Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54890.1
JCVISYN3A_0641
ECF transporter T component.
M. mycoides homolog: Q6MSQ3.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 39
Unique PROST Go: 28
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 105
Unique PROST Homologs: 63
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A2RI03
(Energy-coupling factor transporter transmembrane protein EcfT) with a FATCAT P-Value: 0 and RMSD of 2.39 angstrom. The sequence alignment identity is 33.8%.
Structural alignment shown in left. Query protein AVX54890.1 colored as red in alignment, homolog A2RI03 colored as blue.
Query protein AVX54890.1 is also shown in right top, homolog A2RI03 showed in right bottom. They are colored based on secondary structures.
AVX54890.1 MR-ISFGRYIPKNSLIHKMDPRLKLFMIMVLIVSVFFPIG---LTGYLIISGI---IIGLFALSQLSFKMLVRLLVPV--TFIFAIIVLMNFFFIHPSSN 91 A2RI03 MQNMLMGRYIPGDSIIHRMDPRSKL-LVMIAFVVIIF-LAHDWL-GYLLL--VLYTLAGVL-LSKISVSYFLRGLRPMIGLILFTVIFQMLF------TN 88 AVX54890.1 AVGQISSWVENNPNKIF--W-TKSNGTIVGQLDVDAVSQITNSLGKEIKNLQPIGYFFNWKVFWFSEKALYSALVMGMRIYLMIT-LTCILTGSTPSLQL 187 A2RI03 --GQ---------HVIFSLWFIK-------------IS--TESL------INAV-YIF----FRF-------VLI----IF-MSTILT--LT--TP--PL 133 AVX54890.1 TLA--IEDLLSPLRLIKAPVYILSMIISIALRMIPTLIDEAGRIMKAQASRGIDIKNGKFKDKVKSLTSLIIPLLVSSFQKAEDLAYAMDARGYDPNATR 285 A2RI03 TLADGIEKGLGPLKKIKVPVHELGLMLSISLRFIPTLMDDTTMIMNAQKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAMESRGYQGGDGR 233 AVX54890.1 TRFVQFKFRIIDAIIFVLGISFAIFMMVYGSNPHGIFTNW-HISHIDSLVAY 336 A2RI03 TKYRQLKWQSRDSLL-VVSI---IIMTI-------LLILWSKVS-------- 266
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0022857 | transmembrane transporter activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 1. PBF | GO:0032217 | riboflavin transmembrane transporter activity |
| 1. PBF | GO:0032218 | riboflavin transport |
| 2. PF | GO:0031969 | chloroplast membrane |
| 2. PF | GO:0006824 | cobalt ion transport |
| 2. PF | GO:0015675 | nickel cation transport |
| 3. BF | GO:0015087 | cobalt ion transmembrane transporter activity |
| 3. BF | GO:0042626 | ATPase-coupled transmembrane transporter activity |
| 5. P | GO:0015419 | ABC-type sulfate transporter activity |
| 5. P | GO:0042918 | alkanesulfonate transport |
| 5. P | GO:0016024 | CDP-diacylglycerol biosynthetic process |
| 5. P | GO:0055085 | transmembrane transport |
| 5. P | GO:0005887 | integral component of plasma membrane |
| 5. P | GO:0010044 | response to aluminum ion |
| 5. P | GO:0015786 | UDP-glucose transmembrane transport |
| 5. P | GO:0009314 | response to radiation |
| 5. P | GO:0004605 | phosphatidate cytidylyltransferase activity |
| 5. P | GO:0015423 | ABC-type maltose transporter activity |
| 5. P | GO:0012506 | vesicle membrane |
| 5. P | GO:0051701 | biological process involved in interaction with host |
| 5. P | GO:1990060 | maltose transport complex |
| 5. P | GO:0042956 | maltodextrin transport |
| 5. P | GO:0048472 | threonine-phosphate decarboxylase activity |
| 5. P | GO:0005315 | inorganic phosphate transmembrane transporter activity |
| 5. P | GO:0031460 | glycine betaine transport |
| 5. P | GO:0006817 | phosphate ion transport |
| 5. P | GO:0006865 | amino acid transport |
| 5. P | GO:0008643 | carbohydrate transport |
| 5. P | GO:0009236 | cobalamin biosynthetic process |
| 5. P | GO:0015420 | ABC-type vitamin B12 transporter activity |
| 5. P | GO:0006879 | cellular iron ion homeostasis |
| 5. P | GO:0042170 | plastid membrane |
| 5. P | GO:0042959 | alkanesulfonate transmembrane transporter activity |
| 5. P | GO:0035435 | phosphate ion transmembrane transport |
| 5. P | GO:0005460 | UDP-glucose transmembrane transporter activity |
| 5. P | GO:0010921 | regulation of phosphatase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q50292 | Uncharacterized protein MG181 homolog | 4.78e-11 | 4.54e-24 | 1.24e-35 | 0.7315 |
| 1. PBF | Q2KBP6 | Energy-coupling factor transporter transmembrane protein BioN | 1.17e-11 | 3.10e-10 | 0.004 | 0.8054 |
| 1. PBF | P47427 | Uncharacterized protein MG181 | 1.68e-11 | 3.70e-29 | 9.88e-34 | 0.7348 |
| 1. PBF | A5N4S9 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 2.08e-27 | 3.88e-39 | 0.8674 |
| 1. PBF | Q9X2I1 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 5.57e-33 | 1.50e-33 | 0.8036 |
| 1. PBF | D3FRP0 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 6.31e-32 | 9.99e-36 | 0.8639 |
| 1. PBF | Q5M245 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 1.50e-34 | 3.71e-30 | 0.8704 |
| 1. PBF | A8YXN4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 6.58e-37 | 7.79e-34 | 0.8357 |
| 1. PBF | A2RI03 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 8.36e-31 | 1.90e-28 | 0.8881 |
| 1. PBF | Q03PY7 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 3.34e-35 | 2.27e-39 | 0.9022 |
| 1. PBF | B0TC89 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 2.20e-32 | 1.98e-27 | 0.868 |
| 1. PBF | P70972 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 3.98e-32 | 5.57e-32 | 0.8693 |
| 1. PBF | C0MBF3 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 8.35e-34 | 4.38e-29 | 0.8819 |
| 1. PBF | Q8YZH6 | Ycf92-like protein | 9.14e-12 | 1.41e-47 | 2.34e-08 | 0.7305 |
| 1. PBF | D1B5U2 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 3.80e-34 | 9.13e-29 | 0.8248 |
| 1. PBF | D6XVS2 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 4.32e-36 | 9.96e-31 | 0.8529 |
| 1. PBF | Q927P0 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 5.29e-32 | 1.62e-40 | 0.8468 |
| 1. PBF | Q03ZL4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 4.30e-35 | 3.39e-23 | 0.8381 |
| 1. PBF | C0ZIL1 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 1.40e-29 | 3.10e-33 | 0.8874 |
| 1. PBF | D8IIP4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 5.59e-37 | 1.00e-48 | 0.8671 |
| 1. PBF | D2RNY0 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 6.89e-31 | 3.74e-35 | 0.8693 |
| 1. PBF | D3ERJ1 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 8.31e-33 | 1.18e-45 | 0.8597 |
| 1. PBF | Q035B4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 1.43e-30 | 2.92e-36 | 0.8671 |
| 1. PBF | D2NWE2 | Energy-coupling factor transporter transmembrane protein EcfT 1 | 0.00e+00 | 2.33e-31 | 1.70e-32 | 0.8461 |
| 1. PBF | B9E9M1 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 6.00e-29 | 1.44e-34 | 0.8477 |
| 1. PBF | B8I813 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 1.27e-32 | 8.82e-43 | 0.8513 |
| 1. PBF | P75357 | Uncharacterized protein MG302 homolog | 3.50e-11 | 4.37e-33 | 2.24e-25 | 0.7132 |
| 1. PBF | D9RZP4 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 9.55e-35 | 2.64e-41 | 0.8729 |
| 1. PBF | O34572 | Putative HMP/thiamine permease protein YkoC | 0.00e+00 | 2.68e-32 | 6.41e-06 | 0.7417 |
| 1. PBF | B1YH82 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 1.44e-27 | 2.92e-34 | 0.897 |
| 1. PBF | P47544 | Uncharacterized protein MG302 | 0.00e+00 | 8.44e-36 | 7.98e-23 | 0.7161 |
| 1. PBF | D8MHM9 | Energy-coupling factor transporter transmembrane protein EcfT | 0.00e+00 | 7.43e-35 | 5.38e-29 | 0.8651 |
| 2. PF | D5AQY7 | Nickel transport protein NikQ | 3.33e-16 | 3.48e-23 | NA | 0.6759 |
| 2. PF | Q1XDP8 | Uncharacterized protein ycf92 | 1.19e-08 | 3.47e-34 | NA | 0.5869 |
| 2. PF | P64998 | Uncharacterized protein Mb2352c | 0.00e+00 | 3.37e-30 | NA | 0.6845 |
| 2. PF | P9WPI6 | Uncharacterized protein MT2387 | 0.00e+00 | 3.37e-30 | NA | 0.6645 |
| 2. PF | F9USS6 | Nickel permease LarQ | 1.74e-13 | 1.16e-14 | NA | 0.5585 |
| 2. PF | P51239 | Uncharacterized protein ycf92 | 1.06e-09 | 5.84e-38 | NA | 0.6039 |
| 3. BF | Q8G838 | Putative ABC transporter ATP-binding protein BL0043 | 1.56e-11 | NA | 4.32e-14 | 0.6284 |
| 3. BF | A2SSD6 | Putative fused cobalt transport protein CbiMQ | 8.10e-06 | NA | 0.036 | 0.5607 |
| 4. PB | D5ARG9 | Energy-coupling factor transporter transmembrane protein BioN | 1.87e-09 | 4.15e-13 | 4.69e-05 | NA |
| 5. P | Q7A121 | Phosphatidate cytidylyltransferase | 2.79e-03 | 3.00e-02 | NA | NA |
| 5. P | P55660 | Probable amino-acid ABC transporter permease protein y4tF | 9.98e-04 | 3.27e-02 | NA | NA |
| 5. P | Q4L5W3 | Phosphatidate cytidylyltransferase | 4.98e-03 | 3.24e-02 | NA | NA |
| 5. P | P0A627 | Phosphate transport system permease protein PstA 2 | 5.76e-03 | 1.37e-02 | NA | NA |
| 5. P | P0AGI0 | Phosphate transport system permease protein PstC | 1.33e-03 | 2.46e-04 | NA | NA |
| 5. P | Q92WD8 | sn-glycerol-3-phosphate transport system permease protein UgpA | 1.75e-03 | 4.60e-02 | NA | NA |
| 5. P | Q58420 | Probable phosphate transport system permease protein PstC | 9.08e-03 | 6.51e-04 | NA | NA |
| 5. P | Q9HLZ7 | Probable cobalamin biosynthesis protein CobD | 5.18e-03 | 7.30e-04 | NA | NA |
| 5. P | P0A631 | Phosphate transport system permease protein PstC 2 | 4.17e-03 | 3.65e-03 | NA | NA |
| 5. P | O34684 | UPF0014 membrane protein YjkA | 6.01e-04 | 5.33e-03 | NA | NA |
| 5. P | Q58966 | Uncharacterized protein MJ1571 | NA | 9.66e-20 | NA | NA |
| 5. P | P0A4N2 | Maltodextrin transport system permease protein MalC | 1.52e-03 | 1.10e-02 | NA | NA |
| 5. P | Q7A5Y4 | Phosphatidate cytidylyltransferase | 2.56e-03 | 3.00e-02 | NA | NA |
| 5. P | Q6GHH4 | Phosphatidate cytidylyltransferase | 2.47e-03 | 3.00e-02 | NA | NA |
| 5. P | Q50098 | Phosphate transport system permease protein PstC | 9.31e-03 | 1.52e-02 | NA | NA |
| 5. P | P0ABG3 | Phosphatidate cytidylyltransferase | 3.61e-03 | 8.36e-04 | NA | NA |
| 5. P | Q9PBK2 | Phosphate transport system permease protein PstC | 2.11e-03 | 1.53e-04 | NA | NA |
| 5. P | P46339 | Probable ABC transporter permease protein YqgH | 2.22e-03 | 3.23e-05 | NA | NA |
| 5. P | Q5HGH0 | Phosphatidate cytidylyltransferase | 5.44e-03 | 3.00e-02 | NA | NA |
| 5. P | Q9CNJ5 | Phosphate transport system permease protein PstC | 1.20e-03 | 3.31e-03 | NA | NA |
| 5. P | P0AGH8 | Phosphate transport system permease protein PstC | 9.51e-03 | 2.46e-04 | NA | NA |
| 5. P | P45191 | Phosphate transport system permease protein PstC | 9.58e-03 | 4.50e-03 | NA | NA |
| 5. P | Q58419 | Probable phosphate transport system permease protein PstA | 1.13e-03 | 7.15e-03 | NA | NA |
| 5. P | Q6G9V2 | Phosphatidate cytidylyltransferase | 2.38e-03 | 3.00e-02 | NA | NA |
| 5. P | Q9TJR4 | Probable sulfate transport system permease protein cysT | 2.66e-03 | 2.24e-02 | NA | NA |
| 5. P | Q9Z3R6 | Alpha-glucoside transport system permease protein AglF | 7.48e-03 | 8.95e-03 | NA | NA |
| 5. P | P0A4N1 | Maltodextrin transport system permease protein MalC | 1.49e-03 | 1.10e-02 | NA | NA |
| 5. P | P45768 | Inner membrane amino-acid ABC transporter permease protein YhdY | 2.96e-03 | 1.80e-06 | NA | NA |
| 5. P | Q99UL1 | Phosphatidate cytidylyltransferase | 2.86e-03 | 3.00e-02 | NA | NA |
| 5. P | Q97CS1 | Probable cobalamin biosynthesis protein CobD | 2.86e-03 | 7.93e-04 | NA | NA |
| 5. P | Q578M9 | Probable ABC transporter permease protein BruAb2_0483 | 6.60e-04 | 4.82e-02 | NA | NA |
| 5. P | O58968 | Probable ABC transporter permease protein PH1215 | 2.87e-03 | 2.51e-02 | NA | NA |
| 5. P | Q58763 | Molybdate/tungstate transport system permease protein WtpB | 1.00e-03 | 5.82e-03 | NA | NA |
| 5. P | Q5W7C1 | UPF0014 membrane protein STAR2 | 2.30e-03 | 1.34e-02 | NA | NA |
| 5. P | Q7CRU3 | sn-glycerol-3-phosphate transport system permease protein UgpA | 1.96e-03 | 3.36e-02 | NA | NA |
| 5. P | P9WG08 | Phosphate transport system permease protein PstA 2 | 1.94e-03 | 1.37e-02 | NA | NA |
| 5. P | O30143 | Molybdate/tungstate transport system permease protein WtpB | 1.02e-03 | 1.79e-03 | NA | NA |
| 5. P | Q85AI0 | Probable sulfate transport system permease protein cysT | 5.83e-03 | 8.20e-03 | NA | NA |
| 5. P | P44937 | Phosphatidate cytidylyltransferase | 3.85e-04 | 3.18e-02 | NA | NA |
| 5. P | P9WG04 | Phosphate transport system permease protein PstC 2 | 3.36e-03 | 3.65e-03 | NA | NA |
| 5. P | P9WPI7 | Uncharacterized protein Rv2325c | 0.00e+00 | 3.37e-30 | NA | NA |
| 5. P | Q52814 | General L-amino acid transport system permease protein AapM | 3.60e-03 | 9.89e-06 | NA | NA |
| 5. P | Q8Z8X0 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 3.34e-04 | 1.66e-02 | NA | NA |
| 5. P | Q6B8Q5 | Uncharacterized protein ycf92 | 4.54e-06 | 4.09e-13 | NA | NA |
| 5. P | Q57SD8 | Putative 2-aminoethylphosphonate transport system permease protein PhnV | 2.22e-04 | 2.35e-02 | NA | NA |
| 5. P | P0ABG1 | Phosphatidate cytidylyltransferase | 3.58e-03 | 8.36e-04 | NA | NA |
| 5. P | Q98FL3 | Phosphate transport system permease protein PstC | 4.06e-03 | 4.96e-04 | NA | NA |
| 5. P | Q9YAA0 | Probable cobalamin biosynthesis protein CobD | 1.02e-02 | 1.41e-02 | NA | NA |
| 5. P | P74369 | UPF0014 membrane protein slr1647 | 8.67e-04 | 9.37e-04 | NA | NA |
| 5. P | P0AGH9 | Phosphate transport system permease protein PstC | 1.33e-03 | 2.46e-04 | NA | NA |
| 5. P | Q05598 | Cobalt transport protein CbiQ | 1.23e-09 | 1.15e-16 | NA | NA |
| 5. P | P57223 | Putative transport protein BU123 | 1.46e-03 | 4.52e-02 | NA | NA |
| 5. P | O06990 | Maltodextrin transport system permease protein MdxF | 3.03e-03 | 3.80e-03 | NA | NA |
| 5. P | D5AUZ7 | Cobalt transport protein CbiQ | 1.40e-10 | 3.37e-31 | NA | NA |
| 5. P | Q58489 | Uncharacterized protein MJ1089 | 4.49e-11 | 3.27e-33 | NA | NA |
| 5. P | P0ABG2 | Phosphatidate cytidylyltransferase | 9.64e-04 | 8.36e-04 | NA | NA |
| 5. P | P33361 | Glycine betaine uptake system permease protein YehY | 1.86e-03 | 8.62e-04 | NA | NA |
| 5. P | P58655 | Phosphate transport system permease protein PstA | 3.03e-03 | 2.95e-02 | NA | NA |
| 5. P | Q2YL00 | Probable ABC transporter permease protein BAB2_0490 | 2.64e-04 | 4.82e-02 | NA | NA |
| 5. P | A9WGD1 | Riboflavin transport system permease protein RibX | 2.11e-03 | 4.08e-03 | NA | NA |
| 5. P | P9WG05 | Phosphate transport system permease protein PstC 2 | 1.44e-02 | 3.65e-03 | NA | NA |
| 5. P | P9WG09 | Phosphate transport system permease protein PstA 2 | 5.51e-03 | 1.37e-02 | NA | NA |
| 5. P | Q87C90 | Phosphate transport system permease protein PstC | 1.79e-03 | 1.62e-04 | NA | NA |
| 7. B | Q944H2 | Protein ABCI12, chloroplastic | 9.75e-10 | NA | 0.045 | NA |