04 NA 0.3977
2. PF Q1QZ10 Nicotinate phosphoribosyltransferase 3.98e-08 5.00e-06 NA 0.4189
2. PF Q5F836 Nicotinate phosphoribosyltransferase 1.28e-07 5.66e-06 NA 0.4281
2. PF Q8Y0L2 Nicotinate phosphoribosyltransferase 3.57e-08 2.01e-05 NA 0.4077
2. PF I3LK75 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.78e-10 4.87e-11 NA 0.7109
2. PF P94777 Putative pyrophosphorylase ModD 9.99e-16 1.06e-11 NA 0.7081
2. PF Q9CLU4 Putative pyrophosphorylase ModD 4.44e-16 4.07e-10 NA 0.7648
2. PF A7MEW8 Nicotinate phosphoribosyltransferase 4.95e-08 1.55e-04 NA 0.4106
2. PF Q3T063 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.84e-10 4.17e-10 NA 0.7051
2. PF Q63S63 Nicotinate phosphoribosyltransferase 4.99e-08 2.34e-07 NA 0.4236
2. PF Q7MK41 Nicotinate phosphoribosyltransferase 3.35e-07 2.33e-04 NA 0.4229
2. PF A7ZK22 Nicotinate phosphoribosyltransferase 5.06e-08 3.05e-05 NA 0.3881
2. PF B4T172 Nicotinate phosphoribosyltransferase 5.54e-08 1.09e-05 NA 0.3928
2. PF Q57278 Putative pyrophosphorylase ModD 5.55e-16 1.54e-10 NA 0.7437
2. PF B8D7P8 Nicotinate phosphoribosyltransferase 4.50e-08 8.66e-05 NA 0.3978
2. PF P47283 Uncharacterized protein MG037 3.42e-07 2.43e-05 NA 0.6413
2. PF B1X8N5 Nicotinate phosphoribosyltransferase 5.02e-08 3.18e-05 NA 0.4023
2. PF O25909 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.14e-10 6.48e-11 NA 0.682
2. PF B7UN17 Nicotinate phosphoribosyltransferase 5.02e-08 2.46e-05 NA 0.3966
2. PF A9MHU8 Nicotinate phosphoribosyltransferase 4.26e-08 3.40e-05 NA 0.3934
2. PF Q4UQS8 Nicotinate phosphoribosyltransferase 3.97e-08 2.34e-07 NA 0.394
2. PF B0RVE9 Nicotinate phosphoribosyltransferase 4.39e-08 1.96e-07 NA 0.3976
2. PF B6I904 Nicotinate phosphoribosyltransferase 4.85e-08 3.05e-05 NA 0.4021
2. PF P22253 Nicotinate phosphoribosyltransferase 4.21e-08 1.30e-05 NA 0.3953
2. PF A1JMP2 Nicotinate phosphoribosyltransferase 2.87e-08 1.12e-05 NA 0.4043
2. PF P9WJJ6 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 2.27e-11 1.54e-07 NA 0.747
2. PF B7N398 Nicotinate phosphoribosyltransferase 5.07e-08 4.18e-05 NA 0.3837
2. PF Q6LRA6 Nicotinate phosphoribosyltransferase 5.58e-08 1.75e-04 NA 0.405
2. PF P46714 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 8.88e-16 1.09e-10 NA 0.7717
2. PF Q1BXX4 Nicotinate phosphoribosyltransferase 5.30e-08 1.28e-06 NA 0.3785
2. PF Q8ZG93 Nicotinate phosphoribosyltransferase 3.34e-08 8.33e-05 NA 0.4223
2. PF B2TUE4 Nicotinate phosphoribosyltransferase 5.15e-08 3.61e-05 NA 0.4021
2. PF B4TRW6 Nicotinate phosphoribosyltransferase 4.34e-08 1.11e-05 NA 0.3954
2. PF B5BBM4 Nicotinate phosphoribosyltransferase 5.52e-08 1.09e-05 NA 0.3954
2. PF A0K5S6 Nicotinate phosphoribosyltransferase 5.83e-08 1.28e-06 NA 0.4022
2. PF P59245 Putative pyrophosphorylase ModD 7.77e-16 7.60e-12 NA 0.7185
2. PF B2I1P1 Nicotinate phosphoribosyltransferase 1.31e-07 2.43e-05 NA 0.4051
2. PF P39666 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 5.73e-14 7.60e-12 NA 0.6696
2. PF A8GCJ6 Nicotinate phosphoribosyltransferase 3.25e-08 4.27e-04 NA 0.416
2. PF P30012 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 4.99e-11 2.66e-07 NA 0.7085
2. PF B7MS49 Nicotinate phosphoribosyltransferase 5.07e-08 3.18e-05 NA 0.4022
2. PF A1WJL0 Nicotinate phosphoribosyltransferase 5.48e-08 2.85e-05 NA 0.4082
2. PF C0PXX2 Nicotinate phosphoribosyltransferase 4.27e-08 1.22e-05 NA 0.3954
2. PF A4JCM8 Nicotinate phosphoribosyltransferase 5.21e-08 1.83e-06 NA 0.3908
2. PF B1YVJ0 Nicotinate phosphoribosyltransferase 5.48e-08 1.09e-06 NA 0.395
2. PF Q8PGU5 Nicotinate phosphoribosyltransferase 3.55e-08 4.47e-07 NA 0.3984
2. PF Q31YR6 Nicotinate phosphoribosyltransferase 4.92e-08 3.05e-05 NA 0.3881
2. PF Q9ZJN2 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.95e-10 6.86e-12 NA 0.7074
2. PF Q57QZ3 Nicotinate phosphoribosyltransferase 5.42e-08 1.25e-05 NA 0.3952
2. PF Q6D454 Nicotinate phosphoribosyltransferase 4.36e-08 4.57e-05 NA 0.4044
2. PF Q8FJ98 Nicotinate phosphoribosyltransferase 5.22e-08 2.46e-05 NA 0.3879
2. PF B7LNU8 Nicotinate phosphoribosyltransferase 5.27e-08 1.04e-05 NA 0.3983
2. PF A9M0T9 Nicotinate phosphoribosyltransferase 6.42e-08 1.08e-06 NA 0.4268
2. PF B5YT65 Nicotinate phosphoribosyltransferase 5.03e-08 1.51e-05 NA 0.3879
2. PF Q9JYM9 Nicotinate phosphoribosyltransferase 1.27e-07 2.23e-06 NA 0.4236
2. PF Q8PSJ3 Nicotinate phosphoribosyltransferase 4.31e-06 8.41e-06 NA 0.4459
2. PF P77938 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.81e-10 3.65e-10 NA 0.6504
2. PF Q0BH38 Nicotinate phosphoribosyltransferase 5.61e-08 8.58e-07 NA 0.3914
2. PF Q3BPD5 Nicotinate phosphoribosyltransferase 3.46e-08 3.57e-07 NA 0.3839
2. PF Q8PCP3 Nicotinate phosphoribosyltransferase 3.71e-08 2.34e-07 NA 0.4171
2. PF Q128P8 Nicotinate phosphoribosyltransferase 8.41e-08 5.54e-06 NA 0.3843
2. PF B1LJT2 Nicotinate phosphoribosyltransferase 5.45e-08 3.87e-05 NA 0.4021
2. PF C0QFM5 Nicotinate phosphoribosyltransferase 1.34e-07 6.94e-03 NA 0.4409
2. PF A5F1F1 Nicotinate phosphoribosyltransferase 1.50e-07 9.90e-04 NA 0.4386
2. PF Q12Z05 Nicotinate phosphoribosyltransferase 3.63e-06 7.63e-07 NA 0.4182
2. PF B2VC92 Nicotinate phosphoribosyltransferase 4.36e-08 2.37e-04 NA 0.3918
2. PF B7NM43 Nicotinate phosphoribosyltransferase 5.29e-08 3.87e-05 NA 0.388
2. PF A7FJU4 Nicotinate phosphoribosyltransferase 3.21e-08 8.33e-05 NA 0.4148
2. PF A3MA25 Nicotinate phosphoribosyltransferase 1.11e-07 2.69e-05 NA 0.3991
2. PF A7ZYN4 Nicotinate phosphoribosyltransferase 5.06e-08 3.05e-05 NA 0.3878
2. PF C5BD56 Nicotinate phosphoribosyltransferase 4.57e-08 7.28e-05 NA 0.4097
2. PF Q83LN3 Nicotinate phosphoribosyltransferase 5.07e-08 3.05e-05 NA 0.4014
2. PF B5FQ81 Nicotinate phosphoribosyltransferase 4.18e-08 1.22e-05 NA 0.3954
2. PF Q2NU84 Nicotinate phosphoribosyltransferase 4.40e-08 9.89e-06 NA 0.4214
2. PF P58496 Putative pyrophosphorylase ModD 9.99e-16 3.56e-12 NA 0.7087
2. PF Q9JTM8 Nicotinate phosphoribosyltransferase 8.28e-08 1.15e-06 NA 0.4255
2. PF B4RL23 Nicotinate phosphoribosyltransferase 1.18e-07 5.66e-06 NA 0.4312
2. PF P74301 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 2.66e-15 1.82e-07 NA 0.6752
2. PF P75067 Uncharacterized protein MG037 homolog 3.94e-07 2.84e-09 NA 0.6628
2. PF Q3Z3I9 Nicotinate phosphoribosyltransferase 4.79e-08 3.05e-05 NA 0.3972
2. PF A9N6Y6 Nicotinate phosphoribosyltransferase 4.28e-08 1.09e-05 NA 0.3954
2. PF A7SG73 Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Fragment) 3.96e-10 2.76e-10 NA 0.6491
2. PF Q9KN67 Nicotinate phosphoribosyltransferase 1.48e-07 9.90e-04 NA 0.4386
2. PF B2U8V2 Nicotinate phosphoribosyltransferase 3.76e-08 2.81e-06 NA 0.4208
2. PF A4W8V0 Nicotinate phosphoribosyltransferase 3.78e-08 7.35e-05 NA 0.3915
2. PF A5PK51 Nicotinate phosphoribosyltransferase 2.64e-09 1.46e-02 NA 0.7297
2. PF O28439 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 7.77e-16 8.31e-11 NA 0.7926
2. PF O27860 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 3.77e-15 1.69e-11 NA 0.6962
2. PF P30819 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 7.43e-11 2.27e-09 NA 0.7232
2. PF Q66CG6 Nicotinate phosphoribosyltransferase 3.33e-08 8.33e-05 NA 0.4136
2. PF B7LE31 Nicotinate phosphoribosyltransferase 4.95e-08 3.05e-05 NA 0.3879
2. PF B5F1U0 Nicotinate phosphoribosyltransferase 4.18e-08 4.90e-06 NA 0.3954
2. PF Q7NSK2 Nicotinate phosphoribosyltransferase 6.49e-08 2.17e-06 NA 0.3831
2. PF Q52I78 Nicotinamide phosphoribosyltransferase 6.35e-13 3.02e-05 NA 0.6591
2. PF B5R8M1 Nicotinate phosphoribosyltransferase 5.37e-08 1.22e-05 NA 0.3954
2. PF Q08384 Putative pyrophosphorylase ModD 1.47e-13 2.12e-08 NA 0.7422
2. PF A8AIE5 Nicotinate phosphoribosyltransferase 4.17e-08 4.03e-06 NA 0.4028
2. PF B7MHP0 Nicotinate phosphoribosyltransferase 5.00e-08 3.18e-05 NA 0.3881
2. PF Q8XDE8 Nicotinate phosphoribosyltransferase 5.01e-08 1.51e-05 NA 0.4022
2. PF Q87JE4 Nicotinate phosphoribosyltransferase 2.64e-07 1.02e-04 NA 0.427
3. BF P9WJI6 Nicotinate phosphoribosyltransferase pncB2 0.00e+00 NA 1.36e-08 0.7733
3. BF O32090 Nicotinate phosphoribosyltransferase 0.00e+00 NA 1.29e-09 0.754
4. PB P9WJI9 Nicotinate phosphoribosyltransferase pncB1 0.00e+00 1.25e-07 6.70e-07 NA
5. P Q87VL5 Nicotinate phosphoribosyltransferase 1.27e-07 4.02e-07 NA NA
5. P B4EVC0 Nicotinate phosphoribosyltransferase 4.39e-08 1.81e-05 NA NA
5. P Q62LW1 Nicotinate phosphoribosyltransferase 4.21e-08 2.34e-07 NA NA
5. P B9JYR4 Nicotinate phosphoribosyltransferase 8.78e-06 2.75e-06 NA NA
5. P B9MHC7 Nicotinate phosphoribosyltransferase 5.40e-08 1.47e-06 NA NA
5. P A5IDN6 Isopentenyl-diphosphate delta-isomerase 2.75e-02 4.01e-02 NA NA
5. P Q0K8J9 Nicotinate phosphoribosyltransferase 3.41e-08 5.03e-07 NA NA
5. P A2RJT9 Dihydroorotate dehydrogenase A (fumarate) 4.70e-02 3.66e-02 NA NA
5. P Q11HJ2 Nicotinate phosphoribosyltransferase 7.25e-07 3.05e-06 NA NA
5. P Q32E52 Nicotinate phosphoribosyltransferase 4.86e-08 2.29e-05 NA NA
5. P B4TDS5 Nicotinate phosphoribosyltransferase 5.41e-08 1.90e-05 NA NA
5. P Q7N621 Nicotinate phosphoribosyltransferase 4.76e-08 3.50e-05 NA NA
5. P Q01335 Isopentenyl-diphosphate delta-isomerase 4.20e-02 4.17e-02 NA NA
5. P A0QBX4 Enolase 6.83e-02 4.17e-02 NA NA
5. P A9ILN1 Nicotinate phosphoribosyltransferase 1.05e-05 3.81e-07 NA NA
5. P Q48949 Methylcobamide:CoM methyltransferase MtaA 3.02e-02 3.19e-02 NA NA
5. P Q48NY1 Nicotinate phosphoribosyltransferase 1.40e-06 6.23e-07 NA NA
5. P Q8YEP2 Nicotinate phosphoribosyltransferase 1.04e-06 3.90e-08 NA NA
5. P B2S8A9 Nicotinate phosphoribosyltransferase 1.07e-06 3.52e-08 NA NA
5. P Q5V465 Methylaspartate ammonia-lyase 4.55e-02 2.47e-03 NA NA
5. P P30011 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.39e-10 8.14e-08 NA NA
5. P P18133 Nicotinate phosphoribosyltransferase 5.15e-08 3.18e-05 NA NA
5. P Q9PED1 Nicotinate phosphoribosyltransferase 4.97e-08 7.80e-07 NA NA
5. P C3LUC2 Nicotinate phosphoribosyltransferase 1.41e-07 9.90e-04 NA NA
5. P C0RGH3 Nicotinate phosphoribosyltransferase 8.94e-06 3.52e-08 NA NA
5. P B5QZD8 Nicotinate phosphoribosyltransferase 5.31e-08 1.22e-05 NA NA
5. P Q3KIW4 Nicotinate phosphoribosyltransferase 1.18e-07 6.17e-07 NA NA
5. P B1JY80 Nicotinate phosphoribosyltransferase 5.43e-08 1.14e-06 NA NA
5. P Q7W5G3 Nicotinate phosphoribosyltransferase 7.38e-08 3.18e-05 NA NA
5. P A1UUA2 Nicotinate phosphoribosyltransferase 7.96e-06 1.65e-07 NA NA
5. P Q95XX1 Nicotinate phosphoribosyltransferase 3.57e-10 1.13e-02 NA NA
5. P Q98D24 Nicotinate phosphoribosyltransferase 8.96e-06 1.13e-07 NA NA
5. P B0KKX3 Nicotinate phosphoribosyltransferase 1.85e-06 1.12e-06 NA NA
5. P P0CC06 Enolase superfamily member DDB_G0284701 4.44e-02 1.82e-04 NA NA
5. P Q87EC4 Nicotinate phosphoribosyltransferase 5.01e-08 6.51e-07 NA NA
5. P A4YK54 Nicotinate phosphoribosyltransferase 6.42e-06 6.14e-06 NA NA
5. P A6WV52 Nicotinate phosphoribosyltransferase 1.07e-06 3.25e-08 NA NA
5. P Q9HUP4 Nicotinate phosphoribosyltransferase 1 1.09e-06 1.28e-06 NA NA
5. P Q3AEU2 Methylaspartate ammonia-lyase 1 2.80e-02 2.51e-05 NA NA
5. P Q53ZE5 Dihydroorotate dehydrogenase A (fumarate) 4.69e-02 3.66e-02 NA NA
5. P P39683 Nicotinate phosphoribosyltransferase 2.75e-07 2.14e-07 NA NA
5. P Q8TMW6 Nicotinate phosphoribosyltransferase 3.82e-06 8.76e-06 NA NA
5. P P9WJJ7 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 4.10e-11 1.54e-07 NA NA
5. P Q99KQ4 Nicotinamide phosphoribosyltransferase 6.28e-13 2.18e-05 NA NA
5. P Q9ZU32 Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic 2.03e-09 1.87e-08 NA NA
5. P A5W9Q6 Nicotinate phosphoribosyltransferase 1.36e-07 1.17e-06 NA NA
5. P Q6G4R2 L-lactate dehydrogenase 5.30e-02 1.24e-02 NA NA
5. P P43619 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 8.81e-10 1.33e-13 NA NA
5. P Q2RSU7 5-methylthioribulose-1-phosphate isomerase 1.48e-02 2.99e-03 NA NA
5. P A6U5X9 Nicotinate phosphoribosyltransferase 8.47e-06 1.85e-06 NA NA
5. P Q6XQN6 Nicotinate phosphoribosyltransferase 2.28e-09 2.08e-03 NA NA
5. P B5ZWU4 Nicotinate phosphoribosyltransferase 9.93e-07 1.78e-07 NA NA
5. P B8D9E6 Nicotinate phosphoribosyltransferase 3.78e-08 8.66e-05 NA NA
5. P Q05514 Methylaspartate ammonia-lyase 2.11e-02 4.51e-03 NA NA
5. P Q5X3K0 Isopentenyl-diphosphate delta-isomerase 2.37e-02 3.94e-02 NA NA
5. P P57442 Nicotinate phosphoribosyltransferase 3.17e-08 8.66e-05 NA NA
5. P Q9HW26 Nicotinate phosphoribosyltransferase 2 8.62e-08 2.61e-06 NA NA
5. P Q3AEJ6 Methylaspartate ammonia-lyase 2 2.63e-02 4.03e-03 NA NA
5. P Q91X91 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 2.23e-10 4.09e-13 NA NA
5. P A7N4I5 Nicotinate phosphoribosyltransferase 2.80e-07 5.62e-04 NA NA
5. P Q92S49 Nicotinate phosphoribosyltransferase 8.82e-07 4.85e-06 NA NA
5. P Q15274 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.38e-10 8.70e-13 NA NA
5. P Q6G5H6 Nicotinate phosphoribosyltransferase 7.45e-06 4.24e-07 NA NA
5. P Q57916 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] 8.20e-14 3.74e-11 NA NA
5. P B0CIM5 Nicotinate phosphoribosyltransferase 8.89e-06 3.52e-08 NA NA
5. P Q7WCZ8 Nicotinate phosphoribosyltransferase 7.44e-08 2.85e-05 NA NA
5. P Q57FQ9 Nicotinate phosphoribosyltransferase 1.01e-06 3.52e-08 NA NA
5. P Q8Z7Y9 Nicotinate phosphoribosyltransferase 5.60e-08 1.07e-05 NA NA
5. P B3PXL5 Nicotinate phosphoribosyltransferase 8.79e-06 1.34e-07 NA NA
5. P Q2YNV6 Nicotinate phosphoribosyltransferase 9.18e-06 3.52e-08 NA NA
5. P Q7L5Y1 Mitochondrial enolase superfamily member 1 2.30e-02 4.56e-02 NA NA
5. P C5D7U9 2,3-diketo-5-methylthiopentyl-1-phosphate enolase 2.18e-02 4.75e-02 NA NA
5. P B9J6S5 Nicotinate phosphoribosyltransferase 8.69e-06 1.79e-06 NA NA
5. P Q8K9I6 Nicotinate phosphoribosyltransferase 3.54e-08 7.60e-06 NA NA
5. P Q8UIS9 Nicotinate phosphoribosyltransferase 8.49e-06 9.14e-07 NA NA
5. P Q967Y8 Enolase 2.42e-02 1.59e-02 NA NA
5. P A5E8V7 Nicotinate phosphoribosyltransferase 6.22e-06 4.85e-06 NA NA
5. P Q741U7 Enolase 6.99e-02 4.17e-02 NA NA
5. P Q8G340 Nicotinate phosphoribosyltransferase 8.71e-06 3.52e-08 NA NA
5. P O66145 Methylaspartate ammonia-lyase 2.40e-02 1.73e-03 NA NA
5. P Q4UNB1 Phosphate acetyltransferase 1.89e-01 1.50e-02 NA NA
5. P A9M757 Nicotinate phosphoribosyltransferase 1.01e-06 3.94e-08 NA NA
5. P C3MFW1 Nicotinate phosphoribosyltransferase 9.62e-07 4.20e-06 NA NA
5. P Q8DJ26 Isopentenyl-diphosphate delta-isomerase 5.23e-02 2.20e-02 NA NA
5. P Q75JX0 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 6.80e-10 1.89e-13 NA NA
5. P A1SVJ9 Nicotinate phosphoribosyltransferase 2.36e-07 4.06e-05 NA NA
5. P Q57651 Uncharacterized protein MJ0198 9.68e-02 4.28e-02 NA NA
5. P A9IIC5 Nicotinate phosphoribosyltransferase 5.59e-08 9.95e-07 NA NA
5. P Q80Z29 Nicotinamide phosphoribosyltransferase 6.36e-13 7.30e-06 NA NA
5. P P43490 Nicotinamide phosphoribosyltransferase 3.77e-13 9.89e-06 NA NA
5. P Q88DF7 Nicotinate phosphoribosyltransferase 1.38e-07 1.08e-06 NA NA
5. P Q8CC86 Nicotinate phosphoribosyltransferase 1.14e-09 9.60e-03 NA NA
5. P Q7VTF7 Nicotinate phosphoribosyltransferase 7.87e-08 2.56e-05 NA NA
5. P Q2KDT0 Nicotinate phosphoribosyltransferase 9.83e-07 1.82e-07 NA NA
5. P Q6G0X7 Nicotinate phosphoribosyltransferase 8.35e-06 2.33e-06 NA NA
5. P Q89SS3 Nicotinate phosphoribosyltransferase 7.41e-07 2.75e-06 NA NA
5. P Q4ZYV7 Nicotinate phosphoribosyltransferase 1.38e-06 5.31e-07 NA NA
5. P Q6XQN1 Nicotinate phosphoribosyltransferase 1.38e-09 6.05e-03 NA NA
5. P Q5I0M2 Nicotinate-nucleotide pyrophosphorylase [carboxylating] 1.91e-10 1.19e-13 NA NA
5. P A4G168 Nicotinate phosphoribosyltransferase 5.49e-08 3.95e-06 NA NA
5. P Q48927 Methylcobamide:CoM methyltransferase MtaA 2.97e-02 3.32e-02 NA NA
5. P Q68XX7 Phosphate acetyltransferase 1.34e-01 4.99e-02 NA NA
5. P Q9UTK3 Probable nicotinate phosphoribosyltransferase 8.56e-08 2.17e-06 NA NA
5. P C4ZQ57 Nicotinate phosphoribosyltransferase 4.97e-08 3.18e-05 NA NA
5. P Q1QI14 Nicotinate phosphoribosyltransferase 6.57e-06 5.13e-05 NA NA
5. P Q5RAT4 Mitochondrial enolase superfamily member 1 1.90e-02 1.99e-02 NA NA
5. P A4XS60 Nicotinate phosphoribosyltransferase 1.15e-06 5.43e-06 NA NA
5. P Q6G0J2 L-lactate dehydrogenase 5.79e-02 4.83e-02 NA NA
5. P A1W8S8 Nicotinate phosphoribosyltransferase 5.29e-08 1.47e-06 NA NA
5. P Q8ZYE7 Enolase 6.49e-02 1.09e-02 NA NA
7. B P9WJI7 Nicotinate phosphoribosyltransferase pncB2 0.00e+00 NA 1.36e-08 NA