Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54877.1
JCVISYN3A_0615

Uncharacterized protein.
M. mycoides homolog: Q6MST1.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 11
Unique PROST Go: 0
Unique BLAST Go: 1
Unique Foldseek Go: 2

Total Homologs: 291
Unique PROST Homologs: 0
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 35

Literature

Danchin and Fang [1]: tRNA binding protein|under Spx control in B. subtilis (sulfur metabolism); linked to sulfur oxidative stress; similar to a Phe tRNA ligase subunit; could be a conserved tRNA G6 methyltransferase
Yang and Tsui [2]: Phenylalanine--tRNA ligase beta subunit
Antczak et al. [3]: tRNA binding protein, possible Phe-tRNA ligase pheT
Zhang et al. [4]: GO:0004826|phenylalanine-tRNA ligase activity
Bianchi et al. [5]: tRNA binding protein

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O34943 (Putative tRNA-binding protein YtpR) with a FATCAT P-Value: 5.84e-14 and RMSD of 3.04 angstrom. The sequence alignment identity is 31.5%.
Structural alignment shown in left. Query protein AVX54877.1 colored as red in alignment, homolog O34943 colored as blue. Query protein AVX54877.1 is also shown in right top, homolog O34943 showed in right bottom. They are colored based on secondary structures.

  AVX54877.1 MNSIKFGIFYSKQ--FNSLLVSFFNKKVTSTQQI---NNITILK--NND--EIIGANIFN------VDPN--LNLKSGFCSEDPKAVNYVIQALKN-IYE 82
      O34943 MNA-----FYNKEGVGDTLLISL--QDVTR-EQLGYEKHGDVVKIFNNETKETTGFNIFNASSYLTIDENGPVALSETFV-QD---VNEILN--RNGVEE 86

  AVX54877.1 -VKQEL--QFVIGRIIEC---EPIEGTHLNICQVDIKSEILQIICGASNA--RKKVVCVVATLNSWLPNGQQIVQSKIRGVDSFGMLCSYKELNIEND-- 172
      O34943 TLVVDLSPKFVVG-YVESKEKHP-NADKLSVCKVNVGEETLQIVCGAPNVDQGQKV--VVAKVGAVMPSGLVIKDAELRGVPSSGMICSAKELDLP-DAP 181

  AVX54877.1 -QQGIIEL-GSEYNNKIGESFWKEYYAKQDQV 202
      O34943 AEKGILVLEG-DY--EAGDAF--QF------- 201

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0000049 tRNA binding
3. BF GO:0006432 phenylalanyl-tRNA aminoacylation
3. BF GO:0009328 phenylalanine-tRNA ligase complex
3. BF GO:0005829 cytosol
3. BF GO:0005524 ATP binding
3. BF GO:0005737 cytoplasm
3. BF GO:0000287 magnesium ion binding
3. BF GO:0004826 phenylalanine-tRNA ligase activity
6. F GO:0006431 methionyl-tRNA aminoacylation
6. F GO:0004825 methionine-tRNA ligase activity
7. B GO:0005886 plasma membrane

Uniprot GO Annotations

GO Description
GO:0000049 tRNA binding
GO:0016874 ligase activity
GO:0004826 phenylalanine-tRNA ligase activity
GO:0003723 RNA binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P47687 Uncharacterized protein MG449 3.95e-14 1.66e-37 4.46e-19 0.7837
1. PBF O34943 Putative tRNA-binding protein YtpR 5.84e-14 2.94e-36 1.16e-10 0.7078
1. PBF P75128 Uncharacterized protein MG449 homolog 7.32e-14 5.19e-39 3.02e-21 0.7569
3. BF P17922 Phenylalanine--tRNA ligase beta subunit 6.84e-03 NA 9.05e-11 0.8469
3. BF Q2SDJ7 Phenylalanine--tRNA ligase beta subunit 1.55e-02 NA 2.49e-09 0.7451
3. BF Q5N5G8 Phenylalanine--tRNA ligase beta subunit 1.39e-02 NA 1.33e-12 0.8992
3. BF Q5SGX1 Phenylalanine--tRNA ligase beta subunit 1.10e-02 NA 8.76e-08 0.7284
3. BF P67040 Phenylalanine--tRNA ligase beta subunit 5.16e-03 NA 2.25e-09 0.8455
3. BF Q5QXL8 Phenylalanine--tRNA ligase beta subunit 1.86e-02 NA 2.06e-14 0.9144
3. BF Q492V0 Phenylalanine--tRNA ligase beta subunit 1.09e-02 NA 2.18e-11 0.7256
3. BF Q7MXR4 Phenylalanine--tRNA ligase beta subunit 1.04e-02 NA 8.19e-13 0.6804
3. BF Q7VBX6 Phenylalanine--tRNA ligase beta subunit 1.56e-02 NA 5.21e-09 0.6906
3. BF Q31F19 Phenylalanine--tRNA ligase beta subunit 4.43e-03 NA 5.83e-09 0.911
3. BF Q9I0A4 Phenylalanine--tRNA ligase beta subunit 3.56e-03 NA 3.60e-15 0.7464
3. BF Q8AA39 Phenylalanine--tRNA ligase beta subunit 3.52e-03 NA 6.26e-12 0.6877
3. BF Q5HUR2 Phenylalanine--tRNA ligase beta subunit 1.02e-02 NA 1.34e-16 0.7223
3. BF Q7V1J8 Phenylalanine--tRNA ligase beta subunit 1.25e-02 NA 1.60e-10 0.8865
3. BF Q9AGR3 Phenylalanine--tRNA ligase beta subunit 4.93e-03 NA 2.36e-09 0.8457
3. BF Q633N5 Phenylalanine--tRNA ligase beta subunit 6.08e-03 NA 1.85e-08 0.849
3. BF Q92SS9 Phenylalanine--tRNA ligase beta subunit 8.81e-03 NA 6.32e-13 0.7148
3. BF Q3SWK8 Phenylalanine--tRNA ligase beta subunit 2.51e-02 NA 1.06e-10 0.6895
3. BF B0SAR6 Phenylalanine--tRNA ligase beta subunit 1.57e-02 NA 0.030 0.7297
3. BF Q4L5E4 Phenylalanine--tRNA ligase beta subunit 2.05e-02 NA 2.88e-09 0.6244
3. BF Q5GXY5 Phenylalanine--tRNA ligase beta subunit 1.09e-02 NA 6.36e-13 0.7307
3. BF Q3AVJ1 Phenylalanine--tRNA ligase beta subunit 1.65e-02 NA 3.41e-08 0.6743
3. BF Q7N3Q1 Phenylalanine--tRNA ligase beta subunit 1.92e-02 NA 1.07e-12 0.8836
3. BF Q2LR26 Phenylalanine--tRNA ligase beta subunit 3.21e-03 NA 2.17e-09 0.7381
3. BF P75563 Phenylalanine--tRNA ligase beta subunit 3.17e-02 NA 2.66e-04 0.646
3. BF Q92I38 Phenylalanine--tRNA ligase beta subunit 1.05e-02 NA 2.00e-16 0.7039
3. BF Q3B4Z2 Phenylalanine--tRNA ligase beta subunit 1.47e-02 NA 1.39e-12 0.6957
3. BF Q8KEF9 Phenylalanine--tRNA ligase beta subunit 9.63e-03 NA 2.11e-09 0.6687
3. BF Q5F9T6 Phenylalanine--tRNA ligase beta subunit 5.12e-03 NA 3.03e-07 0.6393
3. BF P74296 Phenylalanine--tRNA ligase beta subunit 1.37e-02 NA 1.57e-11 0.7351
3. BF Q7NBB7 Phenylalanine--tRNA ligase beta subunit 2.78e-02 NA 3.34e-06 0.6319
3. BF P0DG53 Phenylalanine--tRNA ligase beta subunit 6.18e-03 NA 4.14e-14 0.7135
3. BF Q5ZS09 Phenylalanine--tRNA ligase beta subunit 3.68e-03 NA 6.60e-14 0.7221
3. BF Q3ZZD2 Phenylalanine--tRNA ligase beta subunit 2.52e-03 NA 0.020 0.8516
3. BF Q2RYT3 Phenylalanine--tRNA ligase beta subunit 2.52e-03 NA 0.023 0.655
3. BF Q5P7Y0 Phenylalanine--tRNA ligase beta subunit 2.97e-02 NA 1.48e-15 0.8744
3. BF Q49WQ6 Phenylalanine--tRNA ligase beta subunit 5.58e-03 NA 5.89e-10 0.7002
3. BF Q5L6W7 Phenylalanine--tRNA ligase beta subunit 2.31e-03 NA 6.58e-04 0.8236
3. BF Q9JVA0 Phenylalanine--tRNA ligase beta subunit 3.99e-03 NA 3.00e-07 0.7123
3. BF Q7W7C6 Phenylalanine--tRNA ligase beta subunit 2.06e-02 NA 1.44e-14 0.9119
3. BF Q5HAU7 Phenylalanine--tRNA ligase beta subunit 3.42e-03 NA 9.38e-14 0.7261
3. BF Q74IE2 Phenylalanine--tRNA ligase beta subunit 5.40e-03 NA 1.90e-15 0.6807
3. BF Q30Y16 Phenylalanine--tRNA ligase beta subunit 2.84e-03 NA 2.76e-13 0.8925
3. BF Q3A4N8 Phenylalanine--tRNA ligase beta subunit 4.53e-03 NA 2.95e-15 0.7217
3. BF Q3MAZ7 Phenylalanine--tRNA ligase beta subunit 1.51e-02 NA 2.03e-14 0.9067
3. BF Q46KZ8 Phenylalanine--tRNA ligase beta subunit 1.39e-02 NA 3.92e-09 0.6692
3. BF Q3SK29 Phenylalanine--tRNA ligase beta subunit 2.70e-02 NA 2.35e-09 0.8803
3. BF Q5X1H8 Phenylalanine--tRNA ligase beta subunit 6.51e-03 NA 1.20e-13 0.8856
3. BF Q97S34 Phenylalanine--tRNA ligase beta subunit 6.80e-03 NA 7.70e-14 0.7093
3. BF Q7VK65 Phenylalanine--tRNA ligase beta subunit 1.31e-02 NA 1.05e-11 0.6915
3. BF Q32FI6 Phenylalanine--tRNA ligase beta subunit 1.85e-02 NA 1.21e-11 0.9102
3. BF Q38VV4 Phenylalanine--tRNA ligase beta subunit 7.78e-03 NA 2.47e-11 0.6869
3. BF Q5WEJ6 Phenylalanine--tRNA ligase beta subunit 6.15e-03 NA 1.30e-11 0.8564
3. BF Q3IIL2 Phenylalanine--tRNA ligase beta subunit 1.84e-02 NA 9.10e-12 0.914
3. BF Q8RHB5 Phenylalanine--tRNA ligase beta subunit 1.33e-02 NA 2.49e-11 0.6937
3. BF Q5LMS3 Phenylalanine--tRNA ligase beta subunit 7.28e-03 NA 3.47e-11 0.7121
3. BF Q7U6V9 Phenylalanine--tRNA ligase beta subunit 1.57e-02 NA 2.91e-10 0.6865
3. BF Q883H7 Phenylalanine--tRNA ligase beta subunit 1.63e-02 NA 1.94e-11 0.9263
3. BF Q7V7K5 Phenylalanine--tRNA ligase beta subunit 1.89e-02 NA 8.99e-11 0.6812
3. BF Q47N76 Phenylalanine--tRNA ligase beta subunit 9.74e-03 NA 8.97e-07 0.6924
3. BF P43820 Phenylalanine--tRNA ligase beta subunit 1.45e-02 NA 8.75e-10 0.8912
3. BF O88054 Phenylalanine--tRNA ligase beta subunit 2.40e-03 NA 2.31e-05 0.6896
3. BF Q5FIY7 Phenylalanine--tRNA ligase beta subunit 5.73e-03 NA 8.20e-15 0.8685
3. BF Q2NJZ2 Phenylalanine--tRNA ligase beta subunit 1.32e-02 NA 1.12e-06 0.7201
3. BF Q9ZDB4 Phenylalanine--tRNA ligase beta subunit 9.42e-03 NA 6.00e-15 0.7024
3. BF Q8DQT6 Phenylalanine--tRNA ligase beta subunit 6.27e-03 NA 2.76e-15 0.72
3. BF Q47CM9 Phenylalanine--tRNA ligase beta subunit 7.69e-03 NA 4.63e-08 0.6487
3. BF Q8XJ76 Phenylalanine--tRNA ligase beta subunit 1.17e-02 NA 1.95e-07 0.6953
3. BF Q64T65 Phenylalanine--tRNA ligase beta subunit 6.37e-03 NA 1.34e-10 0.6625
3. BF Q4UW52 Phenylalanine--tRNA ligase beta subunit 1.04e-02 NA 2.29e-12 0.8914
3. BF Q39H50 Phenylalanine--tRNA ligase beta subunit 2.79e-02 NA 6.44e-11 0.699
3. BF Q98CQ1 Phenylalanine--tRNA ligase beta subunit 1.96e-02 NA 5.79e-09 0.7283
3. BF Q9PP35 Phenylalanine--tRNA ligase beta subunit 2.77e-03 NA 2.56e-15 0.7223
3. BF Q4FQ66 Phenylalanine--tRNA ligase beta subunit 7.73e-03 NA 1.70e-09 0.8579
3. BF Q2RNH7 Phenylalanine--tRNA ligase beta subunit 1.16e-02 NA 4.76e-16 0.7319
3. BF Q3AQC6 Phenylalanine--tRNA ligase beta subunit 7.38e-03 NA 1.87e-15 0.7059
3. BF Q5NG54 Phenylalanine--tRNA ligase beta subunit 3.69e-03 NA 6.16e-12 0.8936
3. BF Q9K896 Phenylalanine--tRNA ligase beta subunit 6.19e-03 NA 5.97e-11 0.6884
3. BF Q6ANC2 Phenylalanine--tRNA ligase beta subunit 1.13e-02 NA 8.38e-15 0.9121
3. BF Q728S0 Phenylalanine--tRNA ligase beta subunit 3.66e-03 NA 3.12e-10 0.9053
3. BF Q9KSN6 Phenylalanine--tRNA ligase beta subunit 1.52e-02 NA 6.57e-15 0.8958
3. BF Q89WI2 Phenylalanine--tRNA ligase beta subunit 3.78e-03 NA 3.36e-12 0.7255
3. BF P57859 Phenylalanine--tRNA ligase beta subunit 1.51e-02 NA 1.44e-09 0.896
3. BF Q8G5E8 Phenylalanine--tRNA ligase beta subunit 1.91e-02 NA 0.008 0.6401
3. BF Q5PH85 Phenylalanine--tRNA ligase beta subunit 1.92e-02 NA 3.49e-12 0.893
3. BF Q2YX86 Phenylalanine--tRNA ligase beta subunit 5.44e-03 NA 2.67e-09 0.6984
3. BF Q5LC76 Phenylalanine--tRNA ligase beta subunit 2.95e-03 NA 1.40e-10 0.6625
3. BF Q828C6 Phenylalanine--tRNA ligase beta subunit 2.55e-03 NA 8.97e-05 0.6931
3. BF Q6GHU6 Phenylalanine--tRNA ligase beta subunit 5.08e-03 NA 2.41e-09 0.6981
3. BF Q31AV5 Phenylalanine--tRNA ligase beta subunit 1.39e-02 NA 8.57e-11 0.8057
3. BF Q87Q59 Phenylalanine--tRNA ligase beta subunit 1.61e-02 NA 5.21e-14 0.923
3. BF Q5FFS3 Phenylalanine--tRNA ligase beta subunit 6.85e-03 NA 9.20e-14 0.7317
3. BF Q9PFD6 Phenylalanine--tRNA ligase beta subunit 1.02e-02 NA 1.58e-12 0.7146
3. BF Q01SP7 Phenylalanine--tRNA ligase beta subunit 4.94e-02 NA 1.17e-04 0.6141
3. BF Q39VS4 Phenylalanine--tRNA ligase beta subunit 4.21e-03 NA 2.82e-10 0.7107
3. BF P59664 Phenylalanine--tRNA ligase beta subunit 1.88e-02 NA 1.21e-11 0.9099
3. BF Q3JBZ7 Phenylalanine--tRNA ligase beta subunit 1.75e-02 NA 4.96e-14 0.7481
3. BF Q9PJR8 Phenylalanine--tRNA ligase beta subunit 1.17e-03 NA 2.35e-06 0.6452
3. BF P56145 Phenylalanine--tRNA ligase beta subunit 2.97e-03 NA 6.81e-13 0.7149
3. BF Q8XE32 Phenylalanine--tRNA ligase beta subunit 1.93e-02 NA 1.21e-11 0.9101
3. BF P15434 Phenylalanine--tRNA ligase beta subunit 1.95e-02 NA 3.49e-12 0.8944
3. BF Q5GSH5 Phenylalanine--tRNA ligase beta subunit 1.09e-02 NA 6.21e-16 0.7387
3. BF Q3KEX7 Phenylalanine--tRNA ligase beta subunit 1.61e-02 NA 1.30e-12 0.7322
3. BF Q6G5I2 Phenylalanine--tRNA ligase beta subunit 1.55e-02 NA 8.24e-13 0.7379
3. BF P59057 Phenylalanine--tRNA ligase beta subunit 2.99e-02 NA 8.46e-14 0.9005
3. BF Q472N3 Phenylalanine--tRNA ligase beta subunit 7.04e-03 NA 9.15e-12 0.8085
3. BF Q82VV6 Phenylalanine--tRNA ligase beta subunit 8.57e-03 NA 1.65e-14 0.8736
3. BF Q2IJB3 Phenylalanine--tRNA ligase beta subunit 1.39e-02 NA 3.14e-14 0.7148
3. BF Q6GA75 Phenylalanine--tRNA ligase beta subunit 4.96e-03 NA 2.36e-09 0.6983
3. BF Q9A0I0 Phenylalanine--tRNA ligase beta subunit 5.89e-03 NA 4.14e-14 0.7157
3. BF Q8Z6I4 Phenylalanine--tRNA ligase beta subunit 1.90e-02 NA 3.49e-12 0.8931
3. BF Q5E5G5 Phenylalanine--tRNA ligase beta subunit 1.59e-02 NA 4.49e-16 0.9199
3. BF Q8YMH5 Phenylalanine--tRNA ligase beta subunit 1.50e-02 NA 8.78e-15 0.907
3. BF Q5NMC3 Phenylalanine--tRNA ligase beta subunit 3.43e-03 NA 9.99e-12 0.7249
3. BF Q8YE74 Phenylalanine--tRNA ligase beta subunit 2.49e-03 NA 7.78e-11 0.7373
3. BF Q5LZ72 Phenylalanine--tRNA ligase beta subunit 6.23e-03 NA 1.21e-11 0.7067
3. BF Q9A9E5 Phenylalanine--tRNA ligase beta subunit 1.19e-02 NA 9.81e-10 0.9079
3. BF Q817I7 Phenylalanine--tRNA ligase beta subunit 5.82e-03 NA 1.85e-08 0.8502
3. BF Q2JHU3 Phenylalanine--tRNA ligase beta subunit 1.96e-02 NA 1.25e-11 0.6926
3. BF Q6A7V6 Phenylalanine--tRNA ligase beta subunit 1.01e-02 NA 2.97e-05 0.5901
3. BF Q63TM7 Phenylalanine--tRNA ligase beta subunit 2.70e-02 NA 1.71e-11 0.6947
3. BF Q2YQV4 Phenylalanine--tRNA ligase beta subunit 7.76e-03 NA 7.35e-11 0.7337
3. BF Q891T8 Phenylalanine--tRNA ligase beta subunit 1.17e-02 NA 7.11e-09 0.7364
3. BF Q6MEA6 Phenylalanine--tRNA ligase beta subunit 4.64e-03 NA 2.98e-10 0.8656
3. BF Q6F166 Phenylalanine--tRNA ligase beta subunit 1.28e-02 NA 2.76e-07 0.6743
3. BF Q47ZS5 Phenylalanine--tRNA ligase beta subunit 2.09e-02 NA 6.28e-15 0.8284
3. BF Q5KWE5 Phenylalanine--tRNA ligase beta subunit 6.48e-03 NA 1.58e-11 0.8551
3. BF Q6NDR9 Phenylalanine--tRNA ligase beta subunit 3.58e-03 NA 2.33e-10 0.7283
3. BF Q2NT27 Phenylalanine--tRNA ligase beta subunit 1.68e-02 NA 6.38e-15 0.92
3. BF Q2YBS1 Phenylalanine--tRNA ligase beta subunit 2.88e-02 NA 2.97e-12 0.6774
3. BF Q8CSY8 Phenylalanine--tRNA ligase beta subunit 5.51e-03 NA 9.72e-10 0.6988
3. BF Q7M8Y8 Phenylalanine--tRNA ligase beta subunit 6.03e-03 NA 1.10e-12 0.7291
3. BF Q57AD9 Phenylalanine--tRNA ligase beta subunit 8.51e-03 NA 7.35e-11 0.7333
3. BF Q8Y7Q1 Phenylalanine--tRNA ligase beta subunit 5.64e-03 NA 1.03e-08 0.8585
3. BF Q8XZ24 Phenylalanine--tRNA ligase beta subunit 2.62e-02 NA 3.26e-11 0.6858
3. BF Q7NYC1 Phenylalanine--tRNA ligase beta subunit 1.56e-02 NA 1.25e-09 0.9108
3. BF P0DG52 Phenylalanine--tRNA ligase beta subunit 6.92e-03 NA 4.14e-14 0.8618
3. BF Q836J5 Phenylalanine--tRNA ligase beta subunit 9.66e-03 NA 2.34e-11 0.8242
3. BF P67041 Phenylalanine--tRNA ligase beta subunit 5.08e-03 NA 2.25e-09 0.8457
3. BF Q57PU8 Phenylalanine--tRNA ligase beta subunit 1.94e-02 NA 1.66e-11 0.8927
3. BF Q6MMJ1 Phenylalanine--tRNA ligase beta subunit 3.33e-03 NA 1.05e-09 0.7295
3. BF Q7MK40 Phenylalanine--tRNA ligase beta subunit 1.61e-02 NA 3.39e-14 0.9109
3. BF Q5YYH6 Phenylalanine--tRNA ligase beta subunit 1.28e-02 NA 0.008 0.8809
3. BF Q8EPH5 Phenylalanine--tRNA ligase beta subunit 5.28e-03 NA 5.09e-11 0.711
3. BF P27002 Phenylalanine--tRNA ligase beta subunit 8.85e-03 NA 8.76e-08 0.7285
3. BF Q97GL0 Phenylalanine--tRNA ligase beta subunit 1.41e-02 NA 1.34e-10 0.8653
3. BF Q04XL9 Phenylalanine--tRNA ligase beta subunit 1.23e-02 NA 3.36e-05 0.8914
3. BF Q60AY9 Phenylalanine--tRNA ligase beta subunit 7.66e-03 NA 1.08e-18 0.9173
3. BF Q321K5 Phenylalanine--tRNA ligase beta subunit 1.89e-02 NA 1.26e-11 0.9098
3. BF Q3AJY9 Phenylalanine--tRNA ligase beta subunit 1.52e-02 NA 3.90e-09 0.6887
3. BF P37984 Phenylalanine--tRNA ligase beta subunit 2.00e-02 NA 1.48e-11 0.8923
3. BF Q1RIS8 Phenylalanine--tRNA ligase beta subunit 1.26e-02 NA 7.15e-17 0.7038
3. BF Q6F873 Phenylalanine--tRNA ligase beta subunit 1.67e-02 NA 5.88e-10 0.7089
3. BF Q65TL3 Phenylalanine--tRNA ligase beta subunit 1.90e-02 NA 2.22e-11 0.9106
3. BF P9WFU0 Phenylalanine--tRNA ligase beta subunit 1.11e-02 NA 6.61e-08 0.7177
3. BF Q2P100 Phenylalanine--tRNA ligase beta subunit 1.08e-02 NA 6.36e-13 0.7319
3. BF Q6NHH1 Phenylalanine--tRNA ligase beta subunit 1.83e-02 NA 4.52e-05 0.8391
3. BF P57230 Phenylalanine--tRNA ligase beta subunit 7.11e-03 NA 1.74e-10 0.7352
3. BF Q48JR8 Phenylalanine--tRNA ligase beta subunit 1.64e-02 NA 1.04e-11 0.7572
3. BF Q8FXX4 Phenylalanine--tRNA ligase beta subunit 1.36e-02 NA 7.35e-11 0.7329
3. BF Q83C15 Phenylalanine--tRNA ligase beta subunit 1.42e-02 NA 2.40e-07 0.8927
3. BF Q87AB6 Phenylalanine--tRNA ligase beta subunit 9.82e-03 NA 3.45e-12 0.7217
3. BF Q3JT07 Phenylalanine--tRNA ligase beta subunit 2.64e-02 NA 1.71e-11 0.6949
3. BF Q72MG8 Phenylalanine--tRNA ligase beta subunit 1.17e-02 NA 2.13e-05 0.8932
3. BF Q30S83 Phenylalanine--tRNA ligase beta subunit 4.69e-03 NA 3.80e-20 0.7546
3. BF Q65GD3 Phenylalanine--tRNA ligase beta subunit 1.47e-02 NA 8.29e-10 0.8437
3. BF Q8E064 Phenylalanine--tRNA ligase beta subunit 6.75e-03 NA 4.03e-14 0.6924
3. BF Q2JXF6 Phenylalanine--tRNA ligase beta subunit 9.53e-03 NA 2.11e-11 0.6867
3. BF Q3ABT5 Phenylalanine--tRNA ligase beta subunit 2.83e-03 NA 0.002 0.7268
3. BF Q8CWX2 Phenylalanine--tRNA ligase beta subunit 5.58e-03 NA 2.76e-13 0.7167
3. BF Q4KEV9 Phenylalanine--tRNA ligase beta subunit 1.65e-02 NA 2.60e-12 0.7369
3. BF Q73HW5 Phenylalanine--tRNA ligase beta subunit 3.85e-03 NA 6.87e-17 0.7365
3. BF Q88K22 Phenylalanine--tRNA ligase beta subunit 1.60e-02 NA 4.89e-15 0.7499
3. BF Q8E5U1 Phenylalanine--tRNA ligase beta subunit 6.24e-03 NA 3.70e-14 0.693
3. BF Q4JW05 Phenylalanine--tRNA ligase beta subunit 1.90e-02 NA 1.05e-04 0.8043
3. BF Q6MT18 Phenylalanine--tRNA ligase beta subunit 6.68e-03 NA 5.41e-11 0.6899
3. BF Q5FUA2 Phenylalanine--tRNA ligase beta subunit 1.69e-02 NA 2.58e-10 0.7066
3. BF Q88WR2 Phenylalanine--tRNA ligase beta subunit 7.35e-03 NA 4.21e-15 0.7074
3. BF Q7WKR4 Phenylalanine--tRNA ligase beta subunit 2.04e-02 NA 9.69e-14 0.9118
3. BF Q6D4H3 Phenylalanine--tRNA ligase beta subunit 1.91e-02 NA 5.15e-12 0.9104
3. BF P74764 Phenylalanine--tRNA ligase beta subunit 1.44e-02 NA 1.33e-12 0.7355
3. BF Q8DL37 Phenylalanine--tRNA ligase beta subunit 1.89e-02 NA 2.33e-09 0.725
3. BF Q2SS99 Phenylalanine--tRNA ligase beta subunit 6.74e-03 NA 3.63e-10 0.691
3. BF Q83HH4 Phenylalanine--tRNA ligase beta subunit 7.32e-02 NA 1.09e-05 0.4781
3. BF O84481 Phenylalanine--tRNA ligase beta subunit 9.19e-04 NA 8.41e-05 0.6827
3. BF Q3Z9I7 Phenylalanine--tRNA ligase beta subunit 1.50e-03 NA 0.040 0.8512
3. BF Q9CC16 Phenylalanine--tRNA ligase beta subunit 1.31e-02 NA 1.59e-06 0.7318
3. BF Q6YPX7 Phenylalanine--tRNA ligase beta subunit 4.12e-02 NA 3.00e-08 0.7163
3. BF Q74CZ9 Phenylalanine--tRNA ligase beta subunit 5.09e-03 NA 3.16e-10 0.9127
3. BF Q68WW1 Phenylalanine--tRNA ligase beta subunit 8.30e-03 NA 3.76e-15 0.7012
3. BF Q6LQ73 Phenylalanine--tRNA ligase beta subunit 4.29e-03 NA 1.73e-15 0.9153
3. BF Q8EF99 Phenylalanine--tRNA ligase beta subunit 1.40e-02 NA 1.55e-14 0.8961
3. BF Q8DA39 Phenylalanine--tRNA ligase beta subunit 1.66e-02 NA 3.39e-14 0.9103
3. BF Q48UC5 Phenylalanine--tRNA ligase beta subunit 6.16e-03 NA 4.15e-14 0.8588
3. BF Q9CEB5 Phenylalanine--tRNA ligase beta subunit 5.69e-03 NA 5.51e-14 0.8742
3. BF Q2RHN8 Phenylalanine--tRNA ligase beta subunit 3.50e-03 NA 3.38e-09 0.857
3. BF Q8R9C7 Phenylalanine--tRNA ligase beta subunit 6.94e-03 NA 1.82e-08 0.8508
3. BF Q04VV0 Phenylalanine--tRNA ligase beta subunit 1.24e-02 NA 3.30e-05 0.892
3. BF Q83L36 Phenylalanine--tRNA ligase beta subunit 1.88e-02 NA 1.26e-11 0.9099
3. BF Q3K1I7 Phenylalanine--tRNA ligase beta subunit 6.43e-03 NA 2.76e-13 0.6915
3. BF Q72ZI2 Phenylalanine--tRNA ligase beta subunit 6.15e-03 NA 1.85e-08 0.85
3. BF Q740J0 Phenylalanine--tRNA ligase beta subunit 1.34e-02 NA 7.26e-08 0.7279
3. BF Q8NQN6 Phenylalanine--tRNA ligase beta subunit 1.80e-02 NA 1.36e-05 0.8318
3. BF Q824J8 Phenylalanine--tRNA ligase beta subunit 2.07e-03 NA 4.46e-04 0.6921
3. BF Q67QF2 Phenylalanine--tRNA ligase beta subunit 9.74e-03 NA 1.01e-08 0.7388
3. BF B0SJF2 Phenylalanine--tRNA ligase beta subunit 1.57e-02 NA 0.030 0.729
3. BF Q81L31 Phenylalanine--tRNA ligase beta subunit 5.79e-03 NA 1.85e-08 0.8567
3. BF Q83GS8 Phenylalanine--tRNA ligase beta subunit 7.34e-02 NA 1.09e-05 0.6335
3. BF Q8P1K0 Phenylalanine--tRNA ligase beta subunit 6.35e-03 NA 4.14e-14 0.7125
3. BF Q6G0Y3 Phenylalanine--tRNA ligase beta subunit 1.51e-02 NA 8.22e-12 0.7367
3. BF Q3J5M6 Phenylalanine--tRNA ligase beta subunit 1.27e-02 NA 1.44e-12 0.6975
3. BF Q3Z261 Phenylalanine--tRNA ligase beta subunit 1.84e-02 NA 1.26e-11 0.9099
3. BF Q7VVR5 Phenylalanine--tRNA ligase beta subunit 1.99e-02 NA 2.58e-14 0.9117
3. BF Q92CI6 Phenylalanine--tRNA ligase beta subunit 6.74e-03 NA 1.25e-08 0.8442
3. BF Q8EUJ9 Phenylalanine--tRNA ligase beta subunit 1.11e-02 NA 5.02e-09 0.6145
3. BF Q5M3S7 Phenylalanine--tRNA ligase beta subunit 6.04e-03 NA 1.21e-11 0.7053
3. BF Q8P7Z6 Phenylalanine--tRNA ligase beta subunit 1.04e-02 NA 2.29e-12 0.8913
3. BF Q5HGU5 Phenylalanine--tRNA ligase beta subunit 5.36e-03 NA 2.36e-09 0.6983
3. BF Q5WT87 Phenylalanine--tRNA ligase beta subunit 3.70e-03 NA 1.21e-13 0.722
3. BF Q4FNH4 Phenylalanine--tRNA ligase beta subunit 1.19e-02 NA 2.92e-19 0.7498
3. BF Q8UIN4 Phenylalanine--tRNA ligase beta subunit 8.91e-03 NA 2.32e-12 0.7034
3. BF Q8FTP0 Phenylalanine--tRNA ligase beta subunit 1.89e-02 NA 3.08e-04 0.826
3. BF Q3YRN4 Phenylalanine--tRNA ligase beta subunit 1.07e-02 NA 6.37e-17 0.7372
3. BF Q9PQ33 Phenylalanine--tRNA ligase beta subunit 9.51e-03 NA 2.21e-10 0.6867
3. BF Q5HQ35 Phenylalanine--tRNA ligase beta subunit 5.47e-03 NA 8.44e-10 0.6993
3. BF Q7VLG3 Phenylalanine--tRNA ligase beta subunit 1.74e-02 NA 5.84e-11 0.8931
3. BF Q8PJE5 Phenylalanine--tRNA ligase beta subunit 1.09e-02 NA 8.54e-13 0.7303
3. BF Q3BRU2 Phenylalanine--tRNA ligase beta subunit 1.12e-02 NA 4.64e-13 0.7306
3. BF Q62KI7 Phenylalanine--tRNA ligase beta subunit 2.71e-02 NA 1.71e-11 0.699
3. BF Q8NX60 Phenylalanine--tRNA ligase beta subunit 5.29e-03 NA 2.36e-09 0.6982
3. BF Q5XCX3 Phenylalanine--tRNA ligase beta subunit 6.78e-03 NA 4.14e-14 0.7113
3. BF Q669Z6 Phenylalanine--tRNA ligase beta subunit 1.84e-02 NA 4.34e-14 0.9103
3. BF Q9ZKF8 Phenylalanine--tRNA ligase beta subunit 2.92e-03 NA 1.04e-10 0.7179
3. BF Q7NCQ2 Phenylalanine--tRNA ligase beta subunit 1.26e-02 NA 1.00e-13 0.7247
3. BF Q720K7 Phenylalanine--tRNA ligase beta subunit 5.40e-03 NA 9.37e-09 0.8479
3. BF Q2GAI7 Phenylalanine--tRNA ligase beta subunit 1.09e-02 NA 4.74e-11 0.739
3. BF Q6HCW8 Phenylalanine--tRNA ligase beta subunit 6.08e-03 NA 1.85e-08 0.8489
3. BF Q7VEV3 Phenylalanine--tRNA ligase beta subunit 7.90e-03 NA 6.61e-08 0.7258
3. BF Q9WZS9 Phenylalanine--tRNA ligase beta subunit 9.81e-03 NA 0.005 0.6835
3. BF Q4ULS4 Phenylalanine--tRNA ligase beta subunit 1.05e-02 NA 1.26e-15 0.6999
3. BF Q2SVE3 Phenylalanine--tRNA ligase beta subunit 2.76e-02 NA 2.96e-11 0.6949
3. BF Q2VYZ1 Phenylalanine--tRNA ligase beta subunit 9.98e-03 NA 7.90e-16 0.8961
3. BF Q4QKM3 Phenylalanine--tRNA ligase beta subunit 1.39e-02 NA 4.64e-10 0.8921
3. BF Q2FHU2 Phenylalanine--tRNA ligase beta subunit 5.13e-03 NA 2.38e-09 0.6981
3. BF Q3KLM3 Phenylalanine--tRNA ligase beta subunit 7.99e-04 NA 1.35e-04 0.6723
3. BF Q4ZUG2 Phenylalanine--tRNA ligase beta subunit 1.64e-02 NA 1.04e-11 0.7533
3. BF Q9K089 Phenylalanine--tRNA ligase beta subunit 1.38e-02 NA 9.23e-05 0.7062
3. BF Q8EZ26 Phenylalanine--tRNA ligase beta subunit 1.17e-02 NA 6.79e-06 0.8945
3. BF Q5PA83 Phenylalanine--tRNA ligase beta subunit 1.07e-02 NA 5.88e-13 0.719
3. BF Q72HA0 Phenylalanine--tRNA ligase beta subunit 1.01e-02 NA 5.58e-08 0.7457
3. BF Q8ZDX1 Phenylalanine--tRNA ligase beta subunit 1.95e-02 NA 4.34e-14 0.9096
6. F Q2NI31 Methionine--tRNA ligase 5.31e-02 NA NA 0.662
6. F Q7VR66 Phenylalanine--tRNA ligase beta subunit 2.21e-02 NA NA 0.7292
6. F B5FG53 Methionine--tRNA ligase 1.12e-01 NA NA 0.5137
6. F Q3B3N3 Methionine--tRNA ligase 7.50e-02 NA NA 0.4355
6. F Q2S2A3 Methionine--tRNA ligase 9.30e-02 NA NA 0.4137
6. F Q6LSZ7 Methionine--tRNA ligase 1.04e-01 NA NA 0.4903
6. F Q4A6A2 Phenylalanine--tRNA ligase beta subunit 1.23e-02 NA NA 0.6979
6. F Q98QL4 Phenylalanine--tRNA ligase beta subunit 1.42e-02 NA NA 0.6701
6. F P59077 Methionine--tRNA ligase 6.70e-02 NA NA 0.4776
6. F A6UUN1 Methionine--tRNA ligase 6.18e-02 NA NA 0.4403
6. F A2SRE2 Methionine--tRNA ligase 7.82e-02 NA NA 0.4216
6. F Q899D9 Methionine--tRNA ligase 6.73e-02 NA NA 0.4615
6. F Q5E3Z7 Methionine--tRNA ligase 1.12e-01 NA NA 0.5136
6. F Q7MM14 Methionine--tRNA ligase 1.18e-01 NA NA 0.4985
6. F P47437 Phenylalanine--tRNA ligase beta subunit 4.39e-02 NA NA 0.5888
6. F Q5R0G6 Methionine--tRNA ligase 7.95e-02 NA NA 0.5459
6. F Q0AES9 Methionine--tRNA ligase 1.10e-01 NA NA 0.6308
6. F Q9HSA4 Methionine--tRNA ligase 6.63e-02 NA NA 0.4544
6. F B7VLW8 Methionine--tRNA ligase 1.11e-01 NA NA 0.5034
6. F O67620 Phenylalanine--tRNA ligase beta subunit 4.80e-03 NA NA 0.7298
6. F Q82WP0 Methionine--tRNA ligase 8.41e-02 NA NA 0.6775
6. F Q9Z7W0 Phenylalanine--tRNA ligase beta subunit 1.38e-03 NA NA 0.6834
6. F Q9RRX5 Phenylalanine--tRNA ligase beta subunit 2.16e-02 NA NA 0.6734
6. F A7MZT3 Methionine--tRNA ligase 1.14e-01 NA NA 0.5021
6. F Q87N07 Methionine--tRNA ligase 1.15e-01 NA NA 0.4772
6. F A5UJ98 Methionine--tRNA ligase 1.01e-01 NA NA 0.4472
6. F Q3IT47 Methionine--tRNA ligase 1.34e-01 NA NA 0.5305
6. F O26687 Methionine--tRNA ligase 8.23e-02 NA NA 0.4642
6. F O28819 Methionine--tRNA ligase 7.00e-02 NA NA 0.507
6. F P59505 Phenylalanine--tRNA ligase beta subunit 2.05e-02 NA NA 0.839
6. F B3QT85 Methionine--tRNA ligase 6.80e-02 NA NA 0.5595
6. F Q8D3B5 Phenylalanine--tRNA ligase beta subunit 1.50e-02 NA NA 0.6856
6. F Q3AQR4 Methionine--tRNA ligase 6.66e-02 NA NA 0.4844
6. F A3CX39 Methionine--tRNA ligase 6.72e-02 NA NA 0.5506
6. F Q2SKU2 Methionine--tRNA ligase 1.05e-01 NA NA 0.3941
7. B P9WFU1 Phenylalanine--tRNA ligase beta subunit 1.10e-02 NA 6.61e-08 NA
7. B P07395 Phenylalanine--tRNA ligase beta subunit 1.87e-02 NA 1.26e-11 NA