Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54892.1
JCVISYN3A_0643
ECF transporter ATPase.
M. mycoides homolog: Q6MSQ1.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 530
Unique PROST Go: 13
Unique BLAST Go: 401
Unique Foldseek Go: 8
Total Homologs: 3937
Unique PROST Homologs: 14
Unique BLAST Homologs: 2247
Unique Foldseek Homologs: 7
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q9RKC6
(Putative ABC transporter ATP-binding protein SCO3161) with a FATCAT P-Value: 0 and RMSD of 2.65 angstrom. The sequence alignment identity is 20.9%.
Structural alignment shown in left. Query protein AVX54892.1 colored as red in alignment, homolog Q9RKC6 colored as blue.
Query protein AVX54892.1 is also shown in right top, homolog Q9RKC6 showed in right bottom. They are colored based on secondary structures.
AVX54892.1 MDNLAIFEEFNSKKISQDDLEATITSLNNYFVKLNDLNNQYINLIRQDNIDKIEKQNIRQQQKQVKAEIKKISATTKLFKQNLKLAESLYKKIKLTNNQN 100 Q9RKC6 ---------------------------------------------------------------------------------------------------- 0 AVX54892.1 DINKAKQEVEIAKSMLLQLKEVINGQGKSIKLEKLSD--IAIEINHLSFKYGPEFPNAIDDVSFTINQGEYVTIIGHNGSGKSTISKIL-I-GVLNAQHG 196 Q9RKC6 ----------------------MTGPAAA----PVPDAPASLDVSGLAFAY-PDGHQALFGVDFCVARGERVALLGPNGAGKTTL--VLHLNGILTGGTG 71 AVX54892.1 EIKIFGNIVNDHNIEQARKFLGIVFQNPDNQFIGSTVEADIAFGLENKRIDPKKMPDIILDSA-KKVGMEWALK-KEPLNLSGGQKQRVAIASTLALDPD 294 Q9RKC6 TVTVAGLPVDKRNMAEIRRRVGIVFQDPDDQLFMPTVREDVAFGPAAAGVKGAEL-EACVDRALTLVGMA-EFKDRPPHHLSFGQRRRVAVATVLAMEPE 169 AVX54892.1 IMIFDEATSMLDPKGKREIKEIMVQLRETRTKTILSITHDMDEILN-ADKVIVLDHGKLVRVAK-P-LEIVEDKDFLRNIQLDVPFVGLVREELEKKGIK 391 Q9RKC6 ILVLDEPSSNLDPASRRELADILRSL-DV---TVLMVTHDLPYALELCPRALILSDGAI--AADGPTAALLSDDDLMRAHRLELPF-GFDPRSVRASG-- 260 AVX54892.1 IASTQNIDELVEQICKK 408 Q9RKC6 ----------------- 260
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0015419 | ABC-type sulfate transporter activity |
1. PBF | GO:0048502 | ABC-type thiamine transporter activity |
1. PBF | GO:0055085 | transmembrane transport |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0042626 | ATPase-coupled transmembrane transporter activity |
1. PBF | GO:0015633 | ABC-type zinc transporter activity |
1. PBF | GO:0008509 | anion transmembrane transporter activity |
1. PBF | GO:0015424 | ABC-type amino acid transporter activity |
1. PBF | GO:0005524 | ATP binding |
1. PBF | GO:0016787 | hydrolase activity |
1. PBF | GO:0015774 | polysaccharide transport |
1. PBF | GO:0006824 | cobalt ion transport |
1. PBF | GO:0022857 | transmembrane transporter activity |
1. PBF | GO:0005315 | inorganic phosphate transmembrane transporter activity |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0089705 | protein localization to outer membrane |
1. PBF | GO:0015413 | ABC-type nickel transporter activity |
1. PBF | GO:0015599 | ATPase-coupled L-glutamine transmembrane transporter activity |
1. PBF | GO:1901238 | ABC-type tungstate transporter activity |
1. PBF | GO:0015416 | ABC-type phosphonate transporter activity |
1. PBF | GO:0015438 | ABC-type teichoic acid transporter activity |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0102025 | ABC-type thiosulfate transporter activity |
1. PBF | GO:0042959 | alkanesulfonate transmembrane transporter activity |
1. PBF | GO:0044873 | lipoprotein localization to membrane |
1. PBF | GO:0015439 | ABC-type heme transporter activity |
1. PBF | GO:0015675 | nickel cation transport |
1. PBF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
1. PBF | GO:0140306 | lipoprotein releasing activity |
1. PBF | GO:0016151 | nickel cation binding |
1. PBF | GO:0042953 | lipoprotein transport |
3. BF | GO:0015441 | ABC-type beta-glucan transporter activity |
3. BF | GO:0015087 | cobalt ion transmembrane transporter activity |
3. BF | GO:0043214 | ABC-type bacteriocin transporter activity |
3. BF | GO:0140466 | iron-sulfur cluster export from the mitochondrion |
3. BF | GO:0015440 | ABC-type peptide transporter activity |
3. BF | GO:0015721 | bile acid and bile salt transport |
3. BF | GO:0033212 | iron import into cell |
3. BF | GO:0046677 | response to antibiotic |
3. BF | GO:0015462 | ABC-type protein transporter activity |
3. BF | GO:0015612 | ABC-type L-arabinose transporter activity |
3. BF | GO:0043213 | bacteriocin transport |
3. BF | GO:1990961 | xenobiotic detoxification by transmembrane export across the plasma membrane |
3. BF | GO:0032218 | riboflavin transport |
3. BF | GO:0015562 | efflux transmembrane transporter activity |
3. BF | GO:0120189 | positive regulation of bile acid secretion |
3. BF | GO:0015414 | ABC-type nitrate transporter activity |
3. BF | GO:0010043 | response to zinc ion |
3. BF | GO:0015411 | ABC-type taurine transporter transporter activity |
3. BF | GO:1904251 | regulation of bile acid metabolic process |
3. BF | GO:0015432 | ABC-type bile acid transporter activity |
3. BF | GO:0015423 | ABC-type maltose transporter activity |
3. BF | GO:0033228 | cysteine export across plasma membrane |
3. BF | GO:0030256 | type I protein secretion system complex |
3. BF | GO:0015614 | ABC-type D-xylose transporter activity |
3. BF | GO:0046872 | metal ion binding |
3. BF | GO:0015777 | teichoic acid transport |
3. BF | GO:0015658 | branched-chain amino acid transmembrane transporter activity |
3. BF | GO:0042888 | molybdenum ion transmembrane transporter activity |
3. BF | GO:0015893 | |
3. BF | GO:0015408 | ABC-type ferric iron transporter activity |
3. BF | GO:0031460 | glycine betaine transport |
3. BF | GO:0015594 | ABC-type putrescine transporter activity |
3. BF | GO:0030253 | protein secretion by the type I secretion system |
3. BF | GO:1901557 | response to fenofibrate |
3. BF | GO:0034040 | ATPase-coupled lipid transmembrane transporter activity |
3. BF | GO:0055091 | phospholipid homeostasis |
3. BF | GO:0008559 | ABC-type xenobiotic transporter activity |
3. BF | GO:0015420 | ABC-type vitamin B12 transporter activity |
3. BF | GO:0006855 | xenobiotic transmembrane transport |
3. BF | GO:0006879 | cellular iron ion homeostasis |
3. BF | GO:0031998 | regulation of fatty acid beta-oxidation |
3. BF | GO:0015722 | canalicular bile acid transport |
3. BF | GO:0015125 | bile acid transmembrane transporter activity |
3. BF | GO:0015611 | ABC-type D-ribose transporter activity |
3. BF | GO:0046618 | xenobiotic export |
3. BF | GO:0000770 | peptide pheromone export |
3. BF | GO:0032217 | riboflavin transmembrane transporter activity |
3. BF | GO:0008206 | bile acid metabolic process |
3. BF | GO:1905887 | autoinducer AI-2 transmembrane transport |
3. BF | GO:0033232 | ABC-type D-methionine transporter activity |
3. BF | GO:0015126 | canalicular bile acid transmembrane transporter activity |
3. BF | GO:0034775 | glutathione transmembrane transport |
3. BF | GO:0015112 | nitrate transmembrane transporter activity |
3. BF | GO:0015437 | lipopolysaccharide floppase activity |
3. BF | GO:0008234 | cysteine-type peptidase activity |
3. BF | GO:0017144 | |
3. BF | GO:0015412 | ABC-type molybdate transporter activity |
3. BF | GO:0008281 | sulfonylurea receptor activity |
3. BF | GO:0046691 | intracellular canaliculus |
3. BF | GO:0042908 | xenobiotic transport |
3. BF | GO:0055072 | iron ion homeostasis |
4. PB | GO:0030420 | establishment of competence for transformation |
4. PB | GO:0015716 | organic phosphonate transport |
4. PB | GO:0055076 | transition metal ion homeostasis |
4. PB | GO:0005829 | cytosol |
4. PB | GO:0042160 | lipoprotein modification |
4. PB | GO:0035435 | phosphate ion transmembrane transport |
4. PB | GO:0005634 | nucleus |
4. PB | GO:0006817 | phosphate ion transport |
4. PB | GO:0015415 | ATPase-coupled phosphate ion transmembrane transporter activity |
4. PB | GO:0035444 | nickel cation transmembrane transport |
4. PB | GO:0015833 | peptide transport |
4. PB | GO:0017004 | cytochrome complex assembly |
4. PB | GO:0000287 | magnesium ion binding |
4. PB | GO:0006829 | zinc ion transport |
4. PB | GO:0015489 | putrescine transmembrane transporter activity |
4. PB | GO:0044874 | lipoprotein localization to outer membrane |
5. P | GO:0015234 | thiamine transmembrane transporter activity |
5. P | GO:1903810 | L-histidine import across plasma membrane |
5. P | GO:0089709 | L-histidine transmembrane transport |
5. P | GO:1990351 | transporter complex |
5. P | GO:0005291 | high-affinity L-histidine transmembrane transporter activity |
5. P | GO:1904176 | carbon phosphorus lyase complex |
5. P | GO:1990229 | iron-sulfur cluster assembly complex |
5. P | GO:0070297 | regulation of phosphorelay signal transduction system |
5. P | GO:0071934 | thiamine transmembrane transport |
5. P | GO:0008554 | P-type sodium transporter activity |
5. P | GO:0015410 | ABC-type manganese transporter activity |
5. P | GO:0015817 | histidine transport |
5. P | GO:0010921 | regulation of phosphatase activity |
6. F | GO:0016226 | iron-sulfur cluster assembly |
6. F | GO:0008233 | peptidase activity |
6. F | GO:1990281 | efflux pump complex |
6. F | GO:0015921 | lipopolysaccharide export |
6. F | GO:0030153 | bacteriocin immunity |
6. F | GO:0002049 | pyoverdine biosynthetic process |
6. F | GO:0042128 | nitrate assimilation |
6. F | GO:0006508 | proteolysis |
7. B | GO:1902995 | positive regulation of phospholipid efflux |
7. B | GO:0034188 | apolipoprotein A-I receptor activity |
7. B | GO:0010315 | auxin efflux |
7. B | GO:0006778 | porphyrin-containing compound metabolic process |
7. B | GO:0014850 | response to muscle activity |
7. B | GO:1903785 | L-valine transmembrane transport |
7. B | GO:0015031 | protein transport |
7. B | GO:0005975 | carbohydrate metabolic process |
7. B | GO:0042825 | TAP complex |
7. B | GO:0035351 | heme transmembrane transport |
7. B | GO:0030145 | manganese ion binding |
7. B | GO:0140326 | ATPase-coupled intramembrane lipid transporter activity |
7. B | GO:0097254 | renal tubular secretion |
7. B | GO:0008272 | sulfate transport |
7. B | GO:0006649 | phospholipid transfer to membrane |
7. B | GO:0031154 | culmination involved in sorocarp development |
7. B | GO:0043211 | ABC-type carbohydrate transporter activity |
7. B | GO:0090155 | negative regulation of sphingolipid biosynthetic process |
7. B | GO:1902602 | aluminum ion transmembrane transport |
7. B | GO:0015421 | ABC-type oligopeptide transporter activity |
7. B | GO:0015225 | biotin transmembrane transporter activity |
7. B | GO:0042632 | cholesterol homeostasis |
7. B | GO:0015106 | bicarbonate transmembrane transporter activity |
7. B | GO:0019829 | ATPase-coupled cation transmembrane transporter activity |
7. B | GO:0061135 | endopeptidase regulator activity |
7. B | GO:0042441 | eye pigment metabolic process |
7. B | GO:1902418 | (+)-abscisic acid D-glucopyranosyl ester transmembrane transport |
7. B | GO:0038183 | bile acid signaling pathway |
7. B | GO:0098838 | folate transmembrane transport |
7. B | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
7. B | GO:1901140 | p-coumaryl alcohol transport |
7. B | GO:0008558 | ABC-type guanine transporter activity |
7. B | GO:0000054 | ribosomal subunit export from nucleus |
7. B | GO:0032383 | regulation of intracellular cholesterol transport |
7. B | GO:0006727 | ommochrome biosynthetic process |
7. B | GO:0046581 | intercellular canaliculus |
7. B | GO:0006865 | amino acid transport |
7. B | GO:0007588 | excretion |
7. B | GO:1905601 | negative regulation of receptor-mediated endocytosis involved in cholesterol transport |
7. B | GO:0002591 | positive regulation of antigen processing and presentation of peptide antigen via MHC class I |
7. B | GO:0008514 | organic anion transmembrane transporter activity |
7. B | GO:1903413 | cellular response to bile acid |
7. B | GO:0003723 | RNA binding |
7. B | GO:0015108 | chloride transmembrane transporter activity |
7. B | GO:0043481 | anthocyanin accumulation in tissues in response to UV light |
7. B | GO:0010208 | pollen wall assembly |
7. B | GO:0015842 | aminergic neurotransmitter loading into synaptic vesicle |
7. B | GO:0006364 | rRNA processing |
7. B | GO:0006413 | translational initiation |
7. B | GO:0005319 | lipid transporter activity |
7. B | GO:0071806 | protein transmembrane transport |
7. B | GO:0070455 | positive regulation of heme biosynthetic process |
7. B | GO:0051301 | cell division |
7. B | GO:0009276 | Gram-negative-bacterium-type cell wall |
7. B | GO:0097233 | alveolar lamellar body membrane |
7. B | GO:0006412 | translation |
7. B | GO:0016853 | isomerase activity |
7. B | GO:0015865 | purine nucleotide transport |
7. B | GO:0010328 | auxin influx transmembrane transporter activity |
7. B | GO:0005730 | nucleolus |
7. B | GO:1901086 | benzylpenicillin metabolic process |
7. B | GO:0006856 | eye pigment precursor transport |
7. B | GO:0023029 | MHC class Ib protein binding |
7. B | GO:0015878 | biotin transport |
7. B | GO:0140481 | ABC-type iron-sulfur cluster transporter activity |
7. B | GO:0000325 | plant-type vacuole |
7. B | GO:0032585 | multivesicular body membrane |
7. B | GO:0015127 | bilirubin transmembrane transporter activity |
7. B | GO:0015807 | L-amino acid transport |
7. B | GO:0120202 | rod photoreceptor disc membrane |
7. B | GO:0015434 | ABC-type cadmium transporter activity |
7. B | GO:0015418 | ABC-type quaternary ammonium compound transporting activity |
7. B | GO:0000324 | fungal-type vacuole |
7. B | GO:0015625 | ABC-type ferric hydroxamate transporter activity |
7. B | GO:1905075 | positive regulation of tight junction disassembly |
7. B | GO:0034976 | response to endoplasmic reticulum stress |
7. B | GO:0070505 | pollen coat |
7. B | GO:0071714 | icosanoid transmembrane transporter activity |
7. B | GO:0048240 | sperm capacitation |
7. B | GO:1902993 | positive regulation of amyloid precursor protein catabolic process |
7. B | GO:0051539 | 4 iron, 4 sulfur cluster binding |
7. B | GO:1901076 | positive regulation of engulfment of apoptotic cell |
7. B | GO:0036020 | endolysosome membrane |
7. B | GO:0007165 | signal transduction |
7. B | GO:0046968 | peptide antigen transport |
7. B | GO:0042986 | positive regulation of amyloid precursor protein biosynthetic process |
7. B | GO:0015918 | sterol transport |
7. B | GO:0001573 | ganglioside metabolic process |
7. B | GO:0006687 | glycosphingolipid metabolic process |
7. B | GO:1901656 | glycoside transport |
7. B | GO:0034041 | ABC-type sterol transporter activity |
7. B | GO:0080168 | abscisic acid transport |
7. B | GO:0015436 | ABC-type capsular-polysaccharide transporter activity |
7. B | GO:0042882 | L-arabinose transmembrane transport |
7. B | GO:0003677 | DNA binding |
7. B | GO:1900721 | positive regulation of uterine smooth muscle relaxation |
7. B | GO:0042824 | MHC class I peptide loading complex |
7. B | GO:0008282 | inward rectifying potassium channel |
7. B | GO:0097708 | intracellular vesicle |
7. B | GO:0033700 | phospholipid efflux |
7. B | GO:2000008 | regulation of protein localization to cell surface |
7. B | GO:0031901 | early endosome membrane |
7. B | GO:0009380 | excinuclease repair complex |
7. B | GO:1905039 | carboxylic acid transmembrane transport |
7. B | GO:0005774 | vacuolar membrane |
7. B | GO:0034707 | chloride channel complex |
7. B | GO:0046967 | cytosol to endoplasmic reticulum transport |
7. B | GO:0046865 | terpenoid transport |
7. B | GO:0016887 | ATP hydrolysis activity |
7. B | GO:0005503 | all-trans retinal binding |
7. B | GO:0042887 | amide transmembrane transporter activity |
7. B | GO:0005576 | extracellular region |
7. B | GO:0075139 | response to host iron concentration |
7. B | GO:1903805 | L-valine import across plasma membrane |
7. B | GO:0071072 | negative regulation of phospholipid biosynthetic process |
7. B | GO:0033762 | response to glucagon |
7. B | GO:0033013 | tetrapyrrole metabolic process |
7. B | GO:0098849 | cellular detoxification of cadmium ion |
7. B | GO:0070633 | transepithelial transport |
7. B | GO:0098662 | inorganic cation transmembrane transport |
7. B | GO:0030301 | cholesterol transport |
7. B | GO:0043215 | daunorubicin transport |
7. B | GO:0010874 | regulation of cholesterol efflux |
7. B | GO:0046943 | carboxylic acid transmembrane transporter activity |
7. B | GO:0005260 | intracellularly ATP-gated chloride channel activity |
7. B | GO:2001225 | regulation of chloride transport |
7. B | GO:0042883 | cysteine transport |
7. B | GO:0045332 | phospholipid translocation |
7. B | GO:0030505 | inorganic diphosphate transport |
7. B | GO:0035672 | oligopeptide transmembrane transport |
7. B | GO:0019885 | antigen processing and presentation of endogenous peptide antigen via MHC class I |
7. B | GO:0015232 | heme transmembrane transporter activity |
7. B | GO:0006932 | substrate-dependent cell migration, cell contraction |
7. B | GO:0150110 | negative regulation of cholesterol esterification |
7. B | GO:0090374 | oligopeptide export from mitochondrion |
7. B | GO:0042884 | microcin transport |
7. B | GO:1903825 | organic acid transmembrane transport |
7. B | GO:0046978 | TAP1 binding |
7. B | GO:0015803 | branched-chain amino acid transport |
7. B | GO:0015910 | long-chain fatty acid import into peroxisome |
7. B | GO:0005654 | nucleoplasm |
7. B | GO:0062157 | mitochondrial ATP-gated potassium channel complex |
7. B | GO:0090555 | phosphatidylethanolamine flippase activity |
7. B | GO:0044604 | ABC-type phytochelatin transporter activity |
7. B | GO:0015723 | bilirubin transport |
7. B | GO:0060049 | regulation of protein glycosylation |
7. B | GO:0046980 | tapasin binding |
7. B | GO:0001407 | glycerophosphodiester transmembrane transport |
7. B | GO:1900753 | doxorubicin transport |
7. B | GO:0140603 | obsolete ATP hydrolysis activity |
7. B | GO:0090156 | cellular sphingolipid homeostasis |
7. B | GO:0071805 | potassium ion transmembrane transport |
7. B | GO:0015431 | ABC-type glutathione S-conjugate transporter activity |
7. B | GO:0030165 | PDZ domain binding |
7. B | GO:0009624 | response to nematode |
7. B | GO:0042168 | heme metabolic process |
7. B | GO:0015752 | D-ribose transmembrane transport |
7. B | GO:0008270 | zinc ion binding |
7. B | GO:0006289 | nucleotide-excision repair |
7. B | GO:0097232 | lamellar body membrane |
7. B | GO:0044857 | plasma membrane raft organization |
7. B | GO:0034436 | glycoprotein transport |
7. B | GO:0060919 | auxin influx |
7. B | GO:0090108 | positive regulation of high-density lipoprotein particle assembly |
7. B | GO:0033344 | cholesterol efflux |
7. B | GO:0023061 | signal release |
7. B | GO:0005501 | retinoid binding |
7. B | GO:0140394 | ABC-type azole transporter activity |
7. B | GO:0015694 | mercury ion transport |
7. B | GO:0032384 | negative regulation of intracellular cholesterol transport |
7. B | GO:0008494 | translation activator activity |
7. B | GO:0005324 | long-chain fatty acid transporter activity |
7. B | GO:0106138 | Sec61 translocon complex binding |
7. B | GO:0005304 | L-valine transmembrane transporter activity |
7. B | GO:0015132 | prostaglandin transmembrane transporter activity |
7. B | GO:0031152 | aggregation involved in sorocarp development |
7. B | GO:0015216 | purine nucleotide transmembrane transporter activity |
7. B | GO:0060081 | membrane hyperpolarization |
7. B | GO:0042401 | cellular biogenic amine biosynthetic process |
7. B | GO:0002485 | antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent |
7. B | GO:1905948 | ABC-type 3',5'-cyclic GMP transmembrane transporter activity |
7. B | GO:1904486 | response to 17alpha-ethynylestradiol |
7. B | GO:1905604 | negative regulation of blood-brain barrier permeability |
7. B | GO:0046623 | sphingolipid floppase activity |
7. B | GO:0140345 | phosphatidylcholine flippase activity |
7. B | GO:0030299 | intestinal cholesterol absorption |
7. B | GO:0140327 | flippase activity |
7. B | GO:0044847 | iron acquisition from host |
7. B | GO:0031409 | pigment binding |
7. B | GO:0150172 | regulation of phosphatidylcholine metabolic process |
7. B | GO:0042493 | |
7. B | GO:0002790 | peptide secretion |
7. B | GO:0016020 | membrane |
7. B | GO:0009235 | cobalamin metabolic process |
7. B | GO:0015794 | glycerol-3-phosphate transmembrane transport |
7. B | GO:0042910 | xenobiotic transmembrane transporter activity |
7. B | GO:1902476 | chloride transmembrane transport |
7. B | GO:0033231 | carbohydrate export |
7. B | GO:0015886 | heme transport |
7. B | GO:0070730 | cAMP transport |
7. B | GO:0150104 | transport across blood-brain barrier |
7. B | GO:0034375 | high-density lipoprotein particle remodeling |
7. B | GO:0010329 | auxin efflux transmembrane transporter activity |
7. B | GO:1901873 | regulation of post-translational protein modification |
7. B | GO:0070925 | organelle assembly |
7. B | GO:0015607 | ABC-type fatty-acyl-CoA transporter activity |
7. B | GO:0015430 | ABC-type glycerol-3-phosphate transporter activity |
7. B | GO:0043024 | ribosomal small subunit binding |
7. B | GO:1903064 | positive regulation of reverse cholesterol transport |
7. B | GO:0042270 | protection from natural killer cell mediated cytotoxicity |
7. B | GO:0005254 | chloride channel activity |
7. B | GO:0010222 | stem vascular tissue pattern formation |
7. B | GO:0016324 | apical plasma membrane |
7. B | GO:0031004 | potassium ion-transporting ATPase complex |
7. B | GO:0070894 | regulation of transposon integration |
7. B | GO:0019869 | chloride channel inhibitor activity |
7. B | GO:0097234 | epidermal lamellar body membrane |
7. B | GO:0048770 | pigment granule |
7. B | GO:0014045 | establishment of endothelial blood-brain barrier |
7. B | GO:0071403 | cellular response to high density lipoprotein particle stimulus |
7. B | GO:0032367 | intracellular cholesterol transport |
7. B | GO:0055088 | lipid homeostasis |
7. B | GO:0071716 | leukotriene transport |
7. B | GO:0046471 | phosphatidylglycerol metabolic process |
7. B | GO:0005615 | extracellular space |
7. B | GO:0042288 | MHC class I protein binding |
7. B | GO:0043225 | ATPase-coupled inorganic anion transmembrane transporter activity |
7. B | GO:0033285 | ATPase-coupled monocarboxylic acid transmembrane transporter activity |
7. B | GO:1990962 | xenobiotic transport across blood-brain barrier |
7. B | GO:0006633 | fatty acid biosynthetic process |
7. B | GO:0010217 | cellular aluminum ion homeostasis |
7. B | GO:0042941 | D-alanine transport |
7. B | GO:0048545 | response to steroid hormone |
7. B | GO:0003336 | corneocyte desquamation |
7. B | GO:0010588 | cotyledon vascular tissue pattern formation |
7. B | GO:0035377 | transepithelial water transport |
7. B | GO:0032940 | secretion by cell |
7. B | GO:0009381 | excinuclease ABC activity |
7. B | GO:1904446 | positive regulation of establishment of Sertoli cell barrier |
7. B | GO:1903898 | negative regulation of PERK-mediated unfolded protein response |
7. B | GO:0043691 | reverse cholesterol transport |
7. B | GO:1902161 | positive regulation of cyclic nucleotide-gated ion channel activity |
7. B | GO:0103116 | ABC-type D-galactofuranose transporter |
7. B | GO:0042599 | lamellar body |
7. B | GO:0036246 | phytochelatin 2 import into vacuole |
7. B | GO:0097327 | response to antineoplastic agent |
7. B | GO:0015164 | glucuronoside transmembrane transporter activity |
7. B | GO:0016323 | basolateral plasma membrane |
7. B | GO:0007049 | cell cycle |
7. B | GO:0010872 | regulation of cholesterol esterification |
7. B | GO:0036249 | cadmium ion import into vacuole |
7. B | GO:0006695 | cholesterol biosynthetic process |
7. B | GO:0002489 | antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent |
7. B | GO:0019534 | toxin transmembrane transporter activity |
7. B | GO:0085042 | periarbuscular membrane |
7. B | GO:0035690 | |
7. B | GO:0099039 | sphingolipid translocation |
7. B | GO:1990060 | maltose transport complex |
7. B | GO:0005765 | lysosomal membrane |
7. B | GO:0031459 | ABC-type glycine betaine transporter activity |
7. B | GO:0010290 | chlorophyll catabolite transmembrane transporter activity |
7. B | GO:0015188 | L-isoleucine transmembrane transporter activity |
7. B | GO:1901529 | positive regulation of anion channel activity |
7. B | GO:0008643 | carbohydrate transport |
7. B | GO:0010496 | intercellular transport |
7. B | GO:1903232 | melanosome assembly |
7. B | GO:0120188 | regulation of bile acid secretion |
7. B | GO:0010875 | positive regulation of cholesterol efflux |
7. B | GO:1903806 | L-isoleucine import across plasma membrane |
7. B | GO:1905460 | negative regulation of vascular associated smooth muscle cell apoptotic process |
7. B | GO:0071995 | phytochelatin import into vacuole |
7. B | GO:0097744 | renal urate salt excretion |
7. B | GO:0032368 | regulation of lipid transport |
7. B | GO:0009610 | response to symbiotic fungus |
7. B | GO:0098713 | leucine import across plasma membrane |
7. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
7. B | GO:0009507 | chloroplast |
7. B | GO:0042985 | negative regulation of amyloid precursor protein biosynthetic process |
7. B | GO:0050891 | multicellular organismal water homeostasis |
7. B | GO:0046890 | regulation of lipid biosynthetic process |
7. B | GO:0055038 | recycling endosome membrane |
7. B | GO:0080051 | cutin transport |
7. B | GO:1904680 | peptide transmembrane transporter activity |
7. B | GO:0080172 | petal epidermis patterning |
7. B | GO:0098591 | external side of apical plasma membrane |
7. B | GO:0006686 | sphingomyelin biosynthetic process |
7. B | GO:0005275 | amine transmembrane transporter activity |
7. B | GO:0099040 | ceramide translocation |
7. B | GO:0070731 | cGMP transport |
7. B | GO:0140357 | heme export from vacuole to cytoplasm |
7. B | GO:0045900 | negative regulation of translational elongation |
7. B | GO:0097208 | alveolar lamellar body |
7. B | GO:0015143 | urate transmembrane transporter activity |
7. B | GO:0090370 | negative regulation of cholesterol efflux |
7. B | GO:0002479 | antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent |
7. B | GO:0019843 | rRNA binding |
7. B | GO:0033162 | melanosome membrane |
7. B | GO:0090556 | phosphatidylserine floppase activity |
7. B | GO:0030504 | inorganic diphosphate transmembrane transporter activity |
7. B | GO:0010540 | basipetal auxin transport |
7. B | GO:0120020 | cholesterol transfer activity |
7. B | GO:0048225 | suberin network |
7. B | GO:0015847 | putrescine transport |
7. B | GO:1904411 | positive regulation of secretory granule organization |
7. B | GO:0001409 | guanine nucleotide transmembrane transporter activity |
7. B | GO:0003924 | GTPase activity |
7. B | GO:0043231 | intracellular membrane-bounded organelle |
7. B | GO:0010949 | negative regulation of intestinal phytosterol absorption |
7. B | GO:0061843 | Sertoli cell barrier remodeling |
7. B | GO:0032376 | positive regulation of cholesterol transport |
7. B | GO:1903714 | isoleucine transmembrane transport |
7. B | GO:0042802 | identical protein binding |
7. B | GO:0006869 | lipid transport |
7. B | GO:0005506 | iron ion binding |
7. B | GO:0034634 | glutathione transmembrane transporter activity |
7. B | GO:0048581 | negative regulation of post-embryonic development |
7. B | GO:0015711 | organic anion transport |
7. B | GO:0032464 | positive regulation of protein homooligomerization |
7. B | GO:0140328 | floppase activity |
7. B | GO:0061092 | positive regulation of phospholipid translocation |
7. B | GO:0061855 | negative regulation of neuroblast migration |
7. B | GO:0032782 | bile acid secretion |
7. B | GO:2001140 | positive regulation of phospholipid transport |
7. B | GO:2000077 | negative regulation of type B pancreatic cell development |
7. B | GO:0005887 | integral component of plasma membrane |
7. B | GO:0006684 | sphingomyelin metabolic process |
7. B | GO:0090539 | peptide pheromone export by transmembrane transport |
7. B | GO:0006448 | regulation of translational elongation |
7. B | GO:0099038 | ceramide floppase activity |
7. B | GO:0010312 | detoxification of zinc ion |
7. B | GO:0046906 | tetrapyrrole binding |
7. B | GO:0015433 | ABC-type peptide antigen transporter activity |
7. B | GO:0038027 | apolipoprotein A-I-mediated signaling pathway |
7. B | GO:0006904 | vesicle docking involved in exocytosis |
7. B | GO:0000049 | tRNA binding |
7. B | GO:0071320 | cellular response to cAMP |
7. B | GO:0006638 | neutral lipid metabolic process |
7. B | GO:1902943 | positive regulation of voltage-gated chloride channel activity |
7. B | GO:0032310 | prostaglandin secretion |
7. B | GO:0061337 | cardiac conduction |
7. B | GO:0032289 | central nervous system myelin formation |
7. B | GO:0051454 | intracellular pH elevation |
7. B | GO:1903331 | positive regulation of iron-sulfur cluster assembly |
7. B | GO:0005525 | GTP binding |
7. B | GO:0006281 | DNA repair |
7. B | GO:0090554 | phosphatidylcholine floppase activity |
7. B | GO:0150094 | amyloid-beta clearance by cellular catabolic process |
7. B | GO:0140359 | ABC-type transporter activity |
7. B | GO:1904322 | cellular response to forskolin |
7. B | GO:1902417 | (+)-abscisic acid D-glucopyranosyl ester transmembrane transporter activity |
7. B | GO:0097209 | epidermal lamellar body |
7. B | GO:0140341 | phosphatidylethanolamine floppase activity |
7. B | GO:1902497 | iron-sulfur cluster transmembrane transport |
7. B | GO:0009245 | lipid A biosynthetic process |
7. B | GO:0015808 | L-alanine transport |
7. B | GO:0043129 | surfactant homeostasis |
7. B | GO:0032805 | positive regulation of low-density lipoprotein particle receptor catabolic process |
7. B | GO:0071996 | glutathione transmembrane import into vacuole |
7. B | GO:0006357 | regulation of transcription by RNA polymerase II |
7. B | GO:0090740 | integral component of pigment granule membrane |
7. B | GO:1904375 | regulation of protein localization to cell periphery |
7. B | GO:0031288 | sorocarp morphogenesis |
7. B | GO:1902004 | positive regulation of amyloid-beta formation |
7. B | GO:0045796 | negative regulation of intestinal cholesterol absorption |
7. B | GO:2000010 | positive regulation of protein localization to cell surface |
7. B | GO:0000329 | fungal-type vacuole membrane |
7. B | GO:0140352 | export from cell |
7. B | GO:0140115 | export across plasma membrane |
7. B | GO:0034380 | high-density lipoprotein particle assembly |
7. B | GO:1990748 | cellular detoxification |
7. B | GO:0005769 | early endosome |
7. B | GO:0007031 | peroxisome organization |
7. B | GO:0015732 | prostaglandin transport |
7. B | GO:0015701 | bicarbonate transport |
7. B | GO:0032379 | positive regulation of intracellular lipid transport |
7. B | GO:0002481 | antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent |
7. B | GO:0055052 | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
7. B | GO:0015747 | urate transport |
7. B | GO:0120019 | phosphatidylcholine transfer activity |
7. B | GO:0015192 | L-phenylalanine transmembrane transporter activity |
7. B | GO:0015823 | phenylalanine transport |
7. B | GO:0031088 | platelet dense granule membrane |
7. B | GO:0010345 | suberin biosynthetic process |
7. B | GO:0015190 | L-leucine transmembrane transporter activity |
7. B | GO:0035627 | ceramide transport |
7. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
7. B | GO:0005840 | ribosome |
7. B | GO:0042605 | peptide antigen binding |
7. B | GO:0015426 | ATPase-coupled polar amino acid-transporter activity |
7. B | GO:0140347 | N-retinylidene-phosphatidylethanolamine flippase activity |
7. B | GO:0042760 | very long-chain fatty acid catabolic process |
7. B | GO:0015417 | ABC-type polyamine transporter activity |
7. B | GO:1902991 | regulation of amyloid precursor protein catabolic process |
7. B | GO:0046979 | TAP2 binding |
7. B | GO:0030644 | cellular chloride ion homeostasis |
7. B | GO:0045921 | positive regulation of exocytosis |
7. B | GO:0005548 | phospholipid transporter activity |
7. B | GO:1905598 | negative regulation of low-density lipoprotein receptor activity |
7. B | GO:0020037 | heme binding |
7. B | GO:0015689 | molybdate ion transport |
7. B | GO:0031427 | response to methotrexate |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0055085 | transmembrane transport |
GO:0005886 | plasma membrane |
GO:0016020 | membrane |
GO:0005524 | ATP binding |
GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | Q65SC9 | Thiamine import ATP-binding protein ThiQ | 7.51e-14 | 3.18e-03 | 3.83e-24 | 0.8192 |
1. PBF | Q8G195 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.18e-03 | 2.90e-09 | 0.8959 |
1. PBF | Q2GJA5 | Zinc import ATP-binding protein ZnuC | 4.41e-14 | 5.36e-07 | 2.04e-13 | 0.7903 |
1. PBF | P45073 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 4.23e-02 | 1.03e-14 | 0.8889 |
1. PBF | D4GSY7 | Probable anion import ATP-binding protein HVO_1886 | 1.83e-14 | 6.13e-10 | 3.93e-20 | 0.8098 |
1. PBF | Q93KD4 | Tungstate uptake system ATP-binding protein TupC | 0.00e+00 | 5.43e-06 | 2.97e-20 | 0.8905 |
1. PBF | Q64Z80 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.79e-03 | 2.97e-13 | 0.9131 |
1. PBF | Q8X4L6 | Nickel import ATP-binding protein NikE | 3.55e-15 | 9.92e-03 | 1.91e-19 | 0.8304 |
1. PBF | Q73GK9 | Zinc import ATP-binding protein ZnuC | 3.40e-10 | 9.41e-07 | 6.63e-16 | 0.797 |
1. PBF | Q8YUI9 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | 3.48e-02 | 8.91e-23 | 0.8865 |
1. PBF | Q1RK34 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.21e-02 | 4.74e-19 | 0.8965 |
1. PBF | Q99S47 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.42e-02 | 2.16e-65 | 0.9295 |
1. PBF | Q8XHV2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.02e-02 | 1.79e-61 | 0.9264 |
1. PBF | Q8NVB5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.19e-02 | 5.76e-66 | 0.9303 |
1. PBF | P0AAG4 | Glutamate/aspartate import ATP-binding protein GltL | 0.00e+00 | 2.00e-02 | 1.35e-23 | 0.894 |
1. PBF | P94411 | Uncharacterized ABC transporter ATP-binding protein YclH | 6.66e-16 | 1.48e-04 | 9.96e-16 | 0.8923 |
1. PBF | Q2FJ01 | Teichoic acids export ATP-binding protein TagH | 2.50e-10 | 5.13e-03 | 3.20e-08 | 0.6713 |
1. PBF | Q0TJC1 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.20e-11 | 6.20e-03 | 3.30e-17 | 0.7691 |
1. PBF | Q5FHB0 | Zinc import ATP-binding protein ZnuC | 1.36e-13 | 1.36e-06 | 4.10e-19 | 0.7939 |
1. PBF | Q48479 | O-antigen export system ATP-binding protein RfbB | 5.46e-13 | 1.06e-02 | 1.39e-09 | 0.7052 |
1. PBF | Q82HA2 | Putative ABC transporter ATP-binding protein SAV_3608 | 0.00e+00 | 2.31e-07 | 1.58e-38 | 0.8684 |
1. PBF | Q3YSY7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.75e-03 | 4.84e-08 | 0.908 |
1. PBF | Q9A6Z7 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 0.00e+00 | 1.02e-03 | 8.46e-09 | 0.8949 |
1. PBF | Q8RQL7 | Glutamate transport ATP-binding protein GluA | 0.00e+00 | 4.31e-02 | 5.72e-26 | 0.8836 |
1. PBF | Q9CNP9 | Thiamine import ATP-binding protein ThiQ | 4.22e-15 | 1.10e-02 | 1.10e-23 | 0.8514 |
1. PBF | Q2YYM4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.73e-02 | 6.91e-66 | 0.9285 |
1. PBF | Q6MSQ1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 7.49e-111 | 0.0 | 0.9568 |
1. PBF | Q6F1W4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.11e-16 | 2.20e-07 | 3.57e-39 | 0.8408 |
1. PBF | Q0S6U9 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.22e-12 | 1.73e-02 | 1.90e-16 | 0.76 |
1. PBF | Q5HBR8 | Zinc import ATP-binding protein ZnuC | 3.13e-14 | 1.36e-06 | 4.10e-19 | 0.7922 |
1. PBF | Q2YNH6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.18e-03 | 2.90e-09 | 0.8972 |
1. PBF | Q1QCN2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.75e-03 | 9.11e-19 | 0.8692 |
1. PBF | Q52815 | General L-amino acid transport ATP-binding protein AapP | 0.00e+00 | 1.20e-05 | 3.59e-29 | 0.8642 |
1. PBF | Q0T8D1 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 7.63e-03 | 1.92e-20 | 0.8766 |
1. PBF | Q7A470 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.42e-02 | 2.16e-65 | 0.9295 |
1. PBF | Q57DS9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.18e-03 | 2.90e-09 | 0.8962 |
1. PBF | P0AAI2 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.47e-11 | 2.17e-02 | 2.77e-16 | 0.7981 |
1. PBF | Q6GEL3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.21e-02 | 7.84e-65 | 0.9292 |
1. PBF | Q2JPW6 | Phosphonates import ATP-binding protein PhnC 1 | 5.44e-15 | 2.51e-02 | 3.06e-09 | 0.7811 |
1. PBF | Q2SVN0 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.36e-09 | 1.05e-06 | 5.21e-15 | 0.7073 |
1. PBF | Q6GJ33 | Teichoic acids export ATP-binding protein TagH | 2.70e-10 | 6.69e-03 | 3.48e-08 | 0.6786 |
1. PBF | Q2YLW6 | Thiamine import ATP-binding protein ThiQ | 8.88e-16 | 1.04e-03 | 5.28e-21 | 0.8488 |
1. PBF | P48334 | Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region | 2.44e-15 | 2.06e-02 | 5.79e-11 | 0.8146 |
1. PBF | Q3Z3I7 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.76e-11 | 2.09e-02 | 3.84e-16 | 0.788 |
1. PBF | O34756 | Putative ABC transporter ATP-binding protein YjkB | 1.11e-16 | 2.67e-05 | 3.31e-21 | 0.827 |
1. PBF | P0DJA1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.47e-03 | 1.18e-13 | 0.8911 |
1. PBF | P54537 | Arginine transport ATP-binding protein ArtM | 0.00e+00 | 1.17e-03 | 5.34e-28 | 0.8951 |
1. PBF | Q7N8V0 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 8.87e-03 | 5.50e-20 | 0.858 |
1. PBF | Q8NXS6 | Teichoic acids export ATP-binding protein TagH | 2.38e-10 | 5.13e-03 | 3.20e-08 | 0.6806 |
1. PBF | P72297 | Octopine permease ATP-binding protein P | 0.00e+00 | 9.47e-03 | 3.19e-18 | 0.822 |
1. PBF | Q6GBJ3 | Teichoic acids export ATP-binding protein TagH | 2.53e-10 | 5.13e-03 | 3.20e-08 | 0.6667 |
1. PBF | Q2Y624 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.30e-03 | 2.47e-16 | 0.8828 |
1. PBF | Q66D26 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.38e-04 | 6.29e-15 | 0.794 |
1. PBF | Q7UX73 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | 1.08e-03 | 1.18e-12 | 0.8655 |
1. PBF | Q5PDF8 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.15e-02 | 1.95e-20 | 0.8765 |
1. PBF | Q57BC2 | Thiamine import ATP-binding protein ThiQ | 7.77e-16 | 1.04e-03 | 5.28e-21 | 0.8607 |
1. PBF | Q2YQP3 | Putative ABC transporter ATP-binding protein BAB1_1388 | 9.99e-16 | 6.44e-04 | 1.58e-21 | 0.8922 |
1. PBF | P0A9S0 | Cell division ATP-binding protein FtsE | 0.00e+00 | 3.78e-03 | 5.73e-13 | 0.9142 |
1. PBF | Q9PPV1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 5.76e-04 | 2.82e-98 | 0.9585 |
1. PBF | Q92L31 | Thiamine import ATP-binding protein ThiQ | 2.22e-16 | 1.55e-02 | 2.79e-21 | 0.8801 |
1. PBF | O28437 | Putative ABC transporter ATP-binding protein AF_1841 | 0.00e+00 | 1.99e-04 | 4.48e-31 | 0.8998 |
1. PBF | Q6KHL1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 9.74e-03 | 8.05e-84 | 0.935 |
1. PBF | Q66EN1 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.07e-02 | 4.93e-20 | 0.8253 |
1. PBF | Q3K9F9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.29e-02 | 2.88e-18 | 0.892 |
1. PBF | Q8TIX0 | Putative ABC transporter ATP-binding protein MA_4020 | 0.00e+00 | 2.31e-07 | 9.18e-47 | 0.9182 |
1. PBF | Q3IQI3 | Phosphate import ATP-binding protein PstB 2 | 6.66e-13 | 1.91e-11 | 2.54e-20 | 0.8431 |
1. PBF | Q6G3A6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.57e-02 | 1.26e-08 | 0.9012 |
1. PBF | P0A9V2 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 1.44e-02 | 8.06e-12 | 0.8871 |
1. PBF | Q6G4Q8 | Putative ABC transporter ATP-binding protein BH02760 | 0.00e+00 | 1.22e-04 | 2.32e-30 | 0.918 |
1. PBF | P44986 | Thiamine import ATP-binding protein ThiQ | 2.00e-15 | 6.50e-04 | 1.98e-21 | 0.8586 |
1. PBF | Q9RRL9 | Putative ABC transporter ATP-binding protein DR_2469 | 0.00e+00 | 2.38e-02 | 2.92e-27 | 0.9082 |
1. PBF | Q2SRI1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.11e-84 | 0.0 | 0.7666 |
1. PBF | Q0SQH5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.55e-02 | 2.90e-61 | 0.9286 |
1. PBF | Q8FYU9 | Thiamine import ATP-binding protein ThiQ | 8.88e-16 | 1.02e-03 | 2.79e-21 | 0.8579 |
1. PBF | Q52666 | Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD | 2.05e-14 | 4.44e-05 | 2.22e-28 | 0.8609 |
1. PBF | Q8CTM4 | Teichoic acids export ATP-binding protein TagH | 3.03e-10 | 1.17e-02 | 4.13e-11 | 0.6669 |
1. PBF | Q890D1 | Nickel import ATP-binding protein LarO | 0.00e+00 | 3.85e-03 | 5.47e-24 | 0.8936 |
1. PBF | Q65M64 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.80e-12 | 1.55e-02 | 1.66e-25 | 0.8426 |
1. PBF | Q4L885 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.35e-04 | 2.98e-66 | 0.9259 |
1. PBF | Q2LVM2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.49e-03 | 5.77e-13 | 0.9016 |
1. PBF | Q1IKM7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.65e-04 | 7.08e-11 | 0.8858 |
1. PBF | Q9HYG4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.54e-10 | 7.01e-03 | 4.28e-18 | 0.7262 |
1. PBF | Q47MA5 | Hemin import ATP-binding protein HmuV | 1.11e-11 | 1.32e-05 | 7.97e-11 | 0.7165 |
1. PBF | Q5V6B8 | Phosphonates import ATP-binding protein PhnC 1 | 1.40e-12 | 2.32e-04 | 4.83e-11 | 0.6905 |
1. PBF | Q2JB14 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.83e-02 | 7.44e-18 | 0.8528 |
1. PBF | Q7VP69 | Thiamine import ATP-binding protein ThiQ | 6.66e-16 | 2.07e-03 | 1.26e-18 | 0.8771 |
1. PBF | Q57CD8 | Putative ABC transporter ATP-binding protein BruAb1_1365 | 0.00e+00 | 6.44e-04 | 1.58e-21 | 0.8898 |
1. PBF | Q9LC44 | Teichoic acids export ATP-binding protein TagH | 2.91e-10 | 7.78e-03 | 3.06e-08 | 0.6691 |
1. PBF | O34677 | Glutamine transport ATP-binding protein GlnQ | 0.00e+00 | 3.87e-02 | 2.13e-25 | 0.8882 |
1. PBF | Q57TF5 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 7.85e-03 | 2.05e-20 | 0.8507 |
1. PBF | Q68W38 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.32e-03 | 1.76e-18 | 0.8741 |
1. PBF | Q0TLS2 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.81e-02 | 4.25e-20 | 0.8729 |
1. PBF | Q3IY12 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.22e-03 | 4.13e-07 | 0.8846 |
1. PBF | Q6MSQ2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | 2.38e-02 | 4.24e-40 | 0.88 |
1. PBF | Q6CYU2 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.13e-11 | 2.35e-03 | 3.19e-16 | 0.7344 |
1. PBF | Q3Z5U5 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.16e-02 | 1.32e-20 | 0.8764 |
1. PBF | Q7N0N3 | Putative ABC transporter ATP-binding protein plu3849 | 0.00e+00 | 1.77e-04 | 2.33e-30 | 0.9342 |
1. PBF | Q8ZRV2 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.01e-02 | 4.21e-20 | 0.878 |
1. PBF | D5ARH0 | Biotin transport ATP-binding protein BioM | 6.27e-13 | 1.04e-03 | 1.48e-19 | 0.8391 |
1. PBF | Q5HI31 | Teichoic acids export ATP-binding protein TagH | 2.65e-10 | 5.13e-03 | 3.20e-08 | 0.6728 |
1. PBF | O31427 | SkfA peptide export ATP-binding protein SkfE | 1.00e-12 | 1.12e-03 | 6.36e-15 | 0.8528 |
1. PBF | Q73YZ5 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.50e-13 | 4.47e-04 | 2.64e-24 | 0.7725 |
1. PBF | Q981Y8 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.47e-12 | 4.80e-03 | 4.02e-18 | 0.7656 |
1. PBF | Q87UI3 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 1.32e-10 | 2.83e-02 | 4.09e-17 | 0.729 |
1. PBF | Q897I2 | Putative ABC transporter ATP-binding protein CTC_00753 | 1.84e-09 | 4.08e-03 | 1.49e-27 | 0.8264 |
1. PBF | Q2SXD1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.71e-07 | 1.73e-17 | 0.8756 |
1. PBF | Q8A1M1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.09e-02 | 1.19e-13 | 0.9152 |
1. PBF | Q8D385 | Zinc import ATP-binding protein ZnuC | 7.22e-15 | 8.15e-03 | 3.38e-14 | 0.8143 |
1. PBF | Q8UBY6 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.23e-02 | 6.63e-16 | 0.8683 |
1. PBF | Q8YGM0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.18e-03 | 2.90e-09 | 0.8992 |
1. PBF | Q98FA5 | Thiamine import ATP-binding protein ThiQ | 1.47e-12 | 5.53e-04 | 1.38e-15 | 0.7942 |
1. PBF | Q4L459 | Teichoic acids export ATP-binding protein TagH | 2.57e-10 | 5.86e-03 | 1.22e-09 | 0.6805 |
1. PBF | P0A9R9 | Cell division ATP-binding protein FtsE | 0.00e+00 | 3.78e-03 | 5.73e-13 | 0.9094 |
1. PBF | Q83MG3 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.83e-03 | 2.80e-21 | 0.8847 |
1. PBF | Q6G1D9 | Putative ABC transporter ATP-binding protein BQ02700 | 0.00e+00 | 8.96e-04 | 3.71e-28 | 0.9257 |
1. PBF | Q7NNW9 | Putative ABC transporter ATP-binding protein gll0289 | 0.00e+00 | 1.47e-04 | 5.53e-36 | 0.9287 |
1. PBF | Q2GE91 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.26e-03 | 1.46e-11 | 0.9084 |
1. PBF | Q5YVL8 | Hemin import ATP-binding protein HmuV | 5.44e-15 | 8.38e-07 | 1.47e-10 | 0.7629 |
1. PBF | Q8PHQ3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.62e-11 | 4.46e-02 | 8.64e-15 | 0.7341 |
1. PBF | Q5WET7 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.02e-08 | 1.80e-24 | 0.8126 |
1. PBF | Q7MPC5 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 6.63e-03 | 1.69e-21 | 0.8694 |
1. PBF | Q63TW1 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.34e-09 | 8.93e-09 | 6.27e-15 | 0.6957 |
1. PBF | Q46ZU5 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.39e-09 | 1.27e-03 | 5.45e-16 | 0.6685 |
1. PBF | Q3IM36 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 5.52e-08 | 3.97e-21 | 0.7837 |
1. PBF | Q1RGD0 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.76e-02 | 3.38e-20 | 0.8723 |
1. PBF | A0QFE1 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.16e-13 | 4.47e-04 | 2.64e-24 | 0.7718 |
1. PBF | Q2FER7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.12e-02 | 1.50e-65 | 0.929 |
1. PBF | Q62K56 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.63e-12 | 1.64e-09 | 7.78e-15 | 0.6962 |
1. PBF | Q13RD3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 3.83e-11 | 4.99e-03 | 5.27e-19 | 0.7609 |
1. PBF | A0A0H3JT74 | Metal-staphylopine import system ATP-binding protein CntF | 0.00e+00 | 2.06e-02 | 3.77e-21 | 0.7951 |
1. PBF | Q0SK28 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.15e-13 | 3.73e-02 | 2.50e-17 | 0.8175 |
1. PBF | Q0TMS7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.02e-02 | 1.79e-61 | 0.9283 |
1. PBF | P75356 | Putative ABC transporter ATP-binding protein MG303 homolog | 2.89e-15 | 1.48e-12 | 5.23e-20 | 0.7077 |
1. PBF | O34392 | ABC transporter ATP-binding protein YtrE | 0.00e+00 | 4.08e-02 | 5.66e-25 | 0.8797 |
1. PBF | Q8EUF1 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.31e-13 | 3.43e-03 | 2.08e-93 | 0.9067 |
1. PBF | P33982 | Probable ABC transporter ATP-binding protein AZC_3926 | 0.00e+00 | 2.79e-07 | 8.38e-16 | 0.8828 |
1. PBF | A1A9L0 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.26e-12 | 6.69e-03 | 1.74e-17 | 0.8472 |
1. PBF | Q6MD10 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.40e-03 | 8.81e-13 | 0.8748 |
1. PBF | Q5HM27 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 5.23e-03 | 6.53e-65 | 0.9243 |
1. PBF | P45289 | Peptide transport system ATP-binding protein SapF | 2.22e-16 | 3.64e-03 | 6.57e-13 | 0.7765 |
1. PBF | Q11D92 | Thiamine import ATP-binding protein ThiQ | 3.95e-13 | 1.36e-03 | 5.94e-11 | 0.855 |
1. PBF | Q0BSM2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.97e-03 | 1.11e-06 | 0.874 |
1. PBF | Q1RDS4 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.56e-12 | 6.69e-03 | 1.74e-17 | 0.7921 |
1. PBF | Q4UV71 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.85e-04 | 2.17e-14 | 0.8853 |
1. PBF | Q49VI3 | Teichoic acids export ATP-binding protein TagH | 1.92e-10 | 2.45e-03 | 1.41e-09 | 0.6808 |
1. PBF | Q6D0F3 | Thiamine import ATP-binding protein ThiQ | 4.44e-16 | 4.75e-02 | 2.55e-21 | 0.8337 |
1. PBF | Q6XYZ4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 8.46e-03 | 6.73e-123 | 0.9746 |
1. PBF | Q9KP42 | Thiamine import ATP-binding protein ThiQ | 2.98e-12 | 8.44e-04 | 1.82e-18 | 0.8359 |
1. PBF | Q0SIB7 | Hemin import ATP-binding protein HmuV | 1.44e-15 | 9.18e-06 | 1.51e-07 | 0.7515 |
1. PBF | Q8KCE8 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 1.11e-15 | 1.42e-04 | 2.16e-13 | 0.856 |
1. PBF | Q92GP5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.83e-03 | 5.65e-18 | 0.8841 |
1. PBF | Q4UMZ7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.88e-03 | 4.83e-18 | 0.8932 |
1. PBF | Q0I354 | Thiamine import ATP-binding protein ThiQ | 4.33e-15 | 2.85e-04 | 3.74e-21 | 0.8553 |
1. PBF | Q1CMQ3 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.22e-02 | 5.95e-20 | 0.8449 |
1. PBF | Q326G9 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 5.08e-03 | 3.63e-21 | 0.8778 |
1. PBF | Q72PP0 | Lipoprotein-releasing system ATP-binding protein LolD | 1.55e-13 | 1.85e-04 | 5.94e-13 | 0.8623 |
1. PBF | Q7A2W2 | Teichoic acids export ATP-binding protein TagH | 2.59e-10 | 7.78e-03 | 3.06e-08 | 0.6803 |
1. PBF | Q7A713 | Teichoic acids export ATP-binding protein TagH | 2.70e-10 | 7.78e-03 | 3.06e-08 | 0.6659 |
1. PBF | Q48476 | O-antigen export system ATP-binding protein RfbB | 5.14e-13 | 1.55e-02 | 8.58e-10 | 0.7123 |
1. PBF | Q83CV2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.31e-02 | 1.64e-17 | 0.8735 |
1. PBF | Q7N3S7 | Hemin import ATP-binding protein HmuV | 1.11e-16 | 2.70e-02 | 3.75e-25 | 0.863 |
1. PBF | Q5GRS1 | Zinc import ATP-binding protein ZnuC | 4.02e-10 | 6.07e-06 | 1.25e-17 | 0.8003 |
1. PBF | Q0RT43 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 9.88e-10 | 1.83e-03 | 1.04e-19 | 0.7367 |
1. PBF | Q97KZ3 | Putative ABC transporter ATP-binding protein CA_C0773 | 0.00e+00 | 2.57e-04 | 2.64e-39 | 0.9108 |
1. PBF | Q0S0X2 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 2.41e-11 | 2.75e-03 | 1.02e-16 | 0.707 |
1. PBF | Q56903 | O-antigen export system ATP-binding protein RfbE | 8.49e-11 | 3.35e-02 | 2.55e-06 | 0.6431 |
1. PBF | Q5NHP2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.30e-02 | 8.59e-19 | 0.9002 |
1. PBF | Q1C9L0 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.38e-04 | 6.29e-15 | 0.7872 |
1. PBF | Q1CFV9 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.38e-04 | 6.29e-15 | 0.7903 |
1. PBF | Q02QT1 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.36e-11 | 1.59e-02 | 1.23e-17 | 0.74 |
1. PBF | Q4FTM3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.00e-02 | 5.05e-20 | 0.8705 |
1. PBF | A0PXX7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.40e-02 | 5.45e-63 | 0.9365 |
1. PBF | Q8FZV2 | Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 | 0.00e+00 | 3.43e-04 | 2.88e-22 | 0.8899 |
1. PBF | Q28VL7 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 4.16e-05 | 1.76e-19 | 0.8913 |
1. PBF | Q2KBP5 | Biotin transport ATP-binding protein BioM | 0.00e+00 | 1.44e-03 | 4.08e-22 | 0.9172 |
1. PBF | Q4QLQ1 | Thiamine import ATP-binding protein ThiQ | 2.89e-15 | 4.12e-04 | 8.50e-21 | 0.837 |
1. PBF | Q13ZK7 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 4.82e-09 | 5.87e-08 | 1.91e-13 | 0.8221 |
1. PBF | Q2YSU3 | Teichoic acids export ATP-binding protein TagH | 2.45e-10 | 5.13e-03 | 3.20e-08 | 0.6669 |
1. PBF | Q5PB72 | Zinc import ATP-binding protein ZnuC | 5.55e-16 | 1.05e-06 | 6.40e-24 | 0.8237 |
1. PBF | P0A9V3 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 1.44e-02 | 8.06e-12 | 0.8906 |
1. PBF | Q8XA06 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 3.78e-03 | 7.50e-21 | 0.8798 |
1. PBF | Q5HDY6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.12e-02 | 1.50e-65 | 0.9462 |
1. PBF | Q0WJE4 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.22e-02 | 5.95e-20 | 0.8566 |
1. PBF | Q0BZD8 | Phosphonates import ATP-binding protein PhnC | 3.33e-16 | 7.35e-03 | 8.08e-19 | 0.8457 |
1. PBF | Q3IZT1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.97e-03 | 1.36e-11 | 0.9064 |
1. PBF | Q8CRI6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 5.23e-03 | 6.53e-65 | 0.9273 |
1. PBF | Q2GFZ6 | Zinc import ATP-binding protein ZnuC | 6.99e-14 | 1.10e-05 | 9.10e-21 | 0.7889 |
1. PBF | Q83LN2 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.26e-11 | 2.06e-02 | 2.94e-15 | 0.7909 |
1. PBF | Q8DE95 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 6.63e-03 | 1.69e-21 | 0.8769 |
1. PBF | Q9RKQ4 | Hemin import ATP-binding protein HmuV | 2.00e-15 | 1.84e-05 | 4.76e-06 | 0.8401 |
1. PBF | F8DT93 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.70e-04 | 5.40e-14 | 0.8827 |
1. PBF | Q8YJ04 | Thiamine import ATP-binding protein ThiQ | 8.88e-16 | 1.02e-03 | 2.79e-21 | 0.8579 |
1. PBF | Q39EV3 | Lipoprotein-releasing system ATP-binding protein LolD | 1.26e-11 | 4.53e-08 | 2.10e-18 | 0.8819 |
1. PBF | Q4ZLS1 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 2.94e-11 | 4.71e-02 | 6.68e-17 | 0.7239 |
1. PBF | P25885 | Uncharacterized ABC transporter ATP-binding protein R00382 | 1.04e-10 | 8.68e-07 | 2.70e-15 | 0.8746 |
1. PBF | Q6G799 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.19e-02 | 5.76e-66 | 0.9285 |
1. PBF | Q1C1Y5 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.22e-02 | 5.95e-20 | 0.8242 |
1. PBF | O30144 | Molybdate/tungstate import ATP-binding protein WtpC | 1.78e-15 | 4.94e-03 | 2.83e-18 | 0.8526 |
1. PBF | Q8F6L8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.76e-13 | 3.33e-04 | 5.89e-13 | 0.8626 |
1. PBF | Q73L25 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.24e-02 | 3.67e-16 | 0.8659 |
1. PBF | Q8PYH5 | Putative ABC transporter ATP-binding protein MM_0887 | 0.00e+00 | 6.57e-06 | 1.33e-45 | 0.9304 |
1. PBF | Q9RKC6 | Putative ABC transporter ATP-binding protein SCO3161 | 0.00e+00 | 5.74e-06 | 2.75e-40 | 0.9322 |
1. PBF | Q2NVW9 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.48e-02 | 5.16e-23 | 0.8696 |
1. PBF | Q5LI72 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.62e-03 | 2.55e-13 | 0.9122 |
1. PBF | Q32K28 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 4.85e-03 | 8.45e-21 | 0.8628 |
1. PBF | Q9WXX8 | Probable metal transport system ATP-binding protein TM_0124 | 1.11e-15 | 2.90e-02 | 6.70e-20 | 0.8446 |
1. PBF | Q87SV4 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.17e-03 | 4.25e-17 | 0.8476 |
1. PBF | P24693 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 5.86e-03 | 5.74e-13 | 0.9056 |
1. PBF | P35116 | Nopaline permease ATP-binding protein P | 0.00e+00 | 1.88e-02 | 1.07e-20 | 0.8371 |
1. PBF | Q74DN5 | Putative ABC transporter ATP-binding protein GSU1281 | 0.00e+00 | 2.71e-04 | 4.84e-40 | 0.9359 |
1. PBF | Q31VE6 | Nickel import ATP-binding protein NikE | 6.55e-15 | 4.08e-03 | 1.03e-17 | 0.7469 |
1. PBF | Q9ZCM4 | Lipoprotein-releasing system ATP-binding protein LolD | 1.11e-16 | 6.77e-04 | 3.74e-17 | 0.885 |
1. PBF | Q5HR97 | Teichoic acids export ATP-binding protein TagH | 3.41e-10 | 1.17e-02 | 4.13e-11 | 0.6644 |
1. PBF | P0A9R8 | Cell division ATP-binding protein FtsE | 0.00e+00 | 3.78e-03 | 5.73e-13 | 0.9068 |
1. PBF | Q5E882 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 3.01e-05 | 3.09e-19 | 0.8683 |
1. PBF | Q6MMY0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.60e-03 | 2.23e-11 | 0.8761 |
1. PBF | O83590 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.06e-02 | 3.21e-19 | 0.9023 |
1. PBF | Q57213 | Uncharacterized ABC transporter ATP-binding protein HI_1474 | 0.00e+00 | 4.24e-06 | 8.18e-14 | 0.9125 |
1. PBF | Q3YSK9 | Zinc import ATP-binding protein ZnuC | 8.85e-14 | 2.95e-06 | 2.85e-19 | 0.7865 |
1. PBF | Q2JGF5 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.98e-09 | 1.52e-07 | 2.25e-20 | 0.7174 |
1. PBF | Q8FJ95 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.07e-10 | 7.78e-03 | 8.04e-17 | 0.7687 |
1. PBF | Q49ZE0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 4.16e-03 | 1.21e-71 | 0.9228 |
2. PF | P71009 | Putative ABC transporter ATP-binding protein AlbC | 7.77e-16 | 4.75e-02 | NA | 0.8325 |
3. BF | Q6FFL0 | Zinc import ATP-binding protein ZnuC | 6.28e-14 | NA | 9.84e-14 | 0.7488 |
3. BF | Q07LY2 | Phosphonates import ATP-binding protein PhnC 2 | 6.22e-15 | NA | 6.32e-15 | 0.7966 |
3. BF | Q8DQY5 | Putative ABC transporter ATP-binding protein spr0430 | 1.31e-08 | NA | 3.32e-31 | 0.8988 |
3. BF | Q4A9E1 | Spermidine/putrescine import ATP-binding protein PotA | 1.06e-07 | NA | 1.02e-10 | 0.6276 |
3. BF | Q0T3U8 | Zinc import ATP-binding protein ZnuC | 6.00e-15 | NA | 4.96e-15 | 0.7643 |
3. BF | Q8YE15 | Molybdenum import ATP-binding protein ModC | 5.80e-12 | NA | 5.70e-12 | 0.821 |
3. BF | Q48P40 | ATP-dependent lipid A-core flippase | 1.42e-11 | NA | 8.88e-20 | 0.5193 |
3. BF | O84071 | Probable metal transport system ATP-binding protein CT_068 | 6.11e-15 | NA | 1.97e-11 | 0.7881 |
3. BF | Q895C4 | Methionine import ATP-binding protein MetN | 1.32e-13 | NA | 6.14e-26 | 0.8841 |
3. BF | Q2J0F4 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.61e-10 | NA | 3.41e-20 | 0.5054 |
3. BF | Q48CA0 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 2.96e-11 | NA | 4.72e-17 | 0.7241 |
3. BF | Q0ASQ1 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 9.61e-20 | 0.8559 |
3. BF | Q2G7G7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 6.70e-13 | 0.8907 |
3. BF | Q21NS8 | ATP-dependent lipid A-core flippase | 4.15e-12 | NA | 5.72e-26 | 0.517 |
3. BF | Q160Y9 | Zinc import ATP-binding protein ZnuC | 4.75e-14 | NA | 1.28e-16 | 0.7633 |
3. BF | P54954 | Probable amino-acid import ATP-binding protein YxeO | 6.66e-16 | NA | 6.33e-19 | 0.8861 |
3. BF | Q65E55 | Ribose import ATP-binding protein RbsA | 1.49e-06 | NA | 2.51e-15 | 0.7502 |
3. BF | O59479 | Putative ABC transporter ATP-binding protein PH1815 | 0.00e+00 | NA | 4.72e-47 | 0.9127 |
3. BF | Q8FJB1 | ATP-dependent lipid A-core flippase | 4.42e-11 | NA | 4.71e-21 | 0.5043 |
3. BF | P21441 | Multidrug resistance protein | 6.74e-06 | NA | 7.05e-13 | 0.5943 |
3. BF | Q601T5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.68e-76 | 0.9382 |
3. BF | Q0A4U4 | ATP-dependent lipid A-core flippase | 1.12e-10 | NA | 2.59e-24 | 0.5182 |
3. BF | Q8U4L3 | Putative ABC transporter ATP-binding protein PF0068 | 0.00e+00 | NA | 1.59e-34 | 0.9072 |
3. BF | P0A2V0 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.11e-11 | NA | 5.66e-16 | 0.5324 |
3. BF | Q0C1C3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 5.12e-12 | 0.8858 |
3. BF | Q5LXJ3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.65e-71 | 0.9527 |
3. BF | P82451 | ATP-binding cassette sub-family C member 9 | 3.52e-06 | NA | 5.43e-11 | 0.5138 |
3. BF | Q92UV5 | Fe(3+) ions import ATP-binding protein FbpC 2 | 4.00e-14 | NA | 1.43e-25 | 0.8862 |
3. BF | Q1IGZ0 | Methionine import ATP-binding protein MetN 2 | 8.88e-16 | NA | 5.10e-26 | 0.8321 |
3. BF | Q1M8E0 | Methionine import ATP-binding protein MetN | 1.73e-11 | NA | 3.13e-23 | 0.8877 |
3. BF | Q10V16 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 6.22e-17 | 0.8408 |
3. BF | Q2ULH4 | Iron-sulfur clusters transporter atm1, mitochondrial | 1.91e-09 | NA | 2.04e-23 | 0.5188 |
3. BF | Q8YD40 | Methionine import ATP-binding protein MetN | 1.32e-10 | NA | 2.12e-26 | 0.8257 |
3. BF | Q6F9X0 | ATP-dependent lipid A-core flippase | 5.72e-12 | NA | 3.42e-19 | 0.5155 |
3. BF | Q8UIW7 | Phosphonates import ATP-binding protein PhnC | 3.72e-14 | NA | 1.04e-12 | 0.7858 |
3. BF | A0R6H8 | Mycobactin import ATP-binding/permease protein IrtA | 6.35e-07 | NA | 3.83e-23 | 0.7174 |
3. BF | Q2K204 | Ribose import ATP-binding protein RbsA 2 | 8.68e-06 | NA | 3.88e-13 | 0.8182 |
3. BF | Q4FMG5 | Taurine import ATP-binding protein TauB | 6.34e-13 | NA | 2.38e-24 | 0.7511 |
3. BF | Q3KF57 | Macrolide export ATP-binding/permease protein MacB 1 | 5.81e-08 | NA | 7.22e-12 | 0.7348 |
3. BF | Q89C51 | Phosphonates import ATP-binding protein PhnC | 6.66e-16 | NA | 6.50e-14 | 0.8053 |
3. BF | Q65P77 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.56e-64 | 0.949 |
3. BF | Q1GIE5 | Spermidine/putrescine import ATP-binding protein PotA | 4.58e-10 | NA | 3.79e-24 | 0.8506 |
3. BF | Q5L5Z1 | Methionine import ATP-binding protein MetN | 3.73e-12 | NA | 1.38e-16 | 0.8041 |
3. BF | Q8DAV2 | ATP-dependent lipid A-core flippase | 7.17e-12 | NA | 4.51e-26 | 0.5093 |
3. BF | Q5F364 | Multidrug resistance-associated protein 1 | 2.46e-06 | NA | 3.69e-14 | 0.6853 |
3. BF | Q9N0V3 | Bile salt export pump | 2.12e-06 | NA | 7.66e-17 | 0.5192 |
3. BF | Q0I4A9 | Zinc import ATP-binding protein ZnuC | 2.43e-14 | NA | 1.33e-08 | 0.7348 |
3. BF | Q0TKS1 | Taurine import ATP-binding protein TauB | 2.17e-13 | NA | 3.19e-31 | 0.8 |
3. BF | Q02DK6 | Methionine import ATP-binding protein MetN 2 | 1.89e-15 | NA | 2.49e-24 | 0.8145 |
3. BF | Q3JNY2 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 5.36e-16 | 0.7658 |
3. BF | Q82VK1 | Macrolide export ATP-binding/permease protein MacB | 1.50e-07 | NA | 6.00e-14 | 0.8351 |
3. BF | Q63H61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.06e-37 | 0.894 |
3. BF | Q601T6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.40e-35 | 0.8475 |
3. BF | Q579Z3 | Molybdenum import ATP-binding protein ModC | 1.55e-08 | NA | 4.26e-12 | 0.8041 |
3. BF | Q927N8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.70e-76 | 0.9571 |
3. BF | P96117 | Zinc transport system ATP-binding protein TroB | 2.96e-14 | NA | 6.19e-14 | 0.8251 |
3. BF | Q9I190 | Macrolide export ATP-binding/permease protein MacB | 1.09e-07 | NA | 2.78e-13 | 0.7288 |
3. BF | Q03EE4 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 8.72e-67 | 0.9528 |
3. BF | Q142P6 | ATP-dependent lipid A-core flippase | 2.75e-10 | NA | 8.07e-21 | 0.4986 |
3. BF | Q032H4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.25e-65 | 0.9457 |
3. BF | Q0RKH4 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 7.18e-12 | NA | 1.74e-21 | 0.767 |
3. BF | P19844 | Probable ABC transporter ATP-binding protein NosF | 1.28e-11 | NA | 5.33e-12 | 0.8367 |
3. BF | Q92WJ0 | Fe(3+) ions import ATP-binding protein FbpC 1 | 1.07e-14 | NA | 7.03e-24 | 0.8896 |
3. BF | Q1I7I9 | Macrolide export ATP-binding/permease protein MacB 2 | 5.75e-08 | NA | 1.63e-12 | 0.757 |
3. BF | Q39LW7 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 4.82e-11 | NA | 1.57e-17 | 0.7388 |
3. BF | Q71WH7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.09e-75 | 0.9596 |
3. BF | Q16BJ3 | Taurine import ATP-binding protein TauB | 1.09e-11 | NA | 2.46e-25 | 0.7394 |
3. BF | Q0T7M2 | Taurine import ATP-binding protein TauB | 2.34e-13 | NA | 2.94e-29 | 0.7988 |
3. BF | Q7A088 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | 0.8735 |
3. BF | A1B9H9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 3.52e-12 | NA | 2.08e-19 | 0.7881 |
3. BF | Q881U6 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 1.01e-11 | NA | 8.18e-19 | 0.7906 |
3. BF | Q2ISN3 | Phosphonates import ATP-binding protein PhnC 2 | 3.71e-13 | NA | 1.03e-14 | 0.7823 |
3. BF | Q04EY5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.93e-61 | 0.95 |
3. BF | P94374 | Uncharacterized ABC transporter ATP-binding protein YxlF | 2.62e-13 | NA | 9.40e-20 | 0.687 |
3. BF | P44692 | Zinc import ATP-binding protein ZnuC | 3.35e-14 | NA | 6.98e-08 | 0.7219 |
3. BF | Q48KB2 | Macrolide export ATP-binding/permease protein MacB | 6.23e-08 | NA | 6.08e-11 | 0.8746 |
3. BF | Q7N6C6 | ATP-dependent lipid A-core flippase | 3.63e-11 | NA | 2.08e-24 | 0.5085 |
3. BF | Q4WDD4 | ABC multidrug transporter atrF | 1.07e-03 | NA | 5.29e-11 | 0.5742 |
3. BF | P55122 | Leukotoxin translocation ATP-binding protein LktB | 1.62e-09 | NA | 2.46e-26 | 0.5112 |
3. BF | C8ZCR2 | ABC transporter NFT1 | 1.88e-05 | NA | 6.72e-17 | 0.6488 |
3. BF | P63359 | ATP-dependent lipid A-core flippase | 2.30e-11 | NA | 1.59e-20 | 0.5112 |
3. BF | Q3JYF4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.69e-69 | 0.9602 |
3. BF | Q035B2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.60e-67 | 0.957 |
3. BF | P26362 | Cystic fibrosis transmembrane conductance regulator | 1.16e-05 | NA | 4.80e-09 | 0.6337 |
3. BF | P0AAF9 | Arginine transport ATP-binding protein ArtP | 0.00e+00 | NA | 3.62e-21 | 0.8909 |
3. BF | Q65QT6 | Maltose/maltodextrin import ATP-binding protein MalK | 2.69e-11 | NA | 5.51e-26 | 0.9192 |
3. BF | P9WQK4 | Uncharacterized ABC transporter ATP-binding protein MT0079 | 1.38e-10 | NA | 3.08e-12 | 0.8972 |
3. BF | Q0TBX9 | Nickel import ATP-binding protein NikD | 3.00e-15 | NA | 5.40e-15 | 0.8036 |
3. BF | Q6F0P3 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 2.36e-13 | 0.8072 |
3. BF | Q0AUL1 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.43e-50 | 0.8334 |
3. BF | Q5E6M2 | Zinc import ATP-binding protein ZnuC 1 | 8.52e-14 | NA | 5.14e-12 | 0.7477 |
3. BF | Q1M7A6 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.13e-09 | NA | 6.23e-18 | 0.7546 |
3. BF | Q8DY60 | Putative ABC transporter ATP-binding protein SAG1633 | 9.76e-09 | NA | 1.73e-30 | 0.8333 |
3. BF | Q32IZ6 | Taurine import ATP-binding protein TauB | 2.22e-13 | NA | 1.56e-32 | 0.7978 |
3. BF | Q8UF79 | Zinc import ATP-binding protein ZnuC | 4.00e-13 | NA | 3.29e-14 | 0.707 |
3. BF | Q1J982 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.42e-66 | 0.9659 |
3. BF | Q99S48 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | 0.8766 |
3. BF | Q9PEE7 | ATP-dependent lipid A-core flippase | 2.68e-11 | NA | 1.69e-21 | 0.5146 |
3. BF | Q5ZUG5 | Methionine import ATP-binding protein MetN | 2.06e-12 | NA | 2.22e-18 | 0.7989 |
3. BF | Q6N1Y7 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.84e-10 | NA | 1.12e-18 | 0.5094 |
3. BF | O07549 | Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH | 2.17e-09 | NA | 2.83e-26 | 0.5155 |
3. BF | Q5PGH0 | ATP-dependent lipid A-core flippase | 9.38e-12 | NA | 1.50e-20 | 0.5095 |
3. BF | Q98QE1 | Spermidine/putrescine import ATP-binding protein PotA | 3.21e-06 | NA | 2.72e-12 | 0.6385 |
3. BF | Q48PU6 | Methionine import ATP-binding protein MetN 1 | 1.55e-15 | NA | 1.62e-25 | 0.8136 |
3. BF | Q7MMN0 | Zinc import ATP-binding protein ZnuC | 1.28e-11 | NA | 1.00e-15 | 0.74 |
3. BF | Q92AF9 | Manganese transport system ATP-binding protein MntB | 2.81e-14 | NA | 1.53e-12 | 0.8159 |
3. BF | Q6MUF4 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 4.38e-11 | 0.8156 |
3. BF | Q2T8T6 | Ribose import ATP-binding protein RbsA 2 | 5.73e-06 | NA | 8.39e-10 | 0.7778 |
3. BF | Q0RAT5 | Spermidine/putrescine import ATP-binding protein PotA | 6.18e-13 | NA | 1.21e-16 | 0.888 |
3. BF | Q82MV1 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.48e-09 | NA | 1.03e-17 | 0.7173 |
3. BF | Q8ZJD0 | Taurine import ATP-binding protein TauB | 2.65e-13 | NA | 1.37e-19 | 0.7958 |
3. BF | Q56927 | Fe(3+) ions import ATP-binding protein FbpC | 2.57e-09 | NA | 1.06e-19 | 0.88 |
3. BF | Q31TP8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.02e-11 | 0.813 |
3. BF | P0C0E2 | Lantibiotic transport ATP-binding protein SrtF | 3.14e-13 | NA | 7.05e-13 | 0.8734 |
3. BF | Q50801 | Putative ABC transporter ATP-binding protein MTBMA_c05830 | 0.00e+00 | NA | 3.80e-42 | 0.9014 |
3. BF | Q87UN0 | Zinc import ATP-binding protein ZnuC | 3.32e-14 | NA | 5.25e-13 | 0.7298 |
3. BF | Q5LUR8 | Zinc import ATP-binding protein ZnuC | 1.04e-14 | NA | 1.58e-16 | 0.8006 |
3. BF | P47425 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.72e-82 | 0.93 |
3. BF | Q2NUA5 | ATP-dependent lipid A-core flippase | 6.13e-11 | NA | 3.72e-24 | 0.523 |
3. BF | Q1RAS6 | Zinc import ATP-binding protein ZnuC | 1.08e-14 | NA | 4.30e-15 | 0.7907 |
3. BF | Q0BQ80 | Molybdenum import ATP-binding protein ModC | 1.21e-11 | NA | 3.61e-18 | 0.7821 |
3. BF | Q88ZH4 | Teichoic acids export ATP-binding protein TagH | 1.21e-09 | NA | 3.19e-10 | 0.5722 |
3. BF | Q97X60 | Putative ABC transporter ATP-binding protein SSO1893 | 6.15e-06 | NA | 9.12e-33 | 0.8775 |
3. BF | Q737I0 | Putative ABC transporter ATP-binding protein BCE_2668 | 1.67e-07 | NA | 5.92e-35 | 0.7981 |
3. BF | E0SCY1 | Glycine betaine/choline transport system ATP-binding protein OusV | 6.50e-12 | NA | 4.08e-27 | 0.8346 |
3. BF | Q5YYR7 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 3.78e-11 | NA | 3.74e-14 | 0.7584 |
3. BF | Q1LQD3 | ATP-dependent lipid A-core flippase | 8.37e-11 | NA | 5.60e-24 | 0.5219 |
3. BF | Q81CT8 | Putative ABC transporter ATP-binding protein BC_2655 | 1.31e-07 | NA | 1.40e-38 | 0.8169 |
3. BF | Q8U949 | Ribose import ATP-binding protein RbsA 2 | 2.54e-05 | NA | 2.74e-10 | 0.8367 |
3. BF | Q03A07 | Methionine import ATP-binding protein MetN | 2.00e-14 | NA | 2.22e-28 | 0.8655 |
3. BF | Q1CCR9 | Taurine import ATP-binding protein TauB | 2.15e-13 | NA | 1.37e-19 | 0.7995 |
3. BF | A0KE25 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 5.92e-04 | NA | 7.99e-10 | 0.8412 |
3. BF | Q62AW4 | Taurine import ATP-binding protein TauB | 1.24e-12 | NA | 1.03e-14 | 0.7772 |
3. BF | Q2SPI3 | Zinc import ATP-binding protein ZnuC 1 | 2.91e-14 | NA | 1.78e-16 | 0.7304 |
3. BF | Q97KD5 | Methionine import ATP-binding protein MetN | 3.02e-14 | NA | 2.01e-24 | 0.9139 |
3. BF | Q9K9G7 | Formylaminopyrimidine import ATP-binding protein ThiZ | 1.47e-12 | NA | 4.02e-10 | 0.7731 |
3. BF | A1JJ55 | Autoinducer 2 import ATP-binding protein LsrA | 2.30e-05 | NA | 1.45e-09 | 0.8406 |
3. BF | Q7W148 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 2.59e-11 | 0.8156 |
3. BF | Q1CGD7 | Macrolide export ATP-binding/permease protein MacB 2 | 1.18e-07 | NA | 3.70e-16 | 0.7683 |
3. BF | Q47T99 | Spermidine/putrescine import ATP-binding protein PotA | 3.22e-11 | NA | 4.15e-21 | 0.8952 |
3. BF | Q83KR7 | Zinc import ATP-binding protein ZnuC | 1.52e-14 | NA | 4.96e-15 | 0.7541 |
3. BF | Q97WT4 | Putative ABC transporter ATP-binding protein SSO2030 | 1.76e-07 | NA | 5.83e-35 | 0.8714 |
3. BF | Q0PAR0 | Macrolide export ATP-binding/permease protein MacB | 1.13e-08 | NA | 9.46e-12 | 0.8853 |
3. BF | Q8FUN3 | Putative ATP-binding protein BRA1187/BS1330_II1178 | 5.12e-13 | NA | 7.17e-18 | 0.769 |
3. BF | Q11C01 | Ribose import ATP-binding protein RbsA | 3.85e-06 | NA | 1.03e-12 | 0.8475 |
3. BF | Q4AA75 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.39e-75 | 0.9388 |
3. BF | P37608 | Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3 | 3.90e-08 | NA | 1.35e-13 | 0.4816 |
3. BF | Q884D4 | Macrolide export ATP-binding/permease protein MacB 1 | 9.84e-08 | NA | 5.23e-11 | 0.7352 |
3. BF | Q8Y843 | Teichoic acids export ATP-binding protein TagH | 7.10e-10 | NA | 2.32e-14 | 0.6257 |
3. BF | P0C0E8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.06e-66 | 0.9651 |
3. BF | A2RI01 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.25e-65 | 0.9567 |
3. BF | Q8DRR9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.35e-67 | 0.9412 |
3. BF | Q9RCG7 | Exotoxin translocation ATP-binding protein PaxB | 8.60e-10 | NA | 4.81e-28 | 0.5105 |
3. BF | A3DJK5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.88e-41 | 0.9114 |
3. BF | Q8P8W4 | ATP-dependent lipid A-core flippase | 1.10e-11 | NA | 1.99e-22 | 0.5203 |
3. BF | Q1LC89 | Hemin import ATP-binding protein HmuV | 1.78e-15 | NA | 2.68e-09 | 0.8362 |
3. BF | Q3SJC6 | Molybdenum import ATP-binding protein ModC | 3.18e-12 | NA | 8.50e-20 | 0.8025 |
3. BF | Q56993 | Hemin import ATP-binding protein HmuV | 5.55e-16 | NA | 3.62e-20 | 0.8563 |
3. BF | Q47258 | Alpha-hemolysin translocation ATP-binding protein HlyB | 9.49e-10 | NA | 1.95e-24 | 0.5089 |
3. BF | J9VWU3 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.60e-09 | NA | 9.27e-22 | 0.5191 |
3. BF | Q734T1 | Putative ABC transporter ATP-binding protein BCE_3323 | 3.29e-07 | NA | 3.04e-25 | 0.8146 |
3. BF | A0ALT7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.88e-75 | 0.9619 |
3. BF | P0DKX6 | Cyclolysin secretion/processing ATP-binding protein CyaB | 2.23e-09 | NA | 9.01e-22 | 0.5153 |
3. BF | Q1IGL4 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.89e-12 | NA | 3.37e-17 | 0.7255 |
3. BF | Q8K9M6 | Zinc import ATP-binding protein ZnuC | 5.66e-15 | NA | 1.24e-11 | 0.8071 |
3. BF | A1BC20 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 5.64e-10 | NA | 3.31e-13 | 0.7536 |
3. BF | Q1C0Q8 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 3.62e-20 | 0.8571 |
3. BF | Q5ZZZ7 | Spermidine/putrescine import ATP-binding protein PotA | 1.62e-06 | NA | 1.06e-10 | 0.6403 |
3. BF | Q2SZW0 | ATP-dependent lipid A-core flippase | 8.12e-10 | NA | 7.15e-27 | 0.5165 |
3. BF | Q9HUG8 | ATP-dependent lipid A-core flippase | 5.27e-11 | NA | 5.88e-22 | 0.5079 |
3. BF | Q2KUC0 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 1.27e-12 | 0.8369 |
3. BF | Q87RE5 | Zinc import ATP-binding protein ZnuC | 6.83e-14 | NA | 7.83e-13 | 0.7454 |
3. BF | H9BZ66 | ABC transporter G family member 1 | 7.04e-07 | NA | 2.31e-04 | 0.6452 |
3. BF | Q38UT9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.51e-74 | 0.9644 |
3. BF | Q5B1Q2 | Iron-sulfur clusters transporter atm1, mitochondrial | 1.72e-09 | NA | 1.76e-23 | 0.5392 |
3. BF | Q1J449 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.9643 |
3. BF | F9X9V4 | ABC-type transporter MYCGRDRAFT_41235 | 9.60e-06 | NA | 2.51e-09 | 0.5726 |
3. BF | Q8Z5N5 | Cobalt import ATP-binding protein CbiO | 0.00e+00 | NA | 1.35e-19 | 0.8831 |
3. BF | Q7WNT8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 6.26e-12 | 0.8271 |
3. BF | Q92CV8 | Teichoic acids export ATP-binding protein TagH | 5.48e-10 | NA | 8.54e-16 | 0.6709 |
3. BF | P60753 | ATP-dependent lipid A-core flippase | 2.08e-11 | NA | 4.89e-21 | 0.4943 |
3. BF | Q46TK4 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.49e-20 | 0.7663 |
3. BF | Q7WH20 | ATP-dependent lipid A-core flippase | 4.16e-10 | NA | 5.25e-21 | 0.5302 |
3. BF | Q57399 | Molybdate import ATP-binding protein MolC | 5.55e-16 | NA | 4.47e-14 | 0.8073 |
3. BF | Q07LU3 | Hemin import ATP-binding protein HmuV | 2.29e-14 | NA | 1.33e-12 | 0.8197 |
3. BF | Q9I1C8 | Methionine import ATP-binding protein MetN 1 | 3.36e-13 | NA | 3.10e-21 | 0.8071 |
3. BF | Q8RLB6 | Aliphatic sulfonates import ATP-binding protein SsuB | 5.14e-11 | NA | 6.63e-19 | 0.7489 |
3. BF | P45022 | Probable amino-acid ABC transporter ATP-binding protein HI_1078 | 1.42e-13 | NA | 3.29e-18 | 0.8222 |
3. BF | Q07QX6 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 3.97e-10 | NA | 5.15e-19 | 0.5142 |
3. BF | Q4A8A2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.68e-76 | 0.9433 |
3. BF | Q8TQW9 | Putative ABC transporter ATP-binding protein MA_1418 | 3.41e-07 | NA | 2.22e-30 | 0.8017 |
3. BF | P63388 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 1.44e-15 | NA | 8.47e-13 | 0.8405 |
3. BF | Q4ZZR8 | Methionine import ATP-binding protein MetN 1 | 1.11e-15 | NA | 6.67e-26 | 0.8127 |
3. BF | Q1GKZ0 | Phosphonates import ATP-binding protein PhnC 2 | 1.83e-14 | NA | 5.55e-14 | 0.7838 |
3. BF | Q6YRJ4 | Putative ABC transporter ATP-binding protein PAM_020 | 1.09e-08 | NA | 2.92e-29 | 0.7851 |
3. BF | Q32AQ2 | Nickel import ATP-binding protein NikD | 3.33e-15 | NA | 1.89e-13 | 0.8029 |
3. BF | Q0BFU0 | Ribose import ATP-binding protein RbsA 1 | 3.82e-06 | NA | 5.78e-11 | 0.7783 |
3. BF | Q132E8 | Phosphonates import ATP-binding protein PhnC | 3.11e-15 | NA | 4.03e-16 | 0.8547 |
3. BF | Q2PBM0 | Autoinducer 2 import ATP-binding protein LsrA | 2.36e-05 | NA | 1.09e-12 | 0.7596 |
3. BF | Q62IG3 | ATP-dependent lipid A-core flippase | 1.72e-11 | NA | 1.89e-27 | 0.5221 |
3. BF | Q9CIS9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.40e-69 | 0.9411 |
3. BF | P75444 | Putative ABC transporter ATP-binding protein MPN_334 | 5.29e-12 | NA | 2.49e-13 | 0.7559 |
3. BF | P37494 | Uncharacterized ABC transporter ATP-binding protein YybJ | 3.33e-16 | NA | 8.32e-13 | 0.8594 |
3. BF | Q81J16 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.42e-68 | 0.9467 |
3. BF | Q7A471 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | 0.8764 |
3. BF | Q57180 | Uncharacterized ABC transporter ATP-binding protein HI_1051 | 7.21e-11 | NA | 7.81e-26 | 0.5248 |
3. BF | Q8KZQ6 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.15e-11 | NA | 1.02e-17 | 0.7176 |
3. BF | Q3KCC5 | Fe(3+) ions import ATP-binding protein FbpC | 7.15e-10 | NA | 1.17e-20 | 0.8511 |
3. BF | Q98QH5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.10e-85 | 0.9572 |
3. BF | Q9KQW9 | ATP-dependent lipid A-core flippase | 5.59e-12 | NA | 1.04e-25 | 0.5235 |
3. BF | Q3Z542 | Taurine import ATP-binding protein TauB | 2.17e-13 | NA | 1.93e-31 | 0.7985 |
3. BF | Q99ZS8 | Spermidine/putrescine import ATP-binding protein PotA | 2.53e-12 | NA | 8.79e-27 | 0.9218 |
3. BF | Q8ZNV7 | Zinc import ATP-binding protein ZnuC | 1.79e-14 | NA | 4.91e-15 | 0.7939 |
3. BF | Q5X484 | Methionine import ATP-binding protein MetN | 2.90e-12 | NA | 1.15e-18 | 0.8461 |
3. BF | Q98HF7 | Spermidine/putrescine import ATP-binding protein PotA | 3.64e-10 | NA | 4.18e-23 | 0.8826 |
3. BF | P0C086 | Leukotoxin translocation ATP-binding protein LktB | 1.48e-09 | NA | 7.77e-27 | 0.5129 |
3. BF | Q2YIN5 | Molybdenum import ATP-binding protein ModC | 4.06e-12 | NA | 4.26e-12 | 0.8237 |
3. BF | Q8XXB6 | ATP-dependent lipid A-core flippase | 1.43e-10 | NA | 3.09e-27 | 0.539 |
3. BF | Q7NZU6 | ATP-dependent lipid A-core flippase | 3.46e-11 | NA | 6.47e-21 | 0.5265 |
3. BF | Q3Z2L6 | Zinc import ATP-binding protein ZnuC | 1.20e-14 | NA | 4.30e-15 | 0.7918 |
3. BF | Q55462 | Bicarbonate transport ATP-binding protein CmpC | 3.33e-07 | NA | 3.03e-19 | 0.7239 |
3. BF | Q8DWR3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.69e-69 | 0.9604 |
3. BF | Q8PP41 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.92e-10 | NA | 8.11e-17 | 0.7888 |
3. BF | Q3AKM8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 5.50e-13 | 0.8273 |
3. BF | Q9KD30 | Manganese transport system ATP-binding protein MntB | 6.11e-15 | NA | 2.97e-14 | 0.8199 |
3. BF | Q7NAQ6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.15e-88 | 0.9544 |
3. BF | Q630Y3 | Teichoic acids export ATP-binding protein TagH | 1.45e-07 | NA | 1.39e-10 | 0.6749 |
3. BF | Q9CM80 | Fe(3+) ions import ATP-binding protein FbpC | 2.27e-12 | NA | 3.77e-20 | 0.9118 |
3. BF | Q4KGX6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.94e-12 | NA | 2.74e-19 | 0.73 |
3. BF | Q8Z5W6 | Zinc import ATP-binding protein ZnuC | 1.45e-14 | NA | 6.42e-15 | 0.7908 |
3. BF | Q2NHA1 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.81e-44 | 0.9024 |
3. BF | Q5E0F2 | ATP-dependent lipid A-core flippase | 8.02e-12 | NA | 2.42e-25 | 0.5117 |
3. BF | Q6HHI7 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.42e-11 | NA | 8.17e-22 | 0.7581 |
3. BF | Q322E8 | Zinc import ATP-binding protein ZnuC | 9.21e-15 | NA | 4.30e-15 | 0.7904 |
3. BF | Q88R93 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.30e-10 | NA | 1.05e-16 | 0.7187 |
3. BF | Q8FCN0 | Nickel import ATP-binding protein NikD | 2.89e-15 | NA | 3.44e-15 | 0.7768 |
3. BF | Q6KIP2 | Spermidine/putrescine import ATP-binding protein PotA | 2.08e-05 | NA | 9.77e-14 | 0.6133 |
3. BF | Q83J78 | Nickel import ATP-binding protein NikD | 2.78e-15 | NA | 5.75e-14 | 0.7844 |
3. BF | Q8PVG9 | Putative ABC transporter ATP-binding protein MM_1996 | 9.33e-08 | NA | 4.21e-34 | 0.8209 |
3. BF | Q8FAV1 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.57e-12 | 0.8114 |
3. BF | P75516 | Putative carbohydrate transport ATP-binding protein MPN_258 | 1.51e-06 | NA | 2.82e-09 | 0.725 |
3. BF | Q9KQB8 | Zinc import ATP-binding protein ZnuC | 1.02e-13 | NA | 3.13e-13 | 0.8082 |
3. BF | Q7NB11 | Spermidine/putrescine import ATP-binding protein PotA | 2.02e-04 | NA | 1.27e-11 | 0.5467 |
3. BF | Q3ISC1 | Phosphonates import ATP-binding protein PhnC 1 | 2.22e-16 | NA | 6.21e-13 | 0.8344 |
3. BF | P45092 | Arginine transport ATP-binding protein ArtP | 0.00e+00 | NA | 3.69e-23 | 0.8833 |
3. BF | Q4KC87 | Fe(3+) ions import ATP-binding protein FbpC | 2.65e-09 | NA | 1.04e-23 | 0.8775 |
3. BF | Q87R16 | ATP-dependent lipid A-core flippase | 8.49e-12 | NA | 1.92e-24 | 0.5117 |
3. BF | Q2YU20 | Putative multidrug export ATP-binding/permease protein SAB1799c | 3.34e-11 | NA | 2.36e-20 | 0.5245 |
3. BF | P96605 | Uncharacterized ABC transporter ATP-binding protein YdbJ | 8.84e-11 | NA | 4.30e-19 | 0.665 |
3. BF | Q87VF3 | ATP-dependent lipid A-core flippase | 4.53e-11 | NA | 2.09e-20 | 0.5162 |
3. BF | Q03I82 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.47e-70 | 0.9558 |
3. BF | Q4KKK4 | Zinc import ATP-binding protein ZnuC | 2.05e-14 | NA | 1.60e-14 | 0.7897 |
3. BF | Q933I3 | Leukotoxin translocation ATP-binding protein LktB | 8.26e-10 | NA | 1.44e-26 | 0.5105 |
3. BF | P57552 | Multidrug resistance-like ATP-binding protein MdlB | 5.37e-10 | NA | 2.41e-17 | 0.5142 |
3. BF | P17328 | Glycine betaine/proline betaine transport system ATP-binding protein ProV | 7.77e-12 | NA | 1.04e-29 | 0.8341 |
3. BF | Q831L8 | Teichoic acids export ATP-binding protein TagH | 8.50e-09 | NA | 4.99e-09 | 0.603 |
3. BF | Q7CMM7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.9668 |
3. BF | Q8FDZ8 | Alpha-hemolysin translocation ATP-binding protein HlyB | 8.12e-10 | NA | 1.76e-24 | 0.5094 |
3. BF | Q1GZI0 | ATP-dependent lipid A-core flippase | 2.15e-11 | NA | 4.09e-18 | 0.5157 |
3. BF | P73450 | Nitrate import ATP-binding protein NrtC | 3.77e-07 | NA | 1.53e-21 | 0.6935 |
3. BF | Q2YIV5 | Methionine import ATP-binding protein MetN | 1.08e-10 | NA | 2.12e-26 | 0.8267 |
3. BF | A0A0D1CZ63 | Multidrug resistance protein fer6 | 5.64e-07 | NA | 3.68e-14 | 0.6538 |
3. BF | Q92UI2 | Ribose import ATP-binding protein RbsA 3 | 9.23e-07 | NA | 4.36e-11 | 0.8468 |
3. BF | Q5WIL7 | Phosphonates import ATP-binding protein PhnC | 3.33e-16 | NA | 4.68e-13 | 0.8075 |
3. BF | Q8U3E0 | Putative ABC transporter ATP-binding protein PF0528 | 0.00e+00 | NA | 2.89e-46 | 0.8903 |
3. BF | Q5HDY7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | 0.8743 |
3. BF | Q9CJB8 | Lactococcin transport/processing ATP-binding protein LcnC-like | 3.51e-10 | NA | 1.43e-17 | 0.5212 |
3. BF | Q8ZPK4 | Osmoprotectant import ATP-binding protein OsmV | 9.51e-12 | NA | 1.76e-21 | 0.8976 |
3. BF | Q2NIT5 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.22e-58 | 0.8873 |
3. BF | P38046 | Nitrate import ATP-binding protein NrtD | 2.71e-10 | NA | 8.28e-28 | 0.7745 |
3. BF | Q39CJ6 | Taurine import ATP-binding protein TauB | 6.77e-13 | NA | 2.91e-17 | 0.7743 |
3. BF | O28882 | Probable branched-chain amino acid transport ATP-binding protein LivF | 0.00e+00 | NA | 8.81e-13 | 0.8928 |
3. BF | Q7WEH6 | Hemin import ATP-binding protein HmuV | 4.44e-16 | NA | 3.38e-11 | 0.8609 |
3. BF | Q4FQ27 | Zinc import ATP-binding protein ZnuC | 2.14e-13 | NA | 1.84e-12 | 0.7838 |
3. BF | Q0SXV5 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.05e-10 | 0.8098 |
3. BF | Q47JR8 | ATP-dependent lipid A-core flippase | 3.84e-10 | NA | 1.38e-23 | 0.5211 |
3. BF | O57872 | Putative ABC transporter ATP-binding protein PH0132 | 0.00e+00 | NA | 1.52e-32 | 0.8907 |
3. BF | Q5PIA5 | Zinc import ATP-binding protein ZnuC | 1.17e-14 | NA | 7.00e-15 | 0.791 |
3. BF | Q02SA6 | Taurine import ATP-binding protein TauB | 6.13e-13 | NA | 4.99e-19 | 0.7867 |
3. BF | Q9I2N4 | Molybdenum import ATP-binding protein ModC | 4.32e-12 | NA | 1.29e-24 | 0.8225 |
3. BF | A1JRI2 | Zinc import ATP-binding protein ZnuC | 9.88e-15 | NA | 4.08e-15 | 0.7902 |
3. BF | Q70GD4 | Hemin import ATP-binding protein HmuV | 2.78e-15 | NA | 3.26e-13 | 0.8436 |
3. BF | Q2SSS4 | Spermidine/putrescine import ATP-binding protein PotA | 8.61e-12 | NA | 6.07e-23 | 0.8952 |
3. BF | Q92W60 | Ribose import ATP-binding protein RbsA 2 | 8.99e-06 | NA | 4.44e-14 | 0.8416 |
3. BF | Q8FKF5 | Taurine import ATP-binding protein TauB | 2.21e-13 | NA | 1.23e-31 | 0.802 |
3. BF | Q5E284 | Zinc import ATP-binding protein ZnuC 2 | 1.67e-15 | NA | 8.85e-12 | 0.791 |
3. BF | Q8FXI7 | Molybdenum import ATP-binding protein ModC | 6.75e-12 | NA | 2.80e-12 | 0.8217 |
3. BF | Q31YT6 | ATP-dependent lipid A-core flippase | 3.59e-11 | NA | 4.89e-21 | 0.5154 |
3. BF | Q8PUE7 | Putative ABC transporter ATP-binding protein MM_2387 | 3.78e-10 | NA | 1.06e-33 | 0.713 |
3. BF | Q1CA68 | ATP-dependent lipid A-core flippase | 2.14e-11 | NA | 2.60e-23 | 0.5154 |
3. BF | Q2T751 | Taurine import ATP-binding protein TauB | 1.42e-12 | NA | 4.37e-13 | 0.7726 |
3. BF | Q6D645 | Hemin import ATP-binding protein HmuV | 3.33e-16 | NA | 1.19e-20 | 0.862 |
3. BF | P0DKX5 | Cyclolysin secretion/processing ATP-binding protein CyaB | 2.35e-09 | NA | 9.09e-22 | 0.5176 |
3. BF | P0AAG7 | Multidrug resistance-like ATP-binding protein MdlB | 6.06e-10 | NA | 8.00e-19 | 0.5133 |
3. BF | Q48HL2 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 1.38e-15 | 0.7694 |
3. BF | A0LUE6 | Spermidine/putrescine import ATP-binding protein PotA | 5.71e-10 | NA | 1.13e-18 | 0.8906 |
3. BF | Q3SGJ8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 6.91e-15 | 0.861 |
3. BF | P48243 | Glutamate transport ATP-binding protein GluA | 0.00e+00 | NA | 2.26e-24 | 0.8814 |
3. BF | Q39E73 | ATP-dependent lipid A-core flippase | 4.57e-10 | NA | 2.75e-24 | 0.4944 |
3. BF | Q6HI76 | Putative ABC transporter ATP-binding protein BT9727_2424 | 2.26e-07 | NA | 3.23e-36 | 0.7915 |
3. BF | Q1BUV6 | ATP-dependent lipid A-core flippase | 5.55e-10 | NA | 1.27e-24 | 0.5016 |
3. BF | Q4K9A4 | Macrolide export ATP-binding/permease protein MacB 2 | 9.02e-08 | NA | 3.24e-10 | 0.7584 |
3. BF | Q2HIE9 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.74e-10 | NA | 1.15e-22 | 0.521 |
3. BF | P75264 | Putative ABC transporter ATP-binding protein MG187 homolog | 7.07e-05 | NA | 1.30e-10 | 0.4945 |
3. BF | Q3ARY3 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 6.00e-15 | NA | 3.68e-12 | 0.8738 |
3. BF | Q3KBH4 | Spermidine/putrescine import ATP-binding protein PotA | 5.79e-10 | NA | 6.10e-33 | 0.9028 |
3. BF | Q1LQB5 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 6.49e-20 | 0.7706 |
3. BF | Q480N3 | ATP-dependent lipid A-core flippase 2 | 2.29e-11 | NA | 1.14e-23 | 0.5187 |
3. BF | Q5LYN4 | Spermidine/putrescine import ATP-binding protein PotA | 6.05e-12 | NA | 7.24e-24 | 0.914 |
3. BF | Q8ETV7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.70e-74 | 0.9547 |
3. BF | Q659V4 | Hemin import ATP-binding protein HmuV | 4.00e-15 | NA | 2.12e-12 | 0.8397 |
3. BF | Q2SR40 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 7.13e-11 | 0.8133 |
3. BF | Q88XV1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.32e-49 | 0.8954 |
3. BF | Q8X5I6 | Taurine import ATP-binding protein TauB | 2.08e-13 | NA | 1.55e-30 | 0.7998 |
3. BF | Q6GFJ1 | Putative multidrug export ATP-binding/permease protein SAR1956 | 3.00e-12 | NA | 4.40e-22 | 0.5185 |
3. BF | Q6CX96 | Iron-sulfur clusters transporter ATM1, mitochondrial | 7.81e-09 | NA | 1.22e-23 | 0.5314 |
3. BF | Q4KJB2 | ATP-dependent lipid A-core flippase | 7.53e-12 | NA | 7.17e-22 | 0.506 |
3. BF | P0CZ28 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.965 |
3. BF | P54718 | Uncharacterized ABC transporter ATP-binding protein YfiB | 1.19e-11 | NA | 5.89e-22 | 0.5256 |
3. BF | Q6KHL2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.03e-39 | 0.8192 |
3. BF | G7CBF5 | Mycobactin import ATP-binding/permease protein IrtA | 2.82e-05 | NA | 1.77e-24 | 0.6325 |
3. BF | Q1IGN4 | Methionine import ATP-binding protein MetN 1 | 1.31e-10 | NA | 5.69e-17 | 0.7954 |
3. BF | Q9HT73 | Zinc import ATP-binding protein ZnuC | 1.21e-14 | NA | 1.52e-15 | 0.7056 |
3. BF | Q1RFH8 | Taurine import ATP-binding protein TauB | 2.32e-13 | NA | 3.19e-31 | 0.8 |
3. BF | Q21GS5 | Molybdenum import ATP-binding protein ModC | 3.58e-12 | NA | 4.82e-19 | 0.8001 |
3. BF | Q8XDV7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.92e-12 | 0.8134 |
3. BF | Q9CMS0 | Molybdenum import ATP-binding protein ModC | 2.78e-12 | NA | 1.36e-21 | 0.8335 |
3. BF | P0AAF7 | Arginine transport ATP-binding protein ArtP | 0.00e+00 | NA | 3.62e-21 | 0.8952 |
3. BF | Q63P06 | Ribose import ATP-binding protein RbsA | 7.28e-06 | NA | 8.24e-10 | 0.7744 |
3. BF | Q8TI16 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 3.04e-53 | 0.9284 |
3. BF | P53706 | Alpha-factor-transporting ATPase | 1.06e-06 | NA | 2.10e-15 | 0.5135 |
3. BF | S3D778 | ABC transporter gloK | 7.94e-06 | NA | 5.69e-17 | 0.6626 |
3. BF | P94367 | ATP-binding/permease protein CydD | 1.35e-10 | NA | 1.51e-16 | 0.5313 |
3. BF | P45081 | ATP-binding/permease protein CydC | 1.34e-10 | NA | 4.75e-14 | 0.502 |
3. BF | Q9CMG7 | ATP-dependent lipid A-core flippase | 2.48e-11 | NA | 2.99e-23 | 0.5088 |
3. BF | Q6YPR6 | Spermidine/putrescine import ATP-binding protein PotA | 1.84e-09 | NA | 1.45e-12 | 0.6644 |
3. BF | Q1RDU4 | ATP-dependent lipid A-core flippase | 8.10e-10 | NA | 4.71e-21 | 0.5112 |
3. BF | Q1RJ91 | Putative export ATP-binding/permease protein RBE_0492 | 4.44e-11 | NA | 5.62e-19 | 0.5187 |
3. BF | Q2YQ73 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 3.48e-11 | NA | 1.29e-18 | 0.5089 |
3. BF | P9WQL2 | Molybdenum import ATP-binding protein ModC | 3.81e-10 | NA | 1.16e-20 | 0.8309 |
3. BF | Q15UY7 | ATP-dependent lipid A-core flippase | 1.00e-11 | NA | 4.18e-26 | 0.5049 |
3. BF | P0A2V1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.66e-11 | NA | 5.66e-16 | 0.5255 |
3. BF | Q9V1Q4 | Putative ABC transporter ATP-binding protein PYRAB03730 | 0.00e+00 | NA | 1.22e-49 | 0.9072 |
3. BF | Q57NA5 | Zinc import ATP-binding protein ZnuC | 2.23e-14 | NA | 7.00e-15 | 0.7908 |
3. BF | Q6LPK6 | ATP-dependent lipid A-core flippase | 2.40e-10 | NA | 8.06e-24 | 0.5152 |
3. BF | Q8TIW9 | Putative ABC transporter ATP-binding protein MA_4021 | 0.00e+00 | NA | 5.04e-27 | 0.8917 |
3. BF | Q83MA0 | Taurine import ATP-binding protein TauB | 2.31e-13 | NA | 2.65e-30 | 0.802 |
3. BF | Q4HVU7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.10e-09 | NA | 1.28e-21 | 0.5257 |
3. BF | Q9V2E4 | Putative ABC transporter ATP-binding protein PYRAB01300 | 0.00e+00 | NA | 7.99e-36 | 0.908 |
3. BF | P33116 | Subtilin transport ATP-binding protein SpaT | 1.22e-09 | NA | 6.93e-15 | 0.524 |
3. BF | Q7N545 | Zinc import ATP-binding protein ZnuC | 1.34e-11 | NA | 4.00e-12 | 0.7239 |
3. BF | A0R8K9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.98e-39 | 0.8897 |
3. BF | Q4K681 | Spermidine/putrescine import ATP-binding protein PotA | 4.23e-14 | NA | 7.13e-24 | 0.8647 |
3. BF | Q3SFZ6 | ATP-dependent lipid A-core flippase | 3.38e-11 | NA | 2.92e-18 | 0.5169 |
3. BF | P0CL92 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.57e-09 | NA | 8.55e-22 | 0.5181 |
3. BF | Q9CIQ6 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.17e-18 | 0.8402 |
3. BF | Q2YJH4 | Zinc import ATP-binding protein ZnuC | 1.84e-13 | NA | 1.52e-16 | 0.7876 |
3. BF | Q6D437 | ATP-dependent lipid A-core flippase | 6.10e-12 | NA | 7.75e-21 | 0.5118 |
3. BF | A1AC19 | Zinc import ATP-binding protein ZnuC | 3.03e-14 | NA | 4.30e-15 | 0.7895 |
3. BF | Q3KK97 | Methionine import ATP-binding protein MetN 1 | 8.88e-16 | NA | 2.30e-24 | 0.8118 |
3. BF | Q1R3F6 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.57e-12 | 0.8077 |
3. BF | Q03727 | Transport/processing ATP-binding protein ComA | 3.23e-10 | NA | 6.36e-20 | 0.5008 |
3. BF | Q5WKG4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 7.49e-12 | NA | 1.71e-20 | 0.7691 |
3. BF | Q50966 | Fe(3+) ions import ATP-binding protein FbpC | 3.91e-13 | NA | 3.59e-24 | 0.8493 |
3. BF | P0A191 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 0.00e+00 | NA | 8.45e-13 | 0.9014 |
3. BF | Q31I51 | Zinc import ATP-binding protein ZnuC | 5.41e-14 | NA | 1.11e-11 | 0.7582 |
3. BF | Q5F4X8 | ATP-dependent lipid A-core flippase | 1.72e-10 | NA | 2.65e-19 | 0.5091 |
3. BF | Q8X5U1 | Nickel import ATP-binding protein NikD | 3.66e-15 | NA | 1.98e-13 | 0.8035 |
3. BF | P0AAG6 | Multidrug resistance-like ATP-binding protein MdlB | 1.94e-09 | NA | 8.00e-19 | 0.515 |
3. BF | Q97SA3 | Putative ABC transporter ATP-binding protein SP_0483 | 1.45e-08 | NA | 1.32e-31 | 0.8952 |
3. BF | A1KF14 | Multidrug efflux ATP-binding/permease protein BCG_0231 | 1.34e-06 | NA | 4.71e-24 | 0.5307 |
3. BF | A7A063 | ABC transporter NFT1 | 1.96e-05 | NA | 1.94e-15 | 0.6417 |
3. BF | Q55107 | Bicarbonate transport ATP-binding protein CmpC | 4.24e-07 | NA | 2.15e-21 | 0.7067 |
3. BF | Q1B677 | Methionine import ATP-binding protein MetN | 3.75e-12 | NA | 3.82e-27 | 0.8888 |
3. BF | Q668Q3 | Fe(3+) ions import ATP-binding protein FbpC | 1.00e-09 | NA | 2.50e-19 | 0.8558 |
3. BF | Q73R11 | Putative ABC transporter ATP-binding protein TDE_0282 | 3.43e-07 | NA | 6.83e-26 | 0.8974 |
3. BF | S0EGU4 | ABC transporter BEA3 | 5.20e-06 | NA | 4.02e-25 | 0.7317 |
3. BF | Q03SI5 | Teichoic acids export ATP-binding protein TagH | 1.84e-09 | NA | 3.97e-08 | 0.5484 |
3. BF | Q2YJB5 | Putative ATP-binding protein BAB2_1147 | 1.21e-12 | NA | 7.17e-18 | 0.7702 |
3. BF | P26946 | Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 | 1.18e-12 | NA | 3.46e-05 | 0.6365 |
3. BF | Q8PSR0 | Putative ABC transporter ATP-binding protein MM_3016 | 2.11e-08 | NA | 2.16e-32 | 0.8981 |
3. BF | Q8K984 | Multidrug resistance-like ATP-binding protein MdlB | 6.94e-10 | NA | 1.83e-19 | 0.5153 |
3. BF | Q65P76 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.36e-42 | 0.8869 |
3. BF | Q1CGH0 | ATP-dependent lipid A-core flippase | 2.62e-11 | NA | 2.60e-23 | 0.5117 |
3. BF | Q31DV4 | Phosphonates import ATP-binding protein PhnC | 7.92e-14 | NA | 1.63e-18 | 0.7997 |
3. BF | Q63VX7 | ATP-dependent lipid A-core flippase | 8.54e-10 | NA | 1.89e-27 | 0.5176 |
3. BF | P27675 | Glutamine transport ATP-binding protein GlnQ | 0.00e+00 | NA | 4.51e-30 | 0.8598 |
3. BF | Q8Y651 | Manganese transport system ATP-binding protein MntB | 3.00e-14 | NA | 6.08e-14 | 0.8105 |
3. BF | Q6D7D0 | Molybdenum import ATP-binding protein ModC | 6.19e-12 | NA | 3.14e-18 | 0.8168 |
3. BF | Q6YR39 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.34e-59 | 0.9566 |
3. BF | Q6HG98 | Putative ABC transporter ATP-binding protein BT9727_3105 | 3.44e-07 | NA | 3.55e-26 | 0.7964 |
3. BF | Q2SW38 | Xylose import ATP-binding protein XylG | 6.87e-06 | NA | 5.80e-09 | 0.6865 |
3. BF | Q98DA2 | Methionine import ATP-binding protein MetN | 4.54e-11 | NA | 9.89e-23 | 0.8546 |
3. BF | Q83P97 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.05e-10 | 0.8154 |
3. BF | Q50863 | O-antigen export system ATP-binding protein RfbB | 1.40e-10 | NA | 3.37e-11 | 0.6866 |
3. BF | Q2RFS8 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 2.15e-51 | 0.9243 |
3. BF | P35598 | Putative ABC transporter ATP-binding protein exp8 | 8.05e-11 | NA | 4.69e-23 | 0.528 |
3. BF | Q5HEQ8 | Putative multidrug export ATP-binding/permease protein SACOL1924 | 3.34e-12 | NA | 4.40e-22 | 0.5161 |
3. BF | P16532 | Leukotoxin translocation ATP-binding protein LktB | 1.06e-10 | NA | 6.89e-27 | 0.5124 |
3. BF | Q1IGY7 | Zinc import ATP-binding protein ZnuC | 6.33e-15 | NA | 9.28e-15 | 0.7271 |
3. BF | Q2FFM9 | Putative multidrug export ATP-binding/permease protein SAUSA300_1847 | 6.36e-11 | NA | 4.40e-22 | 0.517 |
3. BF | Q2KDV1 | Phosphonates import ATP-binding protein PhnC | 4.05e-14 | NA | 7.16e-14 | 0.7487 |
3. BF | Q3K506 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.35e-10 | NA | 3.60e-15 | 0.8003 |
3. BF | Q93FH3 | Leukotoxin translocation ATP-binding protein LktB | 2.12e-09 | NA | 5.77e-27 | 0.5122 |
3. BF | Q6XYZ3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.81e-44 | 0.8618 |
3. BF | Q2K284 | Methionine import ATP-binding protein MetN | 1.80e-13 | NA | 6.00e-23 | 0.843 |
3. BF | Q5LVC2 | Phosphonates import ATP-binding protein PhnC | 6.70e-13 | NA | 7.07e-11 | 0.7698 |
3. BF | Q832R5 | Putative ABC transporter ATP-binding protein EF_2153 | 2.60e-08 | NA | 7.23e-33 | 0.8796 |
3. BF | Q9AB70 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 9.11e-19 | 0.8219 |
3. BF | Q9YGA6 | Trehalose/maltose import ATP-binding protein MalK | 2.70e-11 | NA | 9.70e-19 | 0.8781 |
3. BF | Q28VN1 | Zinc import ATP-binding protein ZnuC | 3.33e-14 | NA | 2.20e-16 | 0.7869 |
3. BF | Q5WVL8 | Methionine import ATP-binding protein MetN | 2.07e-12 | NA | 2.01e-18 | 0.7996 |
3. BF | A1U776 | Zinc import ATP-binding protein ZnuC | 6.77e-15 | NA | 3.15e-14 | 0.7764 |
3. BF | Q48IB9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 8.03e-11 | NA | 1.96e-18 | 0.7845 |
3. BF | Q3M5J9 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.63e-10 | NA | 3.42e-16 | 0.7596 |
3. BF | P9WQI4 | Uncharacterized ABC transporter ATP-binding protein MT2640 | 5.01e-12 | NA | 6.58e-15 | 0.8556 |
3. BF | P9WQI6 | Uncharacterized ABC transporter ATP-binding protein MT2388 | 3.63e-06 | NA | 4.78e-16 | 0.4972 |
3. BF | Q7W9N7 | ATP-dependent lipid A-core flippase | 1.31e-10 | NA | 5.25e-21 | 0.4973 |
3. BF | Q7CHI2 | Macrolide export ATP-binding/permease protein MacB 1 | 1.25e-07 | NA | 3.70e-16 | 0.7681 |
3. BF | O31708 | Uncharacterized ABC transporter ATP-binding protein YknV | 5.07e-11 | NA | 1.55e-21 | 0.5078 |
3. BF | Q8PKS5 | ATP-dependent lipid A-core flippase | 3.09e-11 | NA | 1.74e-22 | 0.5115 |
3. BF | P0A9X3 | Zinc import ATP-binding protein ZnuC | 1.17e-14 | NA | 4.30e-15 | 0.757 |
3. BF | A2XCD4 | ABC transporter C family member 13 | 6.01e-06 | NA | 8.15e-13 | 0.655 |
3. BF | Q63R24 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 5.36e-16 | 0.7718 |
3. BF | A0A0D1BUH6 | ABC-type transporter atr1 | 4.79e-06 | NA | 5.01e-27 | 0.5336 |
3. BF | Q1QH37 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.73e-10 | NA | 2.23e-17 | 0.5129 |
3. BF | Q8R7Y4 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.81e-57 | 0.9351 |
3. BF | Q8PY27 | Putative ABC transporter ATP-binding protein MM_1037 | 0.00e+00 | NA | 4.76e-51 | 0.9219 |
3. BF | Q66AT7 | Zinc import ATP-binding protein ZnuC | 1.22e-14 | NA | 3.62e-14 | 0.7922 |
3. BF | Q65UG3 | Zinc import ATP-binding protein ZnuC | 4.25e-11 | NA | 2.11e-08 | 0.7259 |
3. BF | Q1R5D9 | Nickel import ATP-binding protein NikD | 2.89e-15 | NA | 5.40e-15 | 0.7824 |
3. BF | Q882S0 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 1.07e-16 | 0.7805 |
3. BF | Q5P2S7 | ATP-dependent lipid A-core flippase | 6.88e-11 | NA | 9.28e-25 | 0.5306 |
3. BF | Q4WD46 | ABC-type transporter fsqE | 1.44e-06 | NA | 1.19e-24 | 0.5436 |
3. BF | Q5X9B5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.9651 |
3. BF | Q1C812 | Zinc import ATP-binding protein ZnuC | 5.66e-15 | NA | 3.99e-14 | 0.7918 |
3. BF | Q46717 | Alpha-hemolysin translocation ATP-binding protein HlyB | 1.80e-09 | NA | 1.18e-21 | 0.5129 |
3. BF | Q3KJ31 | ATP-dependent lipid A-core flippase | 1.82e-11 | NA | 7.22e-22 | 0.5059 |
3. BF | Q1BG75 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 8.07e-11 | NA | 8.76e-16 | 0.7335 |
3. BF | Q6GEL4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.83e-38 | 0.877 |
3. BF | Q9HYL7 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 7.33e-13 | 0.78 |
3. BF | Q7AKE5 | ABC transporter ATP-binding protein RamB | 4.60e-10 | NA | 1.47e-15 | 0.499 |
3. BF | Q02MI4 | Macrolide export ATP-binding/permease protein MacB | 7.12e-08 | NA | 1.93e-13 | 0.7391 |
3. BF | Q93FH6 | Leukotoxin translocation ATP-binding protein LktB | 1.30e-09 | NA | 7.15e-27 | 0.5145 |
3. BF | Q21WN9 | ATP-dependent lipid A-core flippase | 5.26e-12 | NA | 2.77e-24 | 0.529 |
3. BF | Q4ZV10 | Macrolide export ATP-binding/permease protein MacB 1 | 6.44e-08 | NA | 8.67e-11 | 0.7476 |
3. BF | Q8ZGA9 | ATP-dependent lipid A-core flippase | 2.29e-11 | NA | 2.60e-23 | 0.5119 |
3. BF | P0C0E3 | Lantibiotic transport ATP-binding protein SrtF | 2.50e-13 | NA | 7.05e-13 | 0.8747 |
3. BF | Q4FS42 | ATP-dependent lipid A-core flippase | 1.24e-11 | NA | 6.81e-21 | 0.5214 |
3. BF | Q972J5 | Putative ABC transporter ATP-binding protein STK_11360 | 6.66e-16 | NA | 1.20e-25 | 0.9069 |
3. BF | Q1GTY0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.90e-11 | 0.8918 |
3. BF | Q1JJC9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.06e-66 | 0.9649 |
3. BF | P23702 | Leukotoxin export ATP-binding protein LtxB | 1.10e-09 | NA | 4.54e-26 | 0.5161 |
3. BF | Q3BTC8 | ATP-dependent lipid A-core flippase | 3.17e-11 | NA | 5.19e-22 | 0.5139 |
3. BF | Q9HQ18 | Cobalamin import ATP-binding protein BtuD | 7.29e-10 | NA | 2.57e-09 | 0.879 |
3. BF | Q2K6Q4 | Zinc import ATP-binding protein ZnuC | 1.27e-13 | NA | 1.43e-13 | 0.8179 |
3. BF | Q751N2 | Iron-sulfur clusters transporter ATM1, mitochondrial | 3.54e-09 | NA | 7.23e-23 | 0.5281 |
3. BF | Q2LY16 | Cobalt import ATP-binding protein CbiO | 0.00e+00 | NA | 2.41e-51 | 0.9295 |
3. BF | Q92P76 | Zinc import ATP-binding protein ZnuC | 6.03e-14 | NA | 6.84e-16 | 0.7978 |
3. BF | Q5LVM5 | Taurine import ATP-binding protein TauB | 2.78e-11 | NA | 3.04e-18 | 0.7383 |
3. BF | P9WQJ0 | Uncharacterized ABC transporter ATP-binding protein MT1311 | 2.00e-10 | NA | 1.61e-15 | 0.5127 |
3. BF | Q4A7I1 | Spermidine/putrescine import ATP-binding protein PotA | 8.96e-06 | NA | 1.07e-10 | 0.6254 |
3. BF | Q1CE65 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 3.62e-20 | 0.8652 |
3. BF | Q0VTB6 | Zinc import ATP-binding protein ZnuC | 1.56e-13 | NA | 5.83e-11 | 0.8015 |
3. BF | Q66CI3 | ATP-dependent lipid A-core flippase | 2.07e-11 | NA | 2.60e-23 | 0.5153 |
3. BF | Q8UA73 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 1.33e-15 | NA | 1.16e-23 | 0.8633 |
3. BF | P40735 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.37e-64 | 0.9546 |
3. BF | Q1CJS9 | Fe(3+) ions import ATP-binding protein FbpC | 1.34e-09 | NA | 2.50e-19 | 0.8492 |
3. BF | Q3YW49 | Nickel import ATP-binding protein NikD | 3.44e-15 | NA | 7.02e-14 | 0.8049 |
3. BF | Q9I6T2 | Spermidine/putrescine import ATP-binding protein PotA 1 | 2.98e-14 | NA | 4.14e-23 | 0.8615 |
3. BF | Q8ES39 | Putative ABC transporter ATP-binding protein OB0804 | 1.81e-08 | NA | 6.42e-35 | 0.8654 |
3. BF | Q62H59 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 4.56e-16 | 0.7643 |
3. BF | A0RP01 | Macrolide export ATP-binding/permease protein MacB | 2.13e-08 | NA | 6.11e-12 | 0.9012 |
3. BF | A0A1U8QTJ9 | ABC-type transporter cicA | 1.57e-06 | NA | 3.75e-21 | 0.5823 |
3. BF | P97027 | Aliphatic sulfonates import ATP-binding protein SsuB | 5.76e-12 | NA | 2.23e-21 | 0.7638 |
3. BF | Q1JEC8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.9662 |
3. BF | Q12C33 | ATP-dependent lipid A-core flippase | 3.57e-12 | NA | 8.78e-19 | 0.5346 |
3. BF | P0C087 | Leukotoxin translocation ATP-binding protein LktB | 1.67e-09 | NA | 7.77e-27 | 0.5142 |
3. BF | Q1M7R4 | Taurine import ATP-binding protein TauB | 6.34e-13 | NA | 2.52e-22 | 0.761 |
3. BF | Q5HV18 | Methionine import ATP-binding protein MetN | 1.16e-12 | NA | 2.56e-29 | 0.7924 |
3. BF | Q02QM1 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 8.12e-13 | 0.7781 |
3. BF | P08716 | Alpha-hemolysin translocation ATP-binding protein HlyB | 1.05e-09 | NA | 1.46e-24 | 0.5115 |
3. BF | Q5MZ54 | Bicarbonate transport ATP-binding protein CmpC | 3.49e-07 | NA | 2.15e-21 | 0.7244 |
3. BF | Q9HZS1 | Histidine transport ATP-binding protein HisP | 0.00e+00 | NA | 3.25e-13 | 0.8361 |
3. BF | Q4W575 | Fe(3+) ions import ATP-binding protein FbpC | 2.45e-13 | NA | 5.50e-26 | 0.8503 |
3. BF | Q88D92 | ATP-dependent lipid A-core flippase | 1.54e-11 | NA | 6.89e-19 | 0.5203 |
3. BF | Q4KKK8 | Methionine import ATP-binding protein MetN 1 | 1.11e-15 | NA | 2.95e-23 | 0.8129 |
3. BF | Q31FG2 | ATP-dependent lipid A-core flippase | 9.41e-11 | NA | 1.21e-22 | 0.5191 |
3. BF | P0A192 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 0.00e+00 | NA | 8.45e-13 | 0.9019 |
3. BF | Q81VQ2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.27e-68 | 0.949 |
3. BF | Q10418 | Mesentericin-Y105 transport/processing ATP-binding protein MesD | 5.74e-09 | NA | 4.86e-21 | 0.5168 |
3. BF | Q6MPX9 | Macrolide export ATP-binding/permease protein MacB | 1.11e-07 | NA | 5.58e-11 | 0.7111 |
3. BF | Q97EK8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.68e-64 | 0.9311 |
3. BF | O07550 | Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI | 7.79e-10 | NA | 2.22e-20 | 0.4989 |
3. BF | Q89AJ0 | Zinc import ATP-binding protein ZnuC | 6.66e-16 | NA | 1.10e-12 | 0.823 |
3. BF | Q72D73 | Putative ABC transporter ATP-binding protein DVU_1056 | 2.78e-15 | NA | 1.23e-23 | 0.8941 |
3. BF | Q3JKX3 | Taurine import ATP-binding protein TauB | 1.18e-12 | NA | 1.03e-14 | 0.7764 |
3. BF | Q4ZTG9 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 4.64e-11 | NA | 2.34e-13 | 0.803 |
3. BF | Q7RX59 | Iron-sulfur clusters transporter atm1, mitochondrial | 2.19e-09 | NA | 8.46e-23 | 0.5155 |
3. BF | Q81P94 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.22e-11 | NA | 6.90e-22 | 0.752 |
3. BF | Q3SQ65 | Hemin import ATP-binding protein HmuV | 3.22e-15 | NA | 9.18e-12 | 0.8374 |
3. BF | Q8ZCM2 | Fe(3+) ions import ATP-binding protein FbpC | 1.89e-09 | NA | 2.50e-19 | 0.8396 |
3. BF | Q8RHL0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.99e-56 | 0.853 |
3. BF | Q720Z5 | Teichoic acids export ATP-binding protein TagH | 1.47e-09 | NA | 8.46e-16 | 0.652 |
3. BF | O31711 | Uncharacterized ABC transporter ATP-binding protein YknY | 0.00e+00 | NA | 4.30e-15 | 0.882 |
3. BF | Q7VR44 | ATP-dependent lipid A-core flippase | 4.44e-12 | NA | 6.01e-17 | 0.5187 |
3. BF | Q2SRI2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.23e-40 | 0.8565 |
3. BF | Q98G43 | Fe(3+) ions import ATP-binding protein FbpC | 4.58e-09 | NA | 1.47e-22 | 0.8483 |
3. BF | Q66FK0 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 3.62e-20 | 0.8628 |
3. BF | A3DJK3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.05e-54 | 0.915 |
3. BF | Q5YRK2 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 3.62e-13 | NA | 5.75e-15 | 0.758 |
3. BF | Q9Z8J5 | Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 | 1.69e-14 | NA | 3.70e-10 | 0.779 |
3. BF | Q8DFQ4 | Zinc import ATP-binding protein ZnuC | 1.38e-11 | NA | 1.00e-15 | 0.7307 |
3. BF | Q5FA19 | Fe(3+) ions import ATP-binding protein FbpC | 1.65e-10 | NA | 1.90e-26 | 0.8531 |
3. BF | Q8R9L8 | Putative ABC transporter ATP-binding protein TTE1589 | 9.91e-08 | NA | 1.49e-36 | 0.9176 |
3. BF | Q032D0 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 9.89e-18 | 0.8481 |
3. BF | P9WQJ8 | Mycobactin import ATP-binding/permease protein IrtA | 3.23e-07 | NA | 2.33e-22 | 0.5236 |
3. BF | Q03PY5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.26e-76 | 0.9358 |
3. BF | Q93DX8 | Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) | 0.00e+00 | NA | 8.77e-27 | 0.8724 |
3. BF | Q1C607 | Fe(3+) ions import ATP-binding protein FbpC | 1.71e-09 | NA | 2.50e-19 | 0.8423 |
3. BF | Q9PKX1 | Probable metal transport system ATP-binding protein TC_0339 | 1.79e-14 | NA | 1.43e-10 | 0.768 |
3. BF | Q2SJB5 | Molybdenum import ATP-binding protein ModC | 5.06e-08 | NA | 7.98e-18 | 0.823 |
3. BF | Q9JVH1 | Fe(3+) ions import ATP-binding protein FbpC | 2.56e-13 | NA | 5.50e-26 | 0.8585 |
3. BF | Q8VNL9 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.08e-75 | 0.9346 |
3. BF | Q3JUI6 | ATP-dependent lipid A-core flippase | 1.03e-09 | NA | 1.89e-27 | 0.5162 |
3. BF | Q2K164 | Taurine import ATP-binding protein TauB | 8.04e-13 | NA | 2.33e-22 | 0.7738 |
3. BF | Q4UJW5 | Zinc import ATP-binding protein ZnuC | 2.73e-10 | NA | 1.29e-17 | 0.8312 |
3. BF | P63392 | Mycobactin import ATP-binding/permease protein IrtA | 8.10e-07 | NA | 2.33e-22 | 0.5232 |
3. BF | Q5PDU4 | Cobalt import ATP-binding protein CbiO | 0.00e+00 | NA | 1.33e-19 | 0.8858 |
3. BF | Q3Z3K7 | ATP-dependent lipid A-core flippase | 5.59e-11 | NA | 4.76e-21 | 0.5111 |
3. BF | B2K3G1 | Autoinducer 2 import ATP-binding protein LsrA | 1.51e-04 | NA | 1.34e-09 | 0.8461 |
3. BF | Q6D4A8 | Zinc import ATP-binding protein ZnuC | 3.71e-14 | NA | 2.78e-15 | 0.7667 |
3. BF | Q5UW69 | Phosphonates import ATP-binding protein PhnC 2 | 1.33e-15 | NA | 1.86e-11 | 0.7801 |
3. BF | Q71WH8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.75e-39 | 0.8882 |
3. BF | O34900 | L-cystine import ATP-binding protein TcyN | 0.00e+00 | NA | 8.28e-27 | 0.8747 |
3. BF | P44407 | ATP-dependent lipid A-core flippase | 4.21e-12 | NA | 1.24e-23 | 0.5275 |
3. BF | Q7VL52 | ATP-dependent lipid A-core flippase | 9.26e-12 | NA | 4.38e-23 | 0.511 |
3. BF | Q9CH26 | Teichoic acids export ATP-binding protein TagH | 5.52e-07 | NA | 5.19e-14 | 0.5881 |
3. BF | Q0T9T7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 3.21e-12 | 0.8047 |
3. BF | Q05596 | Cobalt import ATP-binding protein CbiO | 0.00e+00 | NA | 1.16e-19 | 0.8663 |
3. BF | P63402 | Uncharacterized ABC transporter ATP-binding protein Mb2593 | 5.52e-12 | NA | 6.58e-15 | 0.8702 |
3. BF | Q0P887 | Tungstate uptake system ATP-binding protein TupC | 2.72e-07 | NA | 3.43e-08 | 0.8278 |
3. BF | Q5Z0P5 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.22e-12 | NA | 3.69e-10 | 0.7769 |
3. BF | P0CL93 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.92e-09 | NA | 8.32e-22 | 0.5291 |
3. BF | O29527 | Putative ABC transporter ATP-binding protein AF_0731 | 1.67e-15 | NA | 2.31e-31 | 0.7415 |
3. BF | Q329I3 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.13e-11 | 0.808 |
3. BF | Q9CP24 | Zinc import ATP-binding protein ZnuC | 2.11e-14 | NA | 5.46e-05 | 0.7327 |
3. BF | P38045 | Nitrate import ATP-binding protein NrtC | 3.87e-07 | NA | 2.80e-23 | 0.7332 |
3. BF | Q28K97 | Taurine import ATP-binding protein TauB | 8.49e-13 | NA | 1.01e-21 | 0.7469 |
3. BF | Q1B8U4 | Aliphatic sulfonates import ATP-binding protein SsuB | 3.68e-11 | NA | 2.51e-21 | 0.7853 |
3. BF | Q73KT5 | Putative ABC transporter ATP-binding protein TDE_2132 | 0.00e+00 | NA | 2.96e-29 | 0.895 |
3. BF | A0KE71 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 8.10e-11 | NA | 8.76e-16 | 0.7315 |
3. BF | P39456 | L-cystine import ATP-binding protein TcyC | 0.00e+00 | NA | 1.16e-18 | 0.8561 |
3. BF | Q579H8 | Methionine import ATP-binding protein MetN | 1.24e-10 | NA | 2.12e-26 | 0.8373 |
3. BF | Q97JB8 | Putative ABC transporter ATP-binding protein CA_C1368 | 0.00e+00 | NA | 6.43e-47 | 0.9298 |
3. BF | Q9S472 | L-arabinose transport ATP-binding protein AraG | 2.56e-06 | NA | 1.71e-11 | 0.8381 |
3. BF | Q88RL5 | Methionine import ATP-binding protein MetN 1 | 7.77e-16 | NA | 1.44e-26 | 0.8335 |
3. BF | Q8K985 | Multidrug resistance-like ATP-binding protein MdlA | 1.16e-09 | NA | 1.58e-13 | 0.5039 |
3. BF | Q5QU36 | ATP-dependent lipid A-core flippase | 6.25e-12 | NA | 1.09e-26 | 0.5302 |
3. BF | Q7W359 | Hemin import ATP-binding protein HmuV | 5.55e-16 | NA | 1.32e-10 | 0.8599 |
3. BF | Q4ZU82 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 5.80e-15 | 0.7954 |
3. BF | A0R8K8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.27e-68 | 0.948 |
3. BF | Q9HT70 | Methionine import ATP-binding protein MetN 2 | 1.44e-15 | NA | 2.49e-24 | 0.8141 |
3. BF | A0KPH6 | Zinc import ATP-binding protein ZnuC | 1.05e-14 | NA | 1.69e-17 | 0.7581 |
3. BF | P63360 | ATP-dependent lipid A-core flippase | 2.41e-11 | NA | 1.59e-20 | 0.5102 |
3. BF | P26760 | Toxin RTX-I translocation ATP-binding protein | 2.26e-09 | NA | 4.20e-27 | 0.5117 |
3. BF | O31707 | Uncharacterized ABC transporter ATP-binding protein YknU | 7.00e-10 | NA | 1.09e-25 | 0.5213 |
3. BF | Q6D2F6 | Fe(3+) ions import ATP-binding protein FbpC 2 | 4.80e-13 | NA | 2.01e-18 | 0.8633 |
3. BF | Q6LQ00 | Putative ABC transporter ATP-binding protein PBPRA2240 | 1.49e-07 | NA | 6.76e-37 | 0.8479 |
3. BF | Q9KGD6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.27e-39 | 0.8662 |
3. BF | P0CE70 | ABC transporter NFT1 | 1.67e-05 | NA | 6.72e-17 | 0.6494 |
3. BF | P0C0E9 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 1.37e-66 | 0.9663 |
3. BF | Q2SI12 | Zinc import ATP-binding protein ZnuC 2 | 8.22e-15 | NA | 2.56e-12 | 0.7865 |
3. BF | Q99T13 | Putative multidrug export ATP-binding/permease protein SAV1866 | 3.32e-12 | NA | 4.40e-22 | 0.5192 |
3. BF | A0KAV6 | Taurine import ATP-binding protein TauB | 6.46e-13 | NA | 6.00e-18 | 0.7568 |
3. BF | Q0TGX4 | Zinc import ATP-binding protein ZnuC | 2.25e-14 | NA | 4.30e-15 | 0.7906 |
3. BF | Q65E84 | Teichoic acids export ATP-binding protein TagH | 1.75e-10 | NA | 4.22e-13 | 0.6366 |
3. BF | Q81PZ8 | Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 | 1.94e-07 | NA | 3.57e-36 | 0.7787 |
3. BF | P11599 | Alpha-hemolysin translocation ATP-binding protein HlyB | 1.73e-09 | NA | 5.59e-23 | 0.5162 |
3. BF | Q8DG84 | Putative ABC transporter ATP-binding protein tll2439 | 0.00e+00 | NA | 3.07e-31 | 0.8882 |
3. BF | Q1CN15 | Autoinducer 2 import ATP-binding protein LsrA | 3.06e-05 | NA | 1.41e-09 | 0.8435 |
3. BF | Q4QPI4 | ATP-dependent lipid A-core flippase | 4.01e-11 | NA | 8.64e-25 | 0.5154 |
3. BF | Q6RCE0 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 2.45e-15 | 0.7929 |
3. BF | Q399M3 | Macrolide export ATP-binding/permease protein MacB | 4.29e-09 | NA | 1.09e-10 | 0.7798 |
3. BF | P39459 | Nitrate transport protein NasD | 3.90e-14 | NA | 1.39e-23 | 0.7603 |
3. BF | Q4A5A5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.72e-82 | 0.9496 |
3. BF | Q1CJG3 | Zinc import ATP-binding protein ZnuC | 1.34e-14 | NA | 3.99e-14 | 0.7923 |
3. BF | Q48PV0 | Zinc import ATP-binding protein ZnuC | 1.83e-14 | NA | 2.05e-12 | 0.7249 |
3. BF | Q5WCL2 | Teichoic acids export ATP-binding protein TagH | 2.21e-09 | NA | 6.44e-11 | 0.6731 |
3. BF | Q04473 | Toxin RTX-III translocation ATP-binding protein | 9.51e-10 | NA | 6.33e-29 | 0.5088 |
3. BF | Q6G868 | Putative multidrug export ATP-binding/permease protein SAS1788 | 9.88e-11 | NA | 4.40e-22 | 0.5158 |
3. BF | Q664P8 | Taurine import ATP-binding protein TauB | 3.14e-13 | NA | 1.17e-19 | 0.7919 |
3. BF | Q1R155 | Zinc import ATP-binding protein ZnuC | 4.44e-15 | NA | 2.18e-15 | 0.8203 |
3. BF | Q11B53 | Zinc import ATP-binding protein ZnuC | 5.41e-10 | NA | 1.14e-12 | 0.7096 |
3. BF | Q8Y454 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.30e-75 | 0.9581 |
3. BF | Q9Z3I3 | Nod factor export ATP-binding protein I | 3.51e-14 | NA | 5.05e-19 | 0.9171 |
3. BF | Q13BH6 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.99e-10 | NA | 5.48e-19 | 0.5046 |
3. BF | Q00564 | Lactococcin-A transport/processing ATP-binding protein LcnC | 3.80e-10 | NA | 1.02e-17 | 0.5217 |
3. BF | Q66EY9 | Autoinducer 2 import ATP-binding protein LsrA | 1.26e-04 | NA | 1.34e-09 | 0.8326 |
3. BF | Q8YDJ8 | Zinc import ATP-binding protein ZnuC | 3.64e-14 | NA | 4.02e-17 | 0.7878 |
3. BF | O34362 | Putative HMP/thiamine import ATP-binding protein YkoD | 4.31e-09 | NA | 3.89e-33 | 0.889 |
3. BF | Q933E0 | Leukotoxin translocation ATP-binding protein LktB | 1.30e-09 | NA | 7.99e-27 | 0.5148 |
3. BF | G4N2B5 | ABC transporter 7 | 4.75e-05 | NA | 9.69e-16 | 0.5462 |
3. BF | Q73F67 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.44e-68 | 0.948 |
3. BF | Q1IEK7 | Phosphonates import ATP-binding protein PhnC | 2.22e-16 | NA | 7.76e-10 | 0.7852 |
3. BF | Q8D2U8 | ATP-dependent lipid A-core flippase | 4.53e-11 | NA | 7.65e-17 | 0.5166 |
3. BF | Q5KYS1 | Xylose import ATP-binding protein XylG | 5.19e-07 | NA | 3.21e-16 | 0.8053 |
3. BF | Q7CIC2 | Zinc import ATP-binding protein ZnuC | 1.20e-14 | NA | 3.99e-14 | 0.791 |
3. BF | Q9JW59 | ATP-dependent lipid A-core flippase | 7.53e-11 | NA | 2.68e-19 | 0.4996 |
3. BF | Q222W0 | Phosphonates import ATP-binding protein PhnC 1 | 5.24e-13 | NA | 8.20e-16 | 0.7305 |
3. BF | Q9X1Z1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 2.22e-16 | NA | 1.40e-39 | 0.8355 |
3. BF | Q4WLN7 | Iron-sulfur clusters transporter atm1, mitochondrial | 2.22e-09 | NA | 9.48e-24 | 0.5023 |
3. BF | Q4A5Q4 | Spermidine/putrescine import ATP-binding protein PotA | 7.06e-06 | NA | 2.14e-12 | 0.6373 |
3. BF | Q3YUN6 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.57e-12 | 0.8137 |
3. BF | Q6LTB1 | Zinc import ATP-binding protein ZnuC | 4.07e-14 | NA | 5.68e-13 | 0.7517 |
3. BF | C0SPB4 | Uncharacterized ABC transporter ATP-binding protein YhaQ | 1.33e-11 | NA | 2.08e-08 | 0.6698 |
3. BF | P59653 | Transport/processing ATP-binding protein ComA | 8.01e-10 | NA | 1.18e-20 | 0.5122 |
3. BF | P42954 | Teichoic acids export ATP-binding protein TagH | 5.37e-08 | NA | 1.57e-12 | 0.632 |
3. BF | Q8TK65 | Putative ABC transporter ATP-binding protein MA_3551 | 0.00e+00 | NA | 2.77e-38 | 0.8934 |
3. BF | P10089 | Alpha-hemolysin translocation ATP-binding protein HlyB | 1.03e-09 | NA | 1.45e-24 | 0.5064 |
3. BF | Q325N3 | Taurine import ATP-binding protein TauB | 2.32e-13 | NA | 2.20e-31 | 0.7998 |
3. BF | Q13RB6 | Xylose import ATP-binding protein XylG | 4.81e-06 | NA | 5.96e-09 | 0.7995 |
3. BF | Q1C2S1 | Taurine import ATP-binding protein TauB | 3.52e-13 | NA | 1.37e-19 | 0.7986 |
3. BF | Q63H62 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.64e-67 | 0.9485 |
3. BF | P71082 | Putative multidrug export ATP-binding/permease protein YgaD | 1.90e-11 | NA | 3.04e-25 | 0.5116 |
3. BF | Q576E0 | Putative ATP-binding protein BruAb2_1123 | 1.29e-12 | NA | 4.24e-18 | 0.7692 |
3. BF | Q3J7R8 | ATP-dependent lipid A-core flippase | 2.06e-10 | NA | 3.44e-20 | 0.5053 |
3. BF | Q9X2W0 | Microcin-J25 export ATP-binding/permease protein McjD | 3.76e-11 | NA | 6.47e-13 | 0.4994 |
3. BF | Q8U4K3 | Molybdate/tungstate import ATP-binding protein WtpC | 9.18e-14 | NA | 6.26e-22 | 0.8636 |
3. BF | Q03203 | Nisin transport ATP-binding protein NisT | 2.73e-09 | NA | 2.56e-12 | 0.5089 |
3. BF | Q736E0 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.60e-11 | NA | 1.83e-21 | 0.7542 |
3. BF | Q89A96 | Multidrug resistance-like ATP-binding protein MdlB | 2.40e-11 | NA | 3.05e-18 | 0.5151 |
3. BF | Q8PZN0 | Putative ABC transporter ATP-binding protein MM_0462 | 0.00e+00 | NA | 1.55e-39 | 0.8864 |
3. BF | Q5L3R0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.67e-78 | 0.9596 |
3. BF | P23174 | Phosphatidylcholine translocator ABCB4 | 1.52e-06 | NA | 3.21e-19 | 0.5165 |
3. BF | Q2FER8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | 0.8769 |
3. BF | Q83D84 | ATP-dependent lipid A-core flippase | 4.37e-11 | NA | 3.87e-21 | 0.521 |
3. BF | Q93FH2 | Leukotoxin translocation ATP-binding protein LktB | 1.39e-09 | NA | 6.89e-27 | 0.5139 |
3. BF | P0A9X2 | Zinc import ATP-binding protein ZnuC | 2.11e-15 | NA | 4.30e-15 | 0.792 |
3. BF | Q1MEG2 | Zinc import ATP-binding protein ZnuC | 1.02e-13 | NA | 3.64e-14 | 0.7885 |
3. BF | Q88XV2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 7.55e-66 | 0.9434 |
3. BF | Q8TSC8 | Putative ABC transporter ATP-binding protein MA_0870 | 2.33e-08 | NA | 1.79e-33 | 0.8831 |
3. BF | Q5H0H0 | ATP-dependent lipid A-core flippase | 7.01e-12 | NA | 5.33e-23 | 0.5106 |
3. BF | Q0VQP5 | ATP-dependent lipid A-core flippase | 1.32e-11 | NA | 7.23e-23 | 0.525 |
3. BF | Q2NTI7 | Zinc import ATP-binding protein ZnuC | 4.10e-14 | NA | 6.15e-09 | 0.7862 |
3. BF | Q2KYS6 | ATP-dependent lipid A-core flippase | 2.84e-11 | NA | 1.16e-25 | 0.5244 |
3. BF | O30506 | Arginine/ornithine transport ATP-binding protein AotP | 0.00e+00 | NA | 1.36e-11 | 0.8673 |
3. BF | Q13LC4 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 3.48e-15 | 0.7289 |
3. BF | Q5M243 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 9.65e-71 | 0.9633 |
3. BF | Q3ABN1 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 3.55e-51 | 0.8942 |
3. BF | Q8NR42 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.47e-13 | NA | 2.98e-20 | 0.8093 |
3. BF | Q4PH16 | Iron-sulfur clusters transporter ATM1, mitochondrial | 2.46e-09 | NA | 3.81e-19 | 0.5271 |
3. BF | Q60AA3 | ATP-dependent lipid A-core flippase | 1.60e-10 | NA | 8.22e-25 | 0.5259 |
3. BF | Q50294 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.63e-87 | 0.9331 |
3. BF | D4GP39 | Xylose/arabinose import ATP-binding protein XacK | 2.42e-13 | NA | 1.13e-23 | 0.8929 |
3. BF | P21410 | Fe(3+) ions import ATP-binding protein FbpC | 6.23e-10 | NA | 6.97e-19 | 0.8801 |
3. BF | Q1RGL1 | Zinc import ATP-binding protein ZnuC | 7.50e-10 | NA | 1.74e-18 | 0.8119 |
3. BF | Q0K2U3 | Taurine import ATP-binding protein TauB | 5.79e-13 | NA | 1.29e-23 | 0.7734 |
3. BF | Q9HNI8 | Phosphonates import ATP-binding protein PhnC | 5.55e-15 | NA | 8.23e-14 | 0.7553 |
3. BF | P73265 | Nitrate import ATP-binding protein NrtD | 9.42e-13 | NA | 2.74e-21 | 0.7554 |
3. BF | Q4QND5 | Zinc import ATP-binding protein ZnuC | 3.26e-14 | NA | 3.03e-07 | 0.7203 |
3. BF | Q1BPZ6 | Macrolide export ATP-binding/permease protein MacB | 5.79e-13 | NA | 3.40e-11 | 0.7701 |
3. BF | Q7MJ07 | ATP-dependent lipid A-core flippase | 7.35e-12 | NA | 3.92e-26 | 0.5077 |
3. BF | Q63JZ3 | Taurine import ATP-binding protein TauB | 8.97e-13 | NA | 1.77e-14 | 0.7714 |
3. BF | Q8TYV9 | Putative ABC transporter ATP-binding protein MK0182 | 0.00e+00 | NA | 5.88e-35 | 0.9164 |
3. BF | Q87UN4 | Methionine import ATP-binding protein MetN 2 | 1.11e-15 | NA | 3.54e-25 | 0.8126 |
3. BF | P57403 | Zinc import ATP-binding protein ZnuC | 2.66e-15 | NA | 1.40e-08 | 0.7827 |
3. BF | Q1BWN5 | Ribose import ATP-binding protein RbsA 1 | 1.19e-05 | NA | 5.14e-11 | 0.7933 |
3. BF | Q32E34 | ATP-dependent lipid A-core flippase | 4.11e-11 | NA | 4.89e-21 | 0.5155 |
3. BF | Q57R14 | ATP-dependent lipid A-core flippase | 1.79e-11 | NA | 1.59e-20 | 0.5131 |
3. BF | A1VYW8 | Macrolide export ATP-binding/permease protein MacB | 1.13e-08 | NA | 1.26e-11 | 0.7371 |
3. BF | Q0TJD9 | ATP-dependent lipid A-core flippase | 8.94e-10 | NA | 4.71e-21 | 0.5117 |
3. BF | Q87G35 | Putative ABC transporter ATP-binding protein VPA1482 | 8.75e-08 | NA | 3.99e-35 | 0.8479 |
3. BF | Q6FWS5 | Pleiotropic ABC efflux transporter of multiple drugs YBT1 | 2.70e-05 | NA | 3.46e-22 | 0.5779 |
3. BF | Q0PAB6 | Methionine import ATP-binding protein MetN | 1.26e-12 | NA | 2.56e-29 | 0.7875 |
3. BF | Q89UT8 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.32e-11 | NA | 5.15e-19 | 0.5196 |
3. BF | Q52402 | Transport ATP-binding protein AarD | 3.27e-09 | NA | 2.23e-11 | 0.4972 |
3. BF | P70864 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 3.51e-11 | NA | 2.30e-21 | 0.5108 |
3. BF | B0R5G4 | Cobalamin import ATP-binding protein BtuD | 8.14e-10 | NA | 2.57e-09 | 0.8777 |
3. BF | Q07698 | ABC transporter protein AbcA | 2.58e-09 | NA | 1.83e-14 | 0.6573 |
3. BF | P0AAF8 | Arginine transport ATP-binding protein ArtP | 0.00e+00 | NA | 3.62e-21 | 0.8911 |
3. BF | Q81K31 | Teichoic acids export ATP-binding protein TagH | 1.54e-07 | NA | 5.17e-11 | 0.5892 |
3. BF | Q9HX79 | Taurine import ATP-binding protein TauB | 6.14e-13 | NA | 3.47e-19 | 0.7903 |
3. BF | Q8E2L2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.69e-69 | 0.9617 |
3. BF | Q3KC21 | Molybdenum import ATP-binding protein ModC | 6.81e-12 | NA | 2.57e-16 | 0.8374 |
3. BF | Q63GR8 | Methionine import ATP-binding protein MetN 2 | 1.11e-15 | NA | 1.25e-27 | 0.8292 |
3. BF | Q7W025 | Hemin import ATP-binding protein HmuV | 4.44e-16 | NA | 1.32e-10 | 0.861 |
3. BF | Q2SIN5 | ATP-dependent lipid A-core flippase | 9.49e-12 | NA | 1.45e-25 | 0.524 |
3. BF | Q02QT6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 1.54e-09 | NA | 5.69e-13 | 0.8145 |
3. BF | Q92UX0 | Taurine import ATP-binding protein TauB | 1.28e-11 | NA | 4.59e-18 | 0.7384 |
3. BF | A2RH11 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | 0.9657 |
3. BF | Q21PQ7 | Zinc import ATP-binding protein ZnuC | 6.37e-10 | NA | 6.63e-16 | 0.7228 |
3. BF | Q2NK31 | Spermidine/putrescine import ATP-binding protein PotA | 6.41e-09 | NA | 1.80e-11 | 0.6641 |
3. BF | Q6HPM9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.17e-39 | 0.8912 |
3. BF | Q8L1U3 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 1.27e-12 | 0.8371 |
3. BF | Q6NBX6 | Phosphonates import ATP-binding protein PhnC 1 | 6.66e-16 | NA | 1.78e-14 | 0.7828 |
3. BF | Q92V71 | Phosphonates import ATP-binding protein PhnC | 1.25e-13 | NA | 8.80e-15 | 0.7681 |
3. BF | Q8FV85 | Methionine import ATP-binding protein MetN | 1.54e-10 | NA | 2.12e-26 | 0.8263 |
3. BF | B8K1W2 | Bile salt export pump | 1.58e-06 | NA | 1.89e-16 | 0.5202 |
3. BF | Q46Y89 | ATP-dependent lipid A-core flippase | 4.45e-11 | NA | 4.26e-24 | 0.5319 |
3. BF | Q92MP8 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 5.93e-06 | NA | 4.98e-08 | 0.8129 |
3. BF | Q0P9C4 | Protein glycosylation K | 1.46e-10 | NA | 5.03e-24 | 0.5051 |
3. BF | Q6BXD7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.66e-09 | NA | 6.76e-23 | 0.5155 |
3. BF | A0LCH8 | Zinc import ATP-binding protein ZnuC | 1.33e-15 | NA | 3.53e-15 | 0.7752 |
3. BF | Q31VE7 | Nickel import ATP-binding protein NikD | 6.03e-12 | NA | 7.51e-14 | 0.8024 |
3. BF | P45031 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 0.00e+00 | NA | 2.81e-16 | 0.8356 |
3. BF | A0K718 | Ribose import ATP-binding protein RbsA 1 | 1.08e-05 | NA | 5.14e-11 | 0.7905 |
3. BF | Q82CD3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.70e-12 | NA | 3.65e-17 | 0.7634 |
3. BF | Q1WSB8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.72e-79 | 0.964 |
3. BF | Q9JXR3 | ATP-dependent lipid A-core flippase | 1.48e-10 | NA | 7.98e-21 | 0.5091 |
3. BF | Q1QBW0 | ATP-dependent lipid A-core flippase | 7.56e-12 | NA | 8.93e-20 | 0.5017 |
3. BF | Q492S9 | ATP-dependent lipid A-core flippase | 1.33e-11 | NA | 1.22e-19 | 0.4975 |
3. BF | Q9ZNB0 | Uncharacterized ABC transporter ATP-binding protein SCO0742 | 2.90e-11 | NA | 6.86e-16 | 0.5344 |
3. BF | A0B212 | Macrolide export ATP-binding/permease protein MacB | 7.89e-10 | NA | 3.55e-11 | 0.7698 |
3. BF | Q9K7C3 | L-arabinose transport ATP-binding protein AraG | 3.54e-06 | NA | 7.35e-11 | 0.8298 |
3. BF | Q18CJ0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 4.99e-62 | 0.9428 |
3. BF | Q6N798 | Methionine import ATP-binding protein MetN 2 | 3.25e-14 | NA | 6.64e-28 | 0.8284 |
3. BF | Q2LVL0 | ATP-dependent lipid A-core flippase | 1.84e-10 | NA | 6.67e-23 | 0.5252 |
3. BF | Q1GL85 | Zinc import ATP-binding protein ZnuC | 4.82e-14 | NA | 9.00e-17 | 0.7739 |
3. BF | Q8D3Z9 | Putative ABC transporter ATP-binding protein VV2_1533 | 3.12e-08 | NA | 1.04e-34 | 0.9253 |
3. BF | Q81LM1 | Petrobactin import ATP-binding protein FpuC | 5.33e-15 | NA | 5.70e-19 | 0.8518 |
3. BF | Q166X0 | Phosphonates import ATP-binding protein PhnC 2 | 5.77e-13 | NA | 1.91e-12 | 0.794 |
3. BF | Q3IWB5 | Zinc import ATP-binding protein ZnuC | 1.07e-14 | NA | 5.67e-20 | 0.7949 |
3. BF | Q2FNX9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 7.57e-43 | 0.9285 |
3. BF | Q89A97 | Multidrug resistance-like ATP-binding protein MdlA | 7.26e-11 | NA | 6.72e-15 | 0.4874 |
3. BF | Q5X627 | Spermidine/putrescine import ATP-binding protein PotA | 2.75e-11 | NA | 2.37e-27 | 0.8855 |
3. BF | Q9Z9J3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.52e-53 | 0.9447 |
3. BF | Q6RH47 | Taurine import ATP-binding protein TauB | 1.57e-12 | NA | 2.65e-16 | 0.7634 |
3. BF | O34338 | Manganese transport system ATP-binding protein MntB | 7.47e-14 | NA | 1.84e-18 | 0.8403 |
3. BF | Q7MFH3 | Putative ABC transporter ATP-binding protein VVA0347 | 2.88e-08 | NA | 2.56e-34 | 0.926 |
3. BF | Q1QX69 | ATP-dependent lipid A-core flippase | 4.74e-11 | NA | 1.28e-17 | 0.5133 |
3. BF | Q2P3E7 | ATP-dependent lipid A-core flippase | 2.60e-11 | NA | 5.33e-23 | 0.514 |
3. BF | Q5WXF0 | Spermidine/putrescine import ATP-binding protein PotA | 9.85e-12 | NA | 3.86e-26 | 0.8889 |
3. BF | P71355 | Uncharacterized ABC transporter ATP-binding protein HI_0663 | 1.57e-09 | NA | 7.51e-17 | 0.5036 |
3. BF | Q4ZZ16 | ATP-dependent lipid A-core flippase | 1.05e-11 | NA | 5.32e-19 | 0.5113 |
3. BF | Q7VWD8 | ATP-dependent lipid A-core flippase | 5.03e-10 | NA | 5.20e-21 | 0.532 |
3. BF | A8AHA1 | Vitamin B12 import ATP-binding protein BtuD | 1.06e-13 | NA | 9.26e-05 | 0.7761 |
3. BF | Q1BT84 | Taurine import ATP-binding protein TauB | 5.74e-13 | NA | 6.00e-18 | 0.7575 |
3. BF | Q7A0J1 | Putative multidrug export ATP-binding/permease protein MW1806 | 3.04e-12 | NA | 4.40e-22 | 0.5161 |
3. BF | Q93FH0 | Leukotoxin translocation ATP-binding protein LktB | 1.64e-09 | NA | 8.07e-27 | 0.5144 |
3. BF | Q0K1N8 | Phosphonates import ATP-binding protein PhnC 2 | 2.89e-15 | NA | 6.88e-20 | 0.7428 |
3. BF | Q83LP0 | ATP-dependent lipid A-core flippase | 1.22e-10 | NA | 4.54e-21 | 0.5128 |
3. BF | Q0SZJ4 | Nickel import ATP-binding protein NikD | 2.44e-15 | NA | 6.70e-14 | 0.7802 |
3. BF | Q4K441 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 7.14e-12 | NA | 2.85e-17 | 0.8582 |
3. BF | Q4UV65 | ATP-dependent lipid A-core flippase | 1.08e-11 | NA | 1.99e-22 | 0.5205 |
3. BF | Q5HVG3 | Macrolide export ATP-binding/permease protein MacB | 1.08e-08 | NA | 8.50e-12 | 0.7369 |
3. BF | Q6HPN0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 8.27e-68 | 0.949 |
3. BF | Q87EF0 | ATP-dependent lipid A-core flippase | 1.50e-11 | NA | 5.20e-21 | 0.5065 |
3. BF | Q0I4C5 | ATP-dependent lipid A-core flippase | 1.91e-11 | NA | 9.71e-24 | 0.5204 |
3. BF | Q6FIK3 | Iron-sulfur clusters transporter ATM1, mitochondrial | 6.43e-09 | NA | 2.30e-23 | 0.5132 |
3. BF | Q7NN36 | Hemin import ATP-binding protein HmuV | 5.55e-16 | NA | 1.06e-09 | 0.8094 |
3. BF | Q18C09 | Methionine import ATP-binding protein MetN | 1.22e-15 | NA | 6.29e-27 | 0.9028 |
3. BF | Q9K8N1 | Phosphonates import ATP-binding protein PhnC 3 | 1.11e-16 | NA | 2.67e-17 | 0.8531 |
3. BF | A0RFA4 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.75e-11 | NA | 6.70e-22 | 0.7575 |
3. BF | Q7ULB5 | Macrolide export ATP-binding/permease protein MacB | 8.47e-08 | NA | 1.70e-13 | 0.742 |
3. BF | Q665B6 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.69e-10 | NA | 3.45e-18 | 0.7514 |
3. BF | Q8XK20 | Putative ABC transporter ATP-binding protein CPE1583 | 1.72e-07 | NA | 4.07e-35 | 0.848 |
3. BF | Q8YQ88 | Putative ABC transporter ATP-binding protein alr3946 | 0.00e+00 | NA | 1.44e-30 | 0.8663 |
3. BF | Q88RB3 | Methionine import ATP-binding protein MetN 2 | 4.14e-13 | NA | 3.46e-17 | 0.8384 |
3. BF | Q7A4T3 | Putative multidrug export ATP-binding/permease protein SA1683 | 3.26e-12 | NA | 4.40e-22 | 0.5208 |
3. BF | O06967 | Multidrug resistance ABC transporter ATP-binding/permease protein BmrA | 1.80e-10 | NA | 1.15e-21 | 0.5317 |
3. BF | Q93FG6 | Leukotoxin translocation ATP-binding protein LktB | 8.62e-11 | NA | 7.42e-27 | 0.5144 |
3. BF | Q32HA3 | Zinc import ATP-binding protein ZnuC | 1.10e-14 | NA | 3.41e-15 | 0.7924 |
3. BF | P75059 | Spermidine/putrescine import ATP-binding protein PotA | 1.40e-05 | NA | 4.69e-12 | 0.5119 |
3. BF | Q39GY8 | Ribose import ATP-binding protein RbsA 1 | 1.78e-05 | NA | 1.05e-10 | 0.7788 |
3. BF | Q65U21 | ATP-dependent lipid A-core flippase | 1.82e-11 | NA | 1.78e-22 | 0.5205 |
3. BF | Q81N53 | Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 | 3.33e-07 | NA | 2.10e-25 | 0.7997 |
3. BF | Q21BF6 | Molybdenum import ATP-binding protein ModC | 2.04e-07 | NA | 3.82e-13 | 0.7686 |
3. BF | Q4ZZS2 | Zinc import ATP-binding protein ZnuC | 1.49e-14 | NA | 9.06e-14 | 0.7313 |
3. BF | Q02DK9 | Zinc import ATP-binding protein ZnuC | 1.93e-14 | NA | 1.52e-15 | 0.7211 |
4. PB | A0K739 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 7.27e-09 | 1.64e-09 | 1.31e-14 | NA |
4. PB | Q8XZ72 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 9.18e-06 | 1.50e-17 | NA |
4. PB | Q9AML4 | Phosphate import ATP-binding protein PstB | 4.95e-14 | 3.47e-04 | 3.67e-17 | NA |
4. PB | Q8G358 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.43e-11 | 1.93e-04 | 4.10e-08 | NA |
4. PB | P42360 | Manganese import ATP-binding protein ScaC | 1.83e-13 | 2.98e-02 | 5.50e-11 | NA |
4. PB | Q6LU82 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.43e-07 | 1.36e-19 | NA |
4. PB | Q6LY93 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.57e-06 | 6.19e-24 | NA |
4. PB | Q48HD9 | Phosphate import ATP-binding protein PstB 1 | 9.57e-14 | 2.37e-05 | 6.12e-17 | NA |
4. PB | Q3ATY5 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | 7.63e-03 | 1.31e-14 | NA |
4. PB | P0A9T9 | Uncharacterized ABC transporter ATP-binding protein YbbA | 0.00e+00 | 8.95e-03 | 1.83e-18 | NA |
4. PB | Q834B4 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 7.70e-03 | 3.35e-25 | NA |
4. PB | Q8EG82 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 2.79e-05 | 1.42e-22 | NA |
4. PB | P0AAH3 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q46BM0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.08e-05 | 1.57e-19 | NA |
4. PB | Q97Q34 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 8.78e-05 | 1.08e-18 | NA |
4. PB | Q11DN5 | Phosphate import ATP-binding protein PstB | 2.31e-12 | 6.24e-08 | 1.90e-15 | NA |
4. PB | Q729H7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.44e-04 | 2.22e-11 | NA |
4. PB | Q47YG8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.70e-03 | 2.60e-13 | NA |
4. PB | Q668T8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.55e-14 | 1.69e-03 | 1.52e-07 | NA |
4. PB | Q74KF8 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.40e-03 | 5.36e-17 | NA |
4. PB | Q4JXC5 | Phosphate import ATP-binding protein PstB | 2.89e-15 | 4.12e-03 | 2.31e-09 | NA |
4. PB | Q8RCU0 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 2.98e-05 | 4.10e-17 | NA |
4. PB | Q3YVL7 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q82VR4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.38e-04 | 5.47e-20 | NA |
4. PB | Q89KN0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 9.08e-06 | 4.42e-12 | NA |
4. PB | Q9CNJ7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.07e-05 | 2.30e-18 | NA |
4. PB | Q92QN0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.10e-04 | 1.29e-10 | NA |
4. PB | Q48TC2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q10YP7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 5.80e-05 | 1.38e-17 | NA |
4. PB | Q65V02 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.69e-13 | 6.32e-03 | 4.88e-06 | NA |
4. PB | Q99RR8 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 3.80e-02 | 7.71e-10 | NA |
4. PB | Q4FLF6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.20e-04 | 8.36e-17 | NA |
4. PB | Q73HX8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.81e-14 | 1.98e-02 | 0.002 | NA |
4. PB | Q7MNI7 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.15e-05 | 7.52e-22 | NA |
4. PB | Q7VZ66 | Phosphate import ATP-binding protein PstB | 4.44e-16 | 7.68e-06 | 1.40e-17 | NA |
4. PB | Q1JLH6 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q8YEM5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.56e-11 | 1.53e-04 | 5.09e-08 | NA |
4. PB | Q5FT15 | Phosphate import ATP-binding protein PstB | 8.62e-14 | 1.54e-05 | 7.22e-18 | NA |
4. PB | Q6G4T6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.65e-04 | 3.44e-14 | NA |
4. PB | Q2JTU3 | Phosphate import ATP-binding protein PstB 2 | 7.86e-14 | 1.10e-03 | 3.87e-15 | NA |
4. PB | Q9PQU3 | Phosphate import ATP-binding protein PstB | 8.57e-10 | 9.72e-25 | 7.19e-20 | NA |
4. PB | Q50293 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | 6.63e-04 | 1.95e-37 | NA |
4. PB | Q8FCM9 | Nickel import ATP-binding protein NikE | 3.55e-15 | 1.70e-03 | 8.51e-19 | NA |
4. PB | Q2YNU0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.10e-11 | 1.93e-04 | 4.10e-08 | NA |
4. PB | Q55791 | Probable ATP-dependent transporter slr0075 | 4.90e-13 | 4.35e-02 | 5.04e-07 | NA |
4. PB | Q8DGZ3 | Phosphate import ATP-binding protein PstB | 2.08e-13 | 7.11e-06 | 3.23e-21 | NA |
4. PB | Q3SVB5 | Phosphate import ATP-binding protein PstB | 2.12e-14 | 6.63e-07 | 5.10e-19 | NA |
4. PB | Q20WP4 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.55e-07 | 1.01e-17 | NA |
4. PB | Q3J8J2 | Phosphate import ATP-binding protein PstB 2 | 1.60e-11 | 1.00e-07 | 1.57e-17 | NA |
4. PB | Q6G0L7 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.14e-04 | 6.20e-14 | NA |
4. PB | Q730R7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.35e-05 | 1.16e-21 | NA |
4. PB | P9WQK0 | Uncharacterized ABC transporter ATP-binding protein MT1014 | 0.00e+00 | 4.58e-02 | 8.32e-21 | NA |
4. PB | Q6HFB5 | Phosphonates import ATP-binding protein PhnC | 6.66e-16 | 2.80e-02 | 8.33e-12 | NA |
4. PB | Q62L74 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 3.38e-09 | 1.89e-18 | NA |
4. PB | P57032 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.18e-03 | 1.16e-15 | NA |
4. PB | Q2FVR1 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | Q6XYT0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.15e-05 | 6.59e-19 | NA |
4. PB | Q5HVF4 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.38e-03 | 1.90e-19 | NA |
4. PB | Q7VR29 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.47e-02 | 2.77e-10 | NA |
4. PB | Q0S736 | Phosphate import ATP-binding protein PstB | 2.44e-15 | 2.72e-02 | 9.54e-11 | NA |
4. PB | Q1C6Q8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.77e-02 | 3.05e-16 | NA |
4. PB | Q5M4F3 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.38e-04 | 7.55e-20 | NA |
4. PB | P56344 | Probable sulfate/thiosulfate import ATP-binding protein CysA | 0.00e+00 | 1.56e-02 | 5.15e-26 | NA |
4. PB | Q60AB3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.24e-14 | 1.42e-02 | 1.44e-07 | NA |
4. PB | Q5P1F3 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.21e-10 | 1.63e-21 | NA |
4. PB | Q9K8L5 | Phosphate import ATP-binding protein PstB | 6.11e-15 | 4.37e-08 | 3.55e-22 | NA |
4. PB | Q8DU23 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.97e-04 | 1.45e-20 | NA |
4. PB | Q2RWU0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.75e-04 | 1.23e-18 | NA |
4. PB | Q9HML8 | Phosphate import ATP-binding protein PstB 2 | 3.80e-09 | 9.09e-12 | 1.38e-17 | NA |
4. PB | P63362 | Phosphate import ATP-binding protein PstB | 1.27e-12 | 7.99e-07 | 9.91e-15 | NA |
4. PB | Q5PKW4 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.12e-05 | 1.44e-16 | NA |
4. PB | P0A9V4 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 1.44e-02 | 8.06e-12 | NA |
4. PB | Q1LPJ9 | Lipoprotein-releasing system ATP-binding protein LolD | 2.69e-13 | 2.83e-09 | 1.27e-15 | NA |
4. PB | P69881 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q8YYE3 | Phosphate import ATP-binding protein PstB 1 | 1.11e-16 | 1.23e-03 | 2.89e-17 | NA |
4. PB | Q0VQQ0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 9.47e-03 | 9.48e-21 | NA |
4. PB | Q3K4F5 | Phosphate import ATP-binding protein PstB | 2.96e-11 | 3.38e-07 | 4.00e-24 | NA |
4. PB | Q5HPF5 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 4.18e-13 | 5.82e-19 | NA |
4. PB | Q0TIV6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.42e-02 | 6.53e-18 | NA |
4. PB | Q1D382 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.89e-02 | 3.72e-14 | NA |
4. PB | Q2G2L1 | Teichoic acids export ATP-binding protein TagH | 2.61e-10 | 5.13e-03 | 3.20e-08 | NA |
4. PB | P75612 | Putative ABC transporter ATP-binding protein MG065 homolog | 5.21e-10 | 3.07e-05 | 1.24e-12 | NA |
4. PB | Q87U31 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 1.34e-04 | 4.15e-19 | NA |
4. PB | Q8FIM7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.42e-02 | 6.53e-18 | NA |
4. PB | Q1JGL2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q83J77 | Nickel import ATP-binding protein NikE | 4.88e-15 | 1.40e-03 | 1.83e-16 | NA |
4. PB | P05529 | Protein McbF | 1.13e-09 | 8.44e-04 | 1.06e-04 | NA |
4. PB | Q0SVB6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.35e-06 | 9.08e-21 | NA |
4. PB | Q5LZU3 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.38e-04 | 7.55e-20 | NA |
4. PB | O84421 | Probable metal transport system ATP-binding protein CT_416 | 2.33e-15 | 1.78e-02 | 1.08e-10 | NA |
4. PB | P0AAH1 | Phosphate import ATP-binding protein PstB | 1.14e-13 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q47A37 | Phosphate import ATP-binding protein PstB | 6.92e-14 | 1.76e-05 | 5.74e-21 | NA |
4. PB | Q48KI4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.94e-04 | 6.42e-20 | NA |
4. PB | Q0BFQ0 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.33e-08 | 2.56e-08 | 1.12e-14 | NA |
4. PB | Q39HM4 | Phosphate import ATP-binding protein PstB | 4.44e-16 | 1.08e-10 | 2.56e-18 | NA |
4. PB | Q5XBY6 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q31BF6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.22e-03 | 1.51e-18 | NA |
4. PB | P31548 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 9.21e-03 | 6.21e-21 | NA |
4. PB | Q0A8P9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.68e-04 | 5.97e-19 | NA |
4. PB | P9WQK8 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 6.21e-06 | 5.78e-15 | NA |
4. PB | Q7NTU0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.96e-02 | 1.10e-18 | NA |
4. PB | Q7UP21 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 6.32e-08 | 4.90e-17 | NA |
4. PB | P0AAG3 | Glutamate/aspartate import ATP-binding protein GltL | 0.00e+00 | 2.00e-02 | 1.35e-23 | NA |
4. PB | Q8U8D6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 6.45e-12 | 5.07e-06 | 7.68e-14 | NA |
4. PB | Q166A0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.19e-06 | 1.93e-15 | NA |
4. PB | Q818I7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.17e-05 | 7.09e-21 | NA |
4. PB | Q2W8B4 | Phosphate import ATP-binding protein PstB 1 | 1.11e-16 | 1.19e-04 | 3.48e-17 | NA |
4. PB | Q5FFC0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.10e-02 | 7.66e-10 | NA |
4. PB | Q5E4D8 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 4.70e-04 | 4.12e-21 | NA |
4. PB | Q57554 | Uncharacterized ABC transporter ATP-binding protein MJ0089 | 1.11e-16 | 9.90e-04 | 6.71e-13 | NA |
4. PB | Q3J7S3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.83e-03 | 7.11e-20 | NA |
4. PB | Q71WT2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.98e-05 | 6.78e-17 | NA |
4. PB | Q8PAG0 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.32e-07 | 1.55e-16 | NA |
4. PB | Q8ELT4 | Phosphate import ATP-binding protein PstB | 7.59e-14 | 5.62e-07 | 7.50e-23 | NA |
4. PB | Q080S4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.06e-03 | 4.13e-11 | NA |
4. PB | Q7U0Z9 | Phosphate import ATP-binding protein PstB 2 | 1.05e-14 | 6.21e-06 | 5.78e-15 | NA |
4. PB | Q7N3A6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.22e-02 | 7.79e-18 | NA |
4. PB | P9WQL1 | Phosphate import ATP-binding protein PstB 1 | 2.00e-15 | 2.68e-02 | 9.71e-12 | NA |
4. PB | Q0TTG6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.35e-06 | 9.08e-21 | NA |
4. PB | Q7VZ31 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.65e-04 | 6.55e-15 | NA |
4. PB | P0CAT6 | Phosphate import ATP-binding protein PstB | 2.25e-13 | 2.39e-07 | 1.50e-14 | NA |
4. PB | Q3JSR6 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.62e-07 | 5.89e-07 | 1.23e-14 | NA |
4. PB | Q5WUF8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 9.45e-05 | 5.35e-17 | NA |
4. PB | Q8EUJ1 | Phosphate import ATP-binding protein PstB | 3.22e-13 | 2.66e-11 | 5.37e-20 | NA |
4. PB | Q6LQC0 | Hemin import ATP-binding protein HmuV | 6.88e-15 | 1.91e-04 | 9.73e-11 | NA |
4. PB | Q57HY8 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.04e-04 | 3.28e-17 | NA |
4. PB | Q9HZL7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.27e-03 | 5.65e-21 | NA |
4. PB | Q6LSC4 | Phosphate import ATP-binding protein PstB 2 | 3.49e-14 | 2.49e-04 | 2.24e-22 | NA |
4. PB | Q8YNJ3 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 1.74e-04 | 1.60e-15 | NA |
4. PB | P0AAH9 | Peptide transport system ATP-binding protein SapF | 0.00e+00 | 5.76e-04 | 9.85e-19 | NA |
4. PB | Q88YK8 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 4.09e-06 | 1.45e-22 | NA |
4. PB | Q55740 | Putative ABC transporter ATP-binding protein sll0385 | 1.11e-16 | 6.21e-15 | 3.03e-38 | NA |
4. PB | P47426 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | 3.51e-02 | 9.27e-42 | NA |
4. PB | Q8TUR7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.14e-05 | 7.09e-21 | NA |
4. PB | Q1GAD3 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.86e-05 | 3.69e-21 | NA |
4. PB | P63364 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.08e-04 | 1.91e-19 | NA |
4. PB | O32487 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.02e-04 | 4.20e-15 | NA |
4. PB | Q221H2 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 5.65e-04 | 1.59e-16 | NA |
4. PB | Q3BV68 | Phosphate import ATP-binding protein PstB | 2.62e-14 | 1.66e-06 | 2.81e-16 | NA |
4. PB | Q9HMZ4 | Putative ABC transporter ATP-binding protein VNG_2317G | 0.00e+00 | 5.43e-07 | 4.74e-32 | NA |
4. PB | Q2KVN7 | Phosphate import ATP-binding protein PstB | 1.58e-13 | 9.50e-06 | 7.35e-18 | NA |
4. PB | Q5X2Z8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.72e-04 | 1.17e-15 | NA |
4. PB | P0A9R7 | Cell division ATP-binding protein FtsE | 0.00e+00 | 3.78e-03 | 5.73e-13 | NA |
4. PB | P47311 | Putative ABC transporter ATP-binding protein MG065 | 3.43e-09 | 7.90e-07 | 3.99e-15 | NA |
4. PB | Q2FW34 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 1.12e-02 | 1.50e-65 | NA |
4. PB | Q473H8 | Lipoprotein-releasing system ATP-binding protein LolD | 1.11e-16 | 5.32e-08 | 3.26e-16 | NA |
4. PB | Q49588 | Phosphate import ATP-binding protein PstB | 4.33e-15 | 3.78e-06 | 7.75e-18 | NA |
4. PB | Q9YG51 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.41e-05 | 2.14e-19 | NA |
4. PB | D5AQY6 | Nickel import ATP-binding protein NikO | 0.00e+00 | 8.79e-03 | 5.82e-29 | NA |
4. PB | Q7A3X3 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 3.80e-02 | 7.71e-10 | NA |
4. PB | P75370 | Probable ABC transporter ATP-binding protein p29 | 3.33e-16 | 3.73e-05 | 1.87e-15 | NA |
4. PB | A5U7B7 | Cell division ATP-binding protein FtsE | 0.00e+00 | 3.13e-04 | 4.79e-26 | NA |
4. PB | Q8Y0C6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.84e-05 | 1.10e-14 | NA |
4. PB | P0A2V3 | Octopine permease ATP-binding protein P | 0.00e+00 | 2.11e-02 | 1.83e-18 | NA |
4. PB | Q9I3N7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.63e-13 | 9.21e-03 | 1.26e-07 | NA |
4. PB | P57066 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 9.65e-03 | 1.67e-17 | NA |
4. PB | P80866 | Vegetative protein 296 | 1.70e-12 | 2.27e-02 | 6.41e-05 | NA |
4. PB | Q8LEF6 | ABC transporter I family member 11, chloroplastic | 1.04e-13 | 1.16e-08 | 3.00e-13 | NA |
4. PB | Q5V225 | Phosphate import ATP-binding protein PstB 1 | 1.10e-12 | 3.38e-12 | 1.24e-18 | NA |
4. PB | Q1QX72 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.47e-04 | 6.27e-16 | NA |
4. PB | Q634R8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.35e-05 | 1.16e-21 | NA |
4. PB | Q46RX0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.82e-10 | 1.26e-02 | 2.41e-04 | NA |
4. PB | Q8ZD58 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.25e-14 | 1.32e-03 | 2.22e-07 | NA |
4. PB | Q4ZLA7 | Phosphate import ATP-binding protein PstB 2 | 2.22e-16 | 1.26e-06 | 6.14e-23 | NA |
4. PB | P9WQL0 | Phosphate import ATP-binding protein PstB 1 | 2.11e-15 | 2.68e-02 | 9.71e-12 | NA |
4. PB | Q58664 | Probable branched-chain amino acid transport ATP-binding protein LivF | 0.00e+00 | 8.62e-03 | 4.66e-12 | NA |
4. PB | Q6G529 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.02e-11 | 2.56e-02 | 4.68e-05 | NA |
4. PB | Q8GDV4 | Phosphate import ATP-binding protein PstB (Fragment) | 0.00e+00 | 8.50e-05 | 6.18e-19 | NA |
4. PB | Q9ZB70 | Putative ABC transporter ATP-binding protein MG468.1 | 1.54e-10 | 4.31e-11 | 2.38e-08 | NA |
4. PB | Q2A4V5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.30e-02 | 8.59e-19 | NA |
4. PB | P63371 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 8.32e-05 | 1.11e-26 | NA |
4. PB | P55339 | ABC-type transporter ATP-binding protein EcsA | 5.01e-12 | 8.87e-03 | 6.91e-12 | NA |
4. PB | Q5LS19 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.43e-06 | 7.26e-15 | NA |
4. PB | Q55196 | Phosphate import ATP-binding protein PstB 1 | 1.57e-13 | 8.24e-05 | 1.45e-18 | NA |
4. PB | Q21JK3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.02e-11 | 4.24e-03 | 2.73e-05 | NA |
4. PB | P37774 | L-cystine transport system ATP-binding protein TcyN | 0.00e+00 | 2.53e-02 | 1.68e-22 | NA |
4. PB | P9WQK9 | Phosphate import ATP-binding protein PstB 2 | 4.14e-14 | 6.21e-06 | 5.78e-15 | NA |
4. PB | Q57QD7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.01e-02 | 3.33e-17 | NA |
4. PB | Q3MA91 | Phosphate import ATP-binding protein PstB 3 | 1.06e-13 | 4.83e-05 | 9.36e-16 | NA |
4. PB | Q609Z8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 7.01e-03 | 1.05e-19 | NA |
4. PB | Q32AQ1 | Nickel import ATP-binding protein NikE | 3.77e-15 | 6.63e-03 | 1.67e-19 | NA |
4. PB | Q1LLB5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.42e-05 | 6.42e-16 | NA |
4. PB | Q2YL69 | Nickel import ATP-binding protein NikE | 0.00e+00 | 4.16e-04 | 1.56e-18 | NA |
4. PB | Q9C8T1 | ABC transporter I family member 1 | 3.74e-11 | 2.79e-04 | 1.61e-06 | NA |
4. PB | Q4QLJ9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.31e-12 | 4.12e-02 | 1.17e-06 | NA |
4. PB | Q5FUV5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.91e-02 | 1.57e-09 | NA |
4. PB | P55476 | Nod factor export ATP-binding protein I | 4.98e-14 | 3.89e-03 | 1.26e-25 | NA |
4. PB | Q2JKC2 | Phosphate import ATP-binding protein PstB 2 | 6.04e-14 | 9.32e-04 | 1.19e-12 | NA |
4. PB | Q9PAP0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.41e-12 | 1.91e-02 | 2.65e-07 | NA |
4. PB | Q2KCV5 | Phosphate import ATP-binding protein PstB | 6.58e-13 | 6.28e-06 | 4.13e-16 | NA |
4. PB | Q1QSE9 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 8.41e-05 | 1.25e-20 | NA |
4. PB | P47705 | Putative ABC transporter ATP-binding protein MG467 | 1.60e-08 | 1.88e-12 | 3.31e-17 | NA |
4. PB | P69878 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q0SZJ3 | Nickel import ATP-binding protein NikE | 5.66e-15 | 1.35e-03 | 2.77e-16 | NA |
4. PB | Q8DAV6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.15e-03 | 2.66e-19 | NA |
4. PB | P45769 | Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ | 0.00e+00 | 3.15e-03 | 2.82e-28 | NA |
4. PB | P23703 | Nod factor export ATP-binding protein I | 1.91e-11 | 1.76e-02 | 9.29e-20 | NA |
4. PB | Q8EEV5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.53e-02 | 6.39e-13 | NA |
4. PB | Q6HDP8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.35e-05 | 1.16e-21 | NA |
4. PB | Q30W28 | Phosphonates import ATP-binding protein PhnC | 2.33e-15 | 9.70e-04 | 1.64e-21 | NA |
4. PB | P0AAI1 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.05e-10 | 2.17e-02 | 2.77e-16 | NA |
4. PB | Q2S3A3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.37e-05 | 1.06e-10 | NA |
4. PB | Q39GW5 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 5.35e-08 | 1.87e-10 | 4.55e-16 | NA |
4. PB | Q2RU16 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | 7.15e-03 | 8.38e-17 | NA |
4. PB | Q2SE49 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.50e-14 | 4.38e-02 | 1.21e-09 | NA |
4. PB | A1WXT0 | Zinc import ATP-binding protein ZnuC | 5.00e-15 | 1.18e-02 | 1.65e-14 | NA |
4. PB | Q1C647 | Cytochrome c biogenesis ATP-binding export protein CcmA | 9.53e-14 | 1.32e-03 | 2.22e-07 | NA |
4. PB | Q0ASG3 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.94e-07 | 1.76e-16 | NA |
4. PB | Q5FM17 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 4.16e-03 | 1.72e-17 | NA |
4. PB | Q0HJG0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.80e-02 | 1.01e-12 | NA |
4. PB | Q74E68 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.73e-05 | 5.41e-21 | NA |
4. PB | Q9WYI7 | Uncharacterized ABC transporter ATP-binding protein TM_0352 | 0.00e+00 | 7.78e-03 | 4.81e-19 | NA |
4. PB | Q9AT00 | Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic | 1.55e-10 | 4.39e-07 | 6.72e-23 | NA |
4. PB | Q1CK45 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.36e-07 | 9.86e-23 | NA |
4. PB | Q084V3 | Phosphate import ATP-binding protein PstB | 2.29e-14 | 4.73e-05 | 2.82e-22 | NA |
4. PB | Q60350 | Uncharacterized ABC transporter ATP-binding protein MJ0035 | 1.27e-14 | 1.84e-03 | 2.25e-15 | NA |
4. PB | Q0T6A8 | Aliphatic sulfonates import ATP-binding protein SsuB | 8.07e-11 | 1.95e-02 | 1.64e-15 | NA |
4. PB | Q88HL0 | Nickel import ATP-binding protein NikE | 2.66e-15 | 9.04e-03 | 2.44e-16 | NA |
4. PB | Q8Z9T1 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.11e-04 | 5.31e-17 | NA |
4. PB | Q9CEW8 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 3.00e-03 | 3.24e-20 | NA |
4. PB | P0A2V8 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 3.04e-05 | 6.90e-24 | NA |
4. PB | P45275 | Uncharacterized ABC transporter ATP-binding protein HI_1618 | 0.00e+00 | 9.96e-05 | 2.95e-22 | NA |
4. PB | Q0BV49 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.62e-12 | 2.27e-04 | 2.13e-04 | NA |
4. PB | Q2FVF1 | Metal-staphylopine import system ATP-binding protein CntF | 0.00e+00 | 1.09e-02 | 9.46e-21 | NA |
4. PB | Q743D1 | Phosphate import ATP-binding protein PstB | 2.55e-15 | 9.21e-03 | 6.70e-10 | NA |
4. PB | Q7VCZ3 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 3.81e-03 | 2.47e-17 | NA |
4. PB | Q0BTP1 | Phosphate import ATP-binding protein PstB | 3.42e-12 | 1.11e-09 | 9.67e-22 | NA |
4. PB | Q5ZT78 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.32e-04 | 2.64e-16 | NA |
4. PB | Q1CHI9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.02e-14 | 1.32e-03 | 2.22e-07 | NA |
4. PB | Q1Q8K4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.70e-05 | 2.98e-14 | NA |
4. PB | Q72D46 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 5.59e-04 | 1.50e-19 | NA |
4. PB | Q135Z8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.64e-06 | 2.79e-10 | NA |
4. PB | Q2S081 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 7.19e-04 | 1.30e-17 | NA |
4. PB | Q1LNM0 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.74e-08 | 4.19e-06 | 3.51e-15 | NA |
4. PB | Q9Z411 | Phosphate import ATP-binding protein PstB | 1.89e-11 | 1.44e-07 | 1.35e-23 | NA |
4. PB | Q47Y12 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 8.79e-08 | 8.16e-21 | NA |
4. PB | Q1C0A2 | Phosphate import ATP-binding protein PstB 2 | 2.23e-14 | 1.11e-04 | 5.31e-17 | NA |
4. PB | Q312H8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.00e-02 | 7.89e-10 | NA |
4. PB | Q31GF5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.05e-02 | 5.93e-18 | NA |
4. PB | Q4K3K9 | Phosphate import ATP-binding protein PstB | 3.21e-11 | 7.45e-07 | 3.66e-24 | NA |
4. PB | P57030 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.40e-02 | 1.02e-11 | NA |
4. PB | Q5E3B8 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.95e-06 | 4.59e-26 | NA |
4. PB | Q7MJ01 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.15e-03 | 2.66e-19 | NA |
4. PB | Q6GH21 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.46e-10 | 2.10e-18 | NA |
4. PB | Q58903 | Uncharacterized ABC transporter ATP-binding protein MJ1508 | 0.00e+00 | 1.32e-02 | 1.46e-15 | NA |
4. PB | Q2L219 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.04e-03 | 1.77e-17 | NA |
4. PB | Q92SA1 | Phosphate import ATP-binding protein PstB | 9.74e-14 | 7.35e-06 | 1.37e-15 | NA |
4. PB | Q6N6K5 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.43e-11 | 1.06e-05 | 2.09e-18 | NA |
4. PB | Q1QQH1 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.68e-04 | 5.70e-18 | NA |
4. PB | Q2YXY2 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.08e-10 | 1.85e-18 | NA |
4. PB | Q3M4H6 | Phosphate import ATP-binding protein PstB 4 | 1.11e-16 | 3.78e-03 | 4.90e-18 | NA |
4. PB | Q5JEP9 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.07e-05 | 3.97e-19 | NA |
4. PB | Q8UFV7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.24e-03 | 1.87e-10 | NA |
4. PB | Q6MMH0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.47e-03 | 3.89e-19 | NA |
4. PB | P75110 | Putative ABC transporter ATP-binding protein MG467 homolog | 6.27e-10 | 2.41e-10 | 6.76e-16 | NA |
4. PB | Q83HT1 | Phosphate import ATP-binding protein PstB | 1.26e-13 | 1.67e-02 | 1.20e-18 | NA |
4. PB | P47650 | Phosphate import ATP-binding protein PstB | 6.11e-14 | 1.12e-22 | 3.55e-20 | NA |
4. PB | Q57FS7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.17e-11 | 1.93e-04 | 4.10e-08 | NA |
4. PB | Q4FQD1 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 5.38e-05 | 4.07e-16 | NA |
4. PB | Q2VZJ1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.45e-14 | 2.88e-04 | 1.16e-09 | NA |
4. PB | Q89VF2 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 4.55e-07 | 1.55e-20 | NA |
4. PB | P57383 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.61e-03 | 8.97e-15 | NA |
4. PB | Q9PHQ1 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.88e-03 | 1.70e-19 | NA |
4. PB | P36638 | Peptide transport system ATP-binding protein SapF | 0.00e+00 | 8.70e-04 | 8.43e-18 | NA |
4. PB | Q0I3C2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.28e-02 | 1.12e-16 | NA |
4. PB | Q3JDJ6 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 4.00e-06 | 3.35e-13 | NA |
4. PB | Q9C9W0 | ABC transporter I family member 17 | 3.33e-11 | 2.17e-07 | 1.01e-18 | NA |
4. PB | Q8PKT0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.66e-05 | 5.98e-15 | NA |
4. PB | Q12BB2 | Phosphate import ATP-binding protein PstB | 3.84e-14 | 1.22e-06 | 2.49e-15 | NA |
4. PB | Q24PY8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.59e-05 | 2.07e-18 | NA |
4. PB | Q6KIS8 | Phosphate import ATP-binding protein PstB | 7.77e-16 | 6.79e-07 | 6.35e-19 | NA |
4. PB | Q65HC0 | Phosphate import ATP-binding protein PstB 1 | 1.11e-16 | 3.50e-05 | 1.12e-22 | NA |
4. PB | Q07LQ4 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.08e-11 | 6.87e-06 | 3.04e-16 | NA |
4. PB | Q57243 | Uncharacterized ABC transporter ATP-binding protein HI_1272 | 5.11e-15 | 8.78e-04 | 1.60e-10 | NA |
4. PB | Q3Z300 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.42e-02 | 6.53e-18 | NA |
4. PB | Q5PGR6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.67e-02 | 1.77e-17 | NA |
4. PB | Q57AC2 | Phosphate import ATP-binding protein PstB | 1.55e-12 | 7.99e-07 | 9.91e-15 | NA |
4. PB | Q62J04 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.02e-06 | 5.82e-18 | NA |
4. PB | Q8P0V3 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 6.05e-05 | 1.05e-21 | NA |
4. PB | Q13X01 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.91e-06 | 1.75e-16 | NA |
4. PB | Q2W7J9 | Phosphate import ATP-binding protein PstB 2 | 8.88e-16 | 9.06e-05 | 1.31e-20 | NA |
4. PB | Q82G23 | Phosphate import ATP-binding protein PstB | 4.33e-15 | 4.35e-02 | 8.26e-18 | NA |
4. PB | Q2YA30 | Phosphate import ATP-binding protein PstB | 1.33e-15 | 1.53e-06 | 1.82e-17 | NA |
4. PB | P02915 | Histidine transport ATP-binding protein HisP | 0.00e+00 | 4.79e-02 | 2.16e-15 | NA |
4. PB | Q6AM16 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 6.09e-08 | 7.47e-15 | NA |
4. PB | Q0IAC3 | Phosphate import ATP-binding protein PstB | 6.94e-14 | 1.17e-05 | 1.01e-17 | NA |
4. PB | Q9HPH7 | Putative ABC transporter ATP-binding protein VNG_1631G | 5.55e-16 | 2.65e-04 | 2.43e-30 | NA |
4. PB | Q2IF17 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.08e-02 | 3.36e-16 | NA |
4. PB | Q88YK7 | Phosphate import ATP-binding protein PstB 2 | 3.33e-16 | 1.26e-02 | 1.67e-23 | NA |
4. PB | Q8A853 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.01e-06 | 1.03e-18 | NA |
4. PB | Q7MFE8 | Phosphate import ATP-binding protein PstB 2 | 3.77e-14 | 6.71e-07 | 5.42e-22 | NA |
4. PB | Q98DT6 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 9.84e-12 | 9.35e-05 | 5.25e-15 | NA |
4. PB | Q8PM59 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.31e-07 | 2.86e-16 | NA |
4. PB | P46341 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 4.43e-06 | 2.46e-19 | NA |
4. PB | Q8NV47 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | Q30YR3 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.41e-05 | 2.96e-19 | NA |
4. PB | Q1BHS6 | Lipoprotein-releasing system ATP-binding protein LolD | 1.44e-15 | 5.73e-08 | 1.83e-18 | NA |
4. PB | O27764 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 7.33e-05 | 1.16e-17 | NA |
4. PB | Q3MH62 | Phosphate import ATP-binding protein PstB 1 | 8.88e-16 | 3.13e-04 | 9.42e-18 | NA |
4. PB | O67154 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 8.13e-06 | 1.54e-21 | NA |
4. PB | Q6N0I5 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.86e-07 | 5.47e-18 | NA |
4. PB | Q12ES3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.52e-04 | 6.06e-14 | NA |
4. PB | Q2FH51 | Phosphate import ATP-binding protein PstB | 1.41e-13 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q5LUD0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.85e-03 | 6.43e-12 | NA |
4. PB | Q3AAA4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 9.23e-04 | 8.61e-23 | NA |
4. PB | Q9EYM2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.97e-03 | 6.74e-18 | NA |
4. PB | O28881 | Probable branched-chain amino acid transport ATP-binding protein LivG | 2.00e-15 | 3.51e-02 | 6.39e-07 | NA |
4. PB | Q5F8K2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.72e-03 | 4.83e-13 | NA |
4. PB | P45247 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.05e-03 | 4.90e-17 | NA |
4. PB | Q12NL5 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.68e-04 | 1.22e-11 | NA |
4. PB | Q3AJS9 | Phosphate import ATP-binding protein PstB | 2.16e-14 | 9.93e-06 | 3.00e-18 | NA |
4. PB | Q1QXH6 | Phosphate import ATP-binding protein PstB 1 | 1.50e-13 | 5.56e-05 | 8.23e-17 | NA |
4. PB | P63378 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q50046 | Phosphate import ATP-binding protein PstB | 1.78e-15 | 1.10e-02 | 1.67e-09 | NA |
4. PB | Q035E0 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 2.23e-02 | 1.57e-13 | NA |
4. PB | O28912 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.36e-03 | 6.77e-24 | NA |
4. PB | Q4L691 | Phosphate import ATP-binding protein PstB | 2.17e-13 | 1.02e-13 | 5.18e-19 | NA |
4. PB | Q8U242 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 4.34e-04 | 3.36e-24 | NA |
4. PB | Q1GFI8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.88e-03 | 3.85e-15 | NA |
4. PB | Q663R5 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.11e-04 | 5.31e-17 | NA |
4. PB | Q8KDZ5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.38e-10 | 1.64e-18 | NA |
4. PB | Q1MLW4 | Phosphate import ATP-binding protein PstB 1 | 9.97e-14 | 3.57e-06 | 2.38e-15 | NA |
4. PB | P57031 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.46e-02 | 6.72e-12 | NA |
4. PB | P0A2U7 | Zinc transport system ATP-binding protein AdcC | 1.63e-11 | 3.93e-03 | 1.45e-18 | NA |
4. PB | Q1QLB0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.13e-05 | 6.92e-13 | NA |
4. PB | Q55281 | Manganese transport system ATP-binding protein MntA | 2.12e-13 | 2.70e-03 | 8.33e-14 | NA |
4. PB | Q4ZRT7 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 2.05e-05 | 3.63e-17 | NA |
4. PB | Q87G59 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 4.73e-05 | 4.32e-22 | NA |
4. PB | Q3SI20 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 7.92e-03 | 1.01e-11 | NA |
4. PB | Q2G607 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.76e-06 | 1.61e-19 | NA |
4. PB | Q8XMP8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.35e-06 | 9.08e-21 | NA |
4. PB | Q5H0G3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.52e-04 | 1.00e-14 | NA |
4. PB | Q7W8T0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.65e-04 | 6.55e-15 | NA |
4. PB | Q97ZT9 | Phosphate import ATP-binding protein PstB | 5.80e-14 | 1.50e-03 | 1.05e-18 | NA |
4. PB | Q8H1R4 | ABC transporter I family member 10 | 2.33e-11 | 1.89e-09 | 3.03e-30 | NA |
4. PB | Q63SP4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.02e-06 | 5.82e-18 | NA |
4. PB | Q2FTF8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.15e-05 | 3.16e-18 | NA |
4. PB | Q4ZV73 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 7.63e-04 | 6.42e-20 | NA |
4. PB | Q487I2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.18e-12 | 8.27e-04 | 1.89e-05 | NA |
4. PB | P33594 | Nickel import ATP-binding protein NikE | 4.44e-15 | 1.41e-03 | 2.61e-18 | NA |
4. PB | P0CZ38 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q5KX47 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.09e-06 | 1.46e-21 | NA |
4. PB | Q64SM5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.82e-05 | 1.64e-19 | NA |
4. PB | Q7WK40 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.65e-04 | 6.55e-15 | NA |
4. PB | Q2SJK0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.76e-03 | 1.73e-12 | NA |
4. PB | Q4QKQ9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.05e-03 | 4.90e-17 | NA |
4. PB | Q8E9I8 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.52e-03 | 3.41e-24 | NA |
4. PB | P63366 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.12e-05 | 1.44e-16 | NA |
4. PB | Q11JI6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.92e-03 | 1.15e-09 | NA |
4. PB | P24586 | Polysialic acid transport ATP-binding protein KpsT | 5.05e-11 | 1.10e-03 | 0.004 | NA |
4. PB | Q81Y10 | Phosphonates import ATP-binding protein PhnC | 5.55e-16 | 3.70e-02 | 2.34e-12 | NA |
4. PB | Q8R9I2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.47e-04 | 1.33e-19 | NA |
4. PB | Q9EUS2 | Phosphate import ATP-binding protein PstB | 4.55e-15 | 1.55e-02 | 4.43e-19 | NA |
4. PB | P63370 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 1.23e-04 | 3.09e-20 | NA |
4. PB | Q8Y4E9 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.10e-05 | 6.47e-17 | NA |
4. PB | Q7NNG3 | Phosphate import ATP-binding protein PstB 2 | 1.67e-15 | 1.92e-05 | 1.93e-23 | NA |
4. PB | P45032 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.45e-13 | 1.21e-02 | 1.06e-06 | NA |
4. PB | P0AAH2 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q7U6R4 | Phosphate import ATP-binding protein PstB | 2.24e-13 | 1.90e-05 | 2.72e-18 | NA |
4. PB | Q1J0N0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.52e-04 | 1.95e-15 | NA |
4. PB | Q00830 | Probable ATP-dependent transporter ycf16 | 9.65e-13 | 4.16e-03 | 1.12e-09 | NA |
4. PB | Q1R4L0 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q31UX2 | Phosphate import ATP-binding protein PstB | 7.28e-14 | 1.24e-04 | 6.78e-17 | NA |
4. PB | P10346 | Glutamine transport ATP-binding protein GlnQ | 0.00e+00 | 3.44e-02 | 2.64e-23 | NA |
4. PB | Q1AXT9 | Phosphate import ATP-binding protein PstB | 4.41e-11 | 3.13e-04 | 2.49e-18 | NA |
4. PB | Q329R2 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q9KN92 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.61e-05 | 7.03e-21 | NA |
4. PB | Q2W450 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.44e-02 | 4.42e-13 | NA |
4. PB | P0A9T8 | Uncharacterized ABC transporter ATP-binding protein YbbA | 0.00e+00 | 8.95e-03 | 1.83e-18 | NA |
4. PB | P61482 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.67e-02 | 1.77e-17 | NA |
4. PB | Q1CCI2 | Phosphate import ATP-binding protein PstB 2 | 3.59e-14 | 1.11e-04 | 5.31e-17 | NA |
4. PB | P73788 | Phosphate import ATP-binding protein PstB 3 | 2.13e-13 | 2.05e-05 | 1.98e-23 | NA |
4. PB | Q1GUY1 | Phosphate import ATP-binding protein PstB | 6.66e-16 | 3.19e-06 | 1.12e-16 | NA |
4. PB | P61481 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.67e-02 | 1.77e-17 | NA |
4. PB | Q3B3H7 | Phosphate import ATP-binding protein PstB | 3.00e-15 | 1.24e-08 | 8.76e-19 | NA |
4. PB | P63363 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.08e-04 | 1.91e-19 | NA |
4. PB | Q1JBJ4 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q9KU04 | Phosphate import ATP-binding protein PstB 1 | 2.11e-14 | 1.00e-05 | 3.57e-23 | NA |
4. PB | Q0I2G0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.33e-13 | 2.70e-03 | 3.22e-05 | NA |
4. PB | P0A9V1 | Lipopolysaccharide export system ATP-binding protein LptB | 0.00e+00 | 1.44e-02 | 8.06e-12 | NA |
4. PB | Q6LV32 | Thiamine import ATP-binding protein ThiQ | 4.44e-16 | 1.40e-05 | 1.77e-21 | NA |
4. PB | P55662 | Probable amino-acid ABC transporter ATP-binding protein y4tH | 0.00e+00 | 1.39e-02 | 2.22e-22 | NA |
4. PB | Q2RM86 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.96e-04 | 7.93e-22 | NA |
4. PB | Q9TLX1 | Probable ATP-dependent transporter ycf16 | 7.77e-15 | 8.62e-03 | 5.66e-12 | NA |
4. PB | Q7MU65 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.72e-02 | 5.25e-14 | NA |
4. PB | Q890R2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 2.36e-02 | 8.41e-64 | NA |
4. PB | Q67RE7 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 3.72e-04 | 2.16e-18 | NA |
4. PB | Q1MIN0 | Phosphate import ATP-binding protein PstB 2 | 1.37e-14 | 2.73e-08 | 8.85e-13 | NA |
4. PB | Q6N999 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | 2.98e-02 | 8.67e-19 | NA |
4. PB | Q48BP8 | Phosphate import ATP-binding protein PstB 2 | 3.95e-12 | 1.26e-06 | 3.81e-22 | NA |
4. PB | Q215F6 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | 7.98e-05 | 1.14e-08 | NA |
4. PB | Q6D2D5 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 2.57e-06 | 6.24e-23 | NA |
4. PB | Q20ZS6 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 0.00e+00 | 4.67e-02 | 3.00e-16 | NA |
4. PB | Q8YYE2 | Phosphate import ATP-binding protein PstB 2 | 5.58e-14 | 5.21e-04 | 1.22e-23 | NA |
4. PB | Q5SLN1 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.91e-06 | 3.44e-22 | NA |
4. PB | Q5FM18 | Phosphate import ATP-binding protein PstB 1 | 3.33e-16 | 3.38e-06 | 3.43e-22 | NA |
4. PB | P15361 | Probable ABC transporter ATP-binding protein p29 | 3.22e-15 | 1.56e-05 | 4.04e-09 | NA |
4. PB | Q7WXC1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.84e-13 | 2.23e-04 | 0.041 | NA |
4. PB | Q1GH74 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.60e-06 | 2.54e-15 | NA |
4. PB | Q3IS07 | Phosphate import ATP-binding protein PstB 1 | 5.55e-16 | 2.73e-08 | 3.03e-18 | NA |
4. PB | Q1WUX1 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.01e-02 | 9.90e-18 | NA |
4. PB | Q1IMC7 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 4.43e-04 | 3.87e-17 | NA |
4. PB | Q8FL82 | Thiamine import ATP-binding protein ThiQ | 0.00e+00 | 1.30e-02 | 5.39e-20 | NA |
4. PB | Q21TG3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.91e-04 | 9.23e-18 | NA |
4. PB | Q3A6U0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.39e-05 | 2.06e-19 | NA |
4. PB | Q0SNU4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.57e-03 | 7.28e-23 | NA |
4. PB | O34814 | Cell division ATP-binding protein FtsE | 0.00e+00 | 5.53e-04 | 2.02e-19 | NA |
4. PB | O05779 | Cell division ATP-binding protein FtsE | 0.00e+00 | 5.88e-04 | 4.09e-26 | NA |
4. PB | Q8ZCX5 | Phosphate import ATP-binding protein PstB 1 | 3.33e-16 | 5.36e-07 | 9.86e-23 | NA |
4. PB | Q3MGT2 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.71e-02 | 7.91e-23 | NA |
4. PB | Q7V7P0 | Phosphate import ATP-binding protein PstB | 1.80e-13 | 4.73e-05 | 2.48e-18 | NA |
4. PB | Q8ZGU5 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 1.38e-04 | 6.29e-15 | NA |
4. PB | Q895Y0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.25e-05 | 7.63e-17 | NA |
4. PB | A6QJK1 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | Q1GMA8 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | 3.29e-02 | 7.87e-12 | NA |
4. PB | A0QQ70 | Phosphate-import ATP-binding protein PhnC | 0.00e+00 | 2.83e-02 | 3.76e-10 | NA |
4. PB | B8GYG4 | Phosphate import ATP-binding protein PstB | 9.19e-14 | 2.39e-07 | 1.50e-14 | NA |
4. PB | Q2VYP7 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 5.37e-04 | 2.47e-15 | NA |
4. PB | P77279 | Probable iron export ATP-binding protein FetA | 5.88e-15 | 7.08e-03 | 4.06e-21 | NA |
4. PB | Q0BN75 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.28e-02 | 2.14e-18 | NA |
4. PB | Q83GE8 | Phosphate import ATP-binding protein PstB | 1.13e-13 | 1.74e-02 | 6.00e-20 | NA |
4. PB | Q9CAF5 | ABC transporter I family member 6, chloroplastic | 8.70e-09 | 5.31e-04 | 2.44e-04 | NA |
4. PB | Q9A9P4 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 1.11e-16 | 2.21e-02 | 5.98e-18 | NA |
4. PB | P75957 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.46e-02 | 2.19e-17 | NA |
4. PB | Q74KF9 | Phosphate import ATP-binding protein PstB 1 | 2.22e-16 | 1.43e-05 | 8.30e-19 | NA |
4. PB | Q6N5P8 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 0.00e+00 | 2.37e-06 | 3.34e-11 | NA |
4. PB | Q9X0Y8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.23e-04 | 8.01e-22 | NA |
4. PB | Q5P3L0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.53e-13 | 1.29e-02 | 0.030 | NA |
4. PB | Q38YC2 | Phosphate import ATP-binding protein PstB 1 | 1.11e-16 | 3.61e-06 | 1.29e-21 | NA |
4. PB | Q6NA00 | Phosphonates import ATP-binding protein PhnC 2 | 4.44e-15 | 5.53e-04 | 6.93e-10 | NA |
4. PB | Q12I82 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.28e-13 | 3.81e-03 | 9.71e-06 | NA |
4. PB | Q49XI8 | Phosphate import ATP-binding protein PstB | 3.70e-12 | 3.77e-13 | 7.93e-20 | NA |
4. PB | Q7V1X3 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.70e-04 | 4.37e-19 | NA |
4. PB | Q6G0V9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.87e-11 | 2.62e-03 | 6.93e-06 | NA |
4. PB | Q1CI46 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.77e-02 | 3.05e-16 | NA |
4. PB | Q13DS7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.48e-12 | 1.96e-02 | 4.77e-12 | NA |
4. PB | P0A2V9 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 3.04e-05 | 6.90e-24 | NA |
4. PB | P0CZ39 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | Q8X8E3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 8.46e-03 | 1.46e-17 | NA |
4. PB | Q5H002 | Phosphate import ATP-binding protein PstB | 3.97e-14 | 6.18e-07 | 2.41e-16 | NA |
4. PB | Q2FED7 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | Q38YC1 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.51e-02 | 1.97e-17 | NA |
4. PB | Q7NC40 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.76e-26 | 1.84e-16 | NA |
4. PB | Q662E6 | Phosphate import ATP-binding protein PstB | 4.14e-14 | 4.24e-03 | 1.66e-23 | NA |
4. PB | Q6G6W1 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | Q8NMK1 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 5.13e-03 | 1.72e-08 | NA |
4. PB | Q1WUX2 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 7.65e-05 | 9.14e-23 | NA |
4. PB | Q21E72 | Phosphate import ATP-binding protein PstB | 4.31e-11 | 1.17e-10 | 1.71e-17 | NA |
4. PB | Q2K9R2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 8.19e-04 | 8.38e-10 | NA |
4. PB | Q8D3X4 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.02e-04 | 7.47e-22 | NA |
4. PB | Q5FQN4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.96e-11 | 2.11e-03 | 0.004 | NA |
4. PB | Q8DB62 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.11e-15 | 4.75e-02 | 2.59e-05 | NA |
4. PB | Q8CPA1 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 9.24e-15 | 5.88e-19 | NA |
4. PB | Q834B3 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 3.70e-06 | 5.18e-20 | NA |
4. PB | Q884I3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.94e-04 | 3.91e-19 | NA |
4. PB | Q5NN23 | Aliphatic sulfonates import ATP-binding protein SsuB | 9.30e-13 | 3.87e-02 | 5.22e-14 | NA |
4. PB | P0AAH0 | Phosphate import ATP-binding protein PstB | 1.32e-13 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q31I88 | Phosphate import ATP-binding protein PstB | 8.00e-12 | 3.65e-05 | 3.58e-20 | NA |
4. PB | O78474 | Probable ATP-dependent transporter ycf16 | 9.86e-13 | 9.83e-03 | 3.86e-05 | NA |
4. PB | Q3M4H5 | Phosphate import ATP-binding protein PstB 5 | 5.67e-14 | 5.10e-04 | 1.25e-23 | NA |
4. PB | Q0VL18 | Phosphate import ATP-binding protein PstB | 7.11e-13 | 1.99e-11 | 8.68e-19 | NA |
4. PB | Q7NAQ7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.44e-15 | 2.09e-04 | 1.93e-35 | NA |
4. PB | Q11CZ6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.28e-11 | 2.13e-02 | 4.33e-07 | NA |
4. PB | Q2IWV8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 7.68e-06 | 1.82e-12 | NA |
4. PB | Q6WB51 | Phosphate import ATP-binding protein PstB | 2.00e-15 | 3.90e-09 | 3.05e-18 | NA |
4. PB | Q7N9U4 | Phosphate import ATP-binding protein PstB | 5.28e-14 | 1.67e-05 | 4.01e-17 | NA |
4. PB | Q0TAY4 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.24e-04 | 6.78e-17 | NA |
4. PB | Q5NQX0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.11e-11 | 2.13e-02 | 2.72e-08 | NA |
4. PB | Q6F1N1 | Phosphate import ATP-binding protein PstB | 2.63e-12 | 1.46e-07 | 5.19e-17 | NA |
4. PB | Q12XW6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.19e-04 | 1.19e-21 | NA |
4. PB | Q2YZ26 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.21e-02 | 3.63e-10 | NA |
4. PB | Q47C66 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.61e-03 | 3.27e-14 | NA |
4. PB | Q2JMJ0 | Phosphate import ATP-binding protein PstB 1 | 2.50e-13 | 5.44e-05 | 5.81e-18 | NA |
4. PB | Q83RS0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.81e-02 | 4.51e-18 | NA |
4. PB | Q7WMC3 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.38e-05 | 1.60e-17 | NA |
4. PB | P63372 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 8.32e-05 | 1.11e-26 | NA |
4. PB | Q2Y9Q1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.68e-13 | 3.90e-02 | 0.004 | NA |
4. PB | Q89ER4 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.03e-12 | 8.70e-04 | 1.28e-14 | NA |
4. PB | Q9XBG1 | Phosphate import ATP-binding protein PstB | 7.77e-16 | 2.47e-05 | 1.36e-17 | NA |
4. PB | Q31ZH4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.60e-02 | 1.92e-18 | NA |
4. PB | P63361 | Phosphate import ATP-binding protein PstB | 1.09e-12 | 7.99e-07 | 9.91e-15 | NA |
4. PB | Q58418 | Phosphate import ATP-binding protein PstB | 3.51e-14 | 7.02e-05 | 7.80e-24 | NA |
4. PB | Q1GCR8 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.30e-05 | 7.07e-17 | NA |
4. PB | P47545 | Putative ABC transporter ATP-binding protein MG303 | 2.16e-12 | 4.09e-15 | 9.02e-18 | NA |
4. PB | Q15QL7 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 7.37e-10 | 9.21e-20 | NA |
4. PB | Q0TBX8 | Nickel import ATP-binding protein NikE | 2.22e-16 | 1.70e-03 | 8.51e-19 | NA |
4. PB | Q9CN78 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.77e-04 | 6.59e-19 | NA |
4. PB | P69879 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q0D9V6 | Protein STAR1 | 4.92e-11 | 2.47e-08 | 6.82e-22 | NA |
4. PB | Q1BXC3 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 3.24e-10 | 7.13e-18 | NA |
4. PB | P54591 | Uncharacterized ABC transporter ATP-binding protein YhcG | 8.84e-14 | 8.79e-03 | 9.41e-14 | NA |
4. PB | Q2JUA1 | Phosphate import ATP-binding protein PstB 1 | 1.99e-13 | 1.06e-05 | 4.56e-19 | NA |
4. PB | Q2SNX4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.65e-11 | 4.10e-21 | NA |
4. PB | Q1BWL4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 2.65e-09 | 1.64e-09 | 1.31e-14 | NA |
4. PB | Q668E1 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.36e-07 | 9.86e-23 | NA |
4. PB | Q0HTE5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.78e-05 | 2.68e-22 | NA |
4. PB | Q98KS7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 8.30e-03 | 7.04e-10 | NA |
4. PB | Q8TSA8 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.65e-07 | 2.60e-20 | NA |
4. PB | Q82VL9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.77e-02 | 9.80e-17 | NA |
4. PB | Q55195 | Phosphate import ATP-binding protein PstB 2 | 1.42e-13 | 8.70e-04 | 8.26e-15 | NA |
4. PB | Q4KFA2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.46e-03 | 5.32e-20 | NA |
4. PB | Q3SRG8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.99e-05 | 1.20e-13 | NA |
4. PB | Q7W8Q6 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.38e-05 | 1.60e-17 | NA |
4. PB | Q1H377 | Phosphate import ATP-binding protein PstB | 3.33e-16 | 2.85e-06 | 2.07e-21 | NA |
4. PB | Q8YCN7 | Nickel import ATP-binding protein NikE | 3.33e-16 | 4.16e-04 | 1.56e-18 | NA |
4. PB | Q3BTD3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 9.23e-04 | 3.73e-15 | NA |
4. PB | Q578S7 | Nickel import ATP-binding protein NikE | 2.22e-16 | 4.16e-04 | 1.56e-18 | NA |
4. PB | Q927Z7 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 2.10e-05 | 7.12e-17 | NA |
4. PB | Q87S48 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 2.64e-05 | 4.91e-21 | NA |
4. PB | Q5HC57 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.10e-02 | 7.66e-10 | NA |
4. PB | Q8U648 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.36e-14 | 3.15e-03 | 3.97e-19 | NA |
4. PB | P0A9U0 | Uncharacterized ABC transporter ATP-binding protein YbbA | 0.00e+00 | 8.95e-03 | 1.83e-18 | NA |
4. PB | O51236 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.67e-03 | 1.80e-22 | NA |
4. PB | P77499 | Probable ATP-dependent transporter SufC | 3.79e-13 | 9.29e-03 | 2.00e-06 | NA |
4. PB | Q3JTS8 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 3.03e-10 | 2.11e-18 | NA |
4. PB | P0AAI0 | Peptide transport system ATP-binding protein SapF | 2.21e-13 | 5.76e-04 | 9.85e-19 | NA |
4. PB | Q8ESM5 | Phosphonates import ATP-binding protein PhnC 1 | 1.44e-15 | 1.58e-02 | 1.80e-11 | NA |
4. PB | Q9PBK0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.68e-06 | 6.75e-19 | NA |
4. PB | Q7NPP4 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.43e-06 | 3.55e-20 | NA |
4. PB | Q18K56 | Phosphate import ATP-binding protein PstB | 1.15e-11 | 2.70e-08 | 2.01e-17 | NA |
4. PB | Q0AKQ2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.53e-12 | 4.58e-03 | 5.17e-04 | NA |
4. PB | Q1R5D8 | Nickel import ATP-binding protein NikE | 7.22e-15 | 1.70e-03 | 8.51e-19 | NA |
4. PB | Q0C0L5 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 7.23e-08 | 8.98e-18 | NA |
4. PB | Q880A6 | Phosphate import ATP-binding protein PstB 1 | 9.94e-14 | 2.05e-05 | 3.63e-17 | NA |
4. PB | Q45593 | Probable peptide export ATP-binding protein YydI | 4.25e-11 | 1.30e-02 | 1.98e-04 | NA |
4. PB | Q9UZU7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.28e-03 | 1.25e-23 | NA |
4. PB | Q11NG0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.61e-03 | 5.60e-22 | NA |
4. PB | Q72AQ6 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | 8.88e-06 | 1.72e-15 | NA |
4. PB | Q2GHT4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.26e-03 | 1.32e-10 | NA |
4. PB | Q50316 | Putative ABC transporter ATP-binding protein MG468.1 homolog | 1.45e-09 | 2.52e-11 | 4.45e-09 | NA |
4. PB | Q6FCW7 | Phosphate import ATP-binding protein PstB | 8.78e-12 | 1.01e-12 | 4.13e-17 | NA |
4. PB | Q2FYQ0 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q1D320 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 7.19e-04 | 6.30e-20 | NA |
4. PB | P44871 | Cell division ATP-binding protein FtsE | 0.00e+00 | 5.59e-03 | 2.10e-13 | NA |
4. PB | Q5E0B3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.67e-02 | 2.87e-15 | NA |
4. PB | Q71WT3 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.08e-04 | 1.91e-19 | NA |
4. PB | Q5LBQ4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.82e-05 | 1.64e-19 | NA |
4. PB | Q0K9I2 | Aliphatic sulfonates import ATP-binding protein SsuB | 7.55e-10 | 6.05e-05 | 4.09e-17 | NA |
4. PB | Q8DPB4 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 8.78e-05 | 1.62e-18 | NA |
4. PB | Q5PBP5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.46e-13 | 1.18e-03 | 1.87e-06 | NA |
4. PB | P0A2U6 | Zinc transport system ATP-binding protein AdcC | 1.06e-11 | 3.93e-03 | 1.45e-18 | NA |
4. PB | Q5HDJ6 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 2.25e-02 | 8.56e-10 | NA |
4. PB | P46903 | ABC transporter ATP-binding protein NatA | 1.17e-14 | 2.97e-03 | 8.99e-20 | NA |
4. PB | Q8ZFR4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.77e-02 | 3.05e-16 | NA |
4. PB | Q51546 | Phosphate import ATP-binding protein PstB | 2.80e-11 | 6.55e-08 | 6.47e-21 | NA |
4. PB | Q0A9E2 | Zinc import ATP-binding protein ZnuC | 1.37e-13 | 5.56e-05 | 2.06e-12 | NA |
4. PB | Q1MFL8 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 3.66e-10 | 7.43e-06 | 3.89e-17 | NA |
4. PB | Q3JYY5 | Phosphate import ATP-binding protein PstB 3 | 0.00e+00 | 1.20e-04 | 4.89e-27 | NA |
4. PB | Q5V0G3 | Phosphate import ATP-binding protein PstB 2 | 1.56e-11 | 6.50e-09 | 2.69e-18 | NA |
4. PB | Q28M30 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.11e-03 | 4.11e-17 | NA |
4. PB | Q87EF4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 5.76e-04 | 3.46e-16 | NA |
4. PB | Q5QZP7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.89e-12 | 2.72e-02 | 9.48e-06 | NA |
4. PB | Q1LKR4 | Cytochrome c biogenesis ATP-binding export protein CcmA 1 | 2.33e-15 | 1.78e-02 | 4.30e-05 | NA |
4. PB | P0CE69 | Putative uncharacterized protein YKR104W | 4.20e-10 | 1.63e-04 | 5.10e-17 | NA |
4. PB | Q15TB1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.76e-03 | 4.95e-17 | NA |
4. PB | Q2NHW1 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 5.21e-05 | 1.70e-17 | NA |
4. PB | Q5NNN6 | Phosphate import ATP-binding protein PstB | 1.32e-13 | 7.23e-08 | 1.70e-16 | NA |
4. PB | Q65TB7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.22e-03 | 2.00e-17 | NA |
4. PB | Q31KE8 | Phosphate import ATP-binding protein PstB | 1.57e-13 | 4.12e-03 | 4.88e-19 | NA |
4. PB | Q2LTG0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.75e-04 | 4.45e-19 | NA |
4. PB | Q6F1W5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | 3.78e-63 | 7.94e-152 | NA |
4. PB | O83078 | Probable metal transport system ATP-binding protein TP_0035 | 5.39e-13 | 2.71e-04 | 5.96e-19 | NA |
4. PB | P72477 | Putative ABC transporter ATP-binding protein | 4.97e-14 | 4.08e-03 | 4.54e-13 | NA |
4. PB | Q2SS06 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.80e-05 | 4.16e-19 | NA |
4. PB | Q4QK92 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 5.94e-06 | 2.51e-16 | NA |
4. PB | Q8FMN9 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.71e-02 | 7.77e-08 | NA |
4. PB | Q4UT63 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.32e-07 | 1.55e-16 | NA |
4. PB | Q5WET8 | Phosphate import ATP-binding protein PstB 1 | 3.15e-14 | 1.35e-02 | 7.16e-24 | NA |
4. PB | Q3SJQ8 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.03e-05 | 9.47e-19 | NA |
4. PB | P50332 | Nod factor export ATP-binding protein I | 2.60e-11 | 4.70e-04 | 3.95e-25 | NA |
4. PB | Q1GZH6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.25e-02 | 1.04e-13 | NA |
4. PB | Q02151 | Uncharacterized ABC transporter ATP-binding protein YmeB | 3.09e-14 | 6.03e-03 | 8.99e-16 | NA |
4. PB | Q2P2Y5 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 6.18e-07 | 2.41e-16 | NA |
4. PB | Q1J6D1 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 7.25e-05 | 7.64e-22 | NA |
4. PB | P47532 | Probable ABC transporter ATP-binding protein p29 | 0.00e+00 | 2.47e-05 | 4.27e-08 | NA |
4. PB | O34979 | Uncharacterized ABC transporter ATP-binding protein YvrO | 0.00e+00 | 4.42e-02 | 2.79e-18 | NA |
4. PB | P07109 | Histidine transport ATP-binding protein HisP | 0.00e+00 | 5.75e-03 | 7.67e-15 | NA |
4. PB | P16678 | Putative phosphonates utilization ATP-binding protein PhnK | 0.00e+00 | 4.80e-03 | 1.01e-12 | NA |
4. PB | Q5WBL0 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 7.46e-10 | 5.05e-05 | 2.92e-20 | NA |
4. PB | P63365 | Phosphate import ATP-binding protein PstB | 1.34e-13 | 6.12e-05 | 1.44e-16 | NA |
4. PB | Q0HH38 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.78e-05 | 2.68e-22 | NA |
4. PB | Q5QVB0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 3.12e-06 | 1.81e-23 | NA |
4. PB | Q3ATA4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.64e-05 | 4.88e-17 | NA |
4. PB | Q13GD4 | Aliphatic sulfonates import ATP-binding protein SsuB 3 | 3.73e-11 | 3.74e-03 | 5.64e-19 | NA |
4. PB | Q7W736 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.25e-13 | 4.35e-02 | 0.029 | NA |
4. PB | Q2P3E1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.52e-04 | 1.00e-14 | NA |
4. PB | Q2YQT8 | Phosphate import ATP-binding protein PstB | 1.35e-12 | 7.99e-07 | 9.91e-15 | NA |
4. PB | Q8D3A0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.24e-02 | 6.23e-13 | NA |
4. PB | Q5NZT6 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.33e-03 | 3.37e-20 | NA |
4. PB | Q2RS22 | Nickel import ATP-binding protein NikE | 9.99e-14 | 2.89e-03 | 3.91e-18 | NA |
4. PB | P0AAH8 | Putrescine export system ATP-binding protein SapF | 0.00e+00 | 5.76e-04 | 9.85e-19 | NA |
4. PB | Q46ZA5 | Phosphate import ATP-binding protein PstB | 4.44e-16 | 8.59e-05 | 1.61e-17 | NA |
4. PB | Q88JJ0 | Phosphate import ATP-binding protein PstB 1 | 8.13e-12 | 3.13e-04 | 8.59e-18 | NA |
4. PB | Q8DEW5 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.15e-05 | 7.52e-22 | NA |
4. PB | Q7M9G3 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.57e-04 | 2.47e-17 | NA |
4. PB | Q97IE0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.33e-03 | 5.26e-19 | NA |
4. PB | Q089M3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.01e-13 | 1.36e-02 | 6.03e-12 | NA |
4. PB | Q8NQH4 | Phosphonates import ATP-binding protein PhnC | 1.11e-15 | 5.00e-04 | 2.79e-21 | NA |
4. PB | Q0APW8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.75e-03 | 3.06e-11 | NA |
4. PB | Q733D6 | Phosphonates import ATP-binding protein PhnC | 7.77e-16 | 2.36e-02 | 9.41e-12 | NA |
4. PB | Q6G9H4 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q6CYN3 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 1.65e-05 | 1.78e-16 | NA |
4. PB | Q5QU46 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 7.49e-03 | 9.65e-16 | NA |
4. PB | Q8RD07 | Putative ABC transporter ATP-binding protein TTE0246 | 0.00e+00 | 8.69e-06 | 3.79e-32 | NA |
4. PB | Q81LW6 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.35e-05 | 1.16e-21 | NA |
4. PB | P76909 | Uncharacterized ABC transporter ATP-binding protein YnjD | 1.33e-12 | 1.83e-03 | 5.52e-15 | NA |
4. PB | Q8PVF6 | Phosphate import ATP-binding protein PstB | 1.48e-14 | 2.72e-06 | 1.54e-19 | NA |
4. PB | Q8Z9I6 | Thiamine import ATP-binding protein ThiQ | 1.11e-16 | 1.03e-02 | 1.87e-20 | NA |
4. PB | Q47L96 | Phosphate import ATP-binding protein PstB | 6.22e-15 | 3.18e-02 | 1.43e-18 | NA |
4. PB | Q180A5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.32e-04 | 3.24e-18 | NA |
4. PB | Q3MBW2 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 2.02e-07 | 1.47e-17 | NA |
4. PB | Q13CR0 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 8.13e-06 | 4.15e-18 | NA |
4. PB | Q3ILC5 | Phosphate import ATP-binding protein PstB | 8.46e-14 | 8.40e-06 | 3.29e-21 | NA |
4. PB | Q82WC8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.67e-13 | 2.06e-02 | 0.011 | NA |
4. PB | Q63V79 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 3.03e-10 | 2.11e-18 | NA |
4. PB | Q21JQ9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 7.01e-03 | 1.08e-18 | NA |
4. PB | Q0A9K1 | Phosphate import ATP-binding protein PstB | 1.09e-09 | 4.42e-08 | 3.35e-23 | NA |
4. PB | Q3ZA58 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 6.44e-04 | 1.01e-15 | NA |
4. PB | Q9RYZ3 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 5.00e-04 | 2.10e-14 | NA |
4. PB | Q0VR80 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.97e-13 | 6.31e-04 | 0.001 | NA |
4. PB | Q9CEW7 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | 1.72e-05 | 2.06e-20 | NA |
4. PB | Q46L27 | Phosphate import ATP-binding protein PstB | 4.09e-14 | 7.56e-03 | 1.44e-18 | NA |
4. PB | Q3K198 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 1.23e-04 | 3.09e-20 | NA |
4. PB | Q88C57 | Phosphate import ATP-binding protein PstB 2 | 1.54e-11 | 7.90e-07 | 3.81e-23 | NA |
4. PB | P75186 | Phosphate import ATP-binding protein PstB | 6.48e-11 | 7.35e-24 | 1.08e-18 | NA |
4. PB | Q8RFV0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 3.41e-02 | 1.73e-11 | NA |
4. PB | Q6GE75 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | 3.54e-02 | 2.20e-10 | NA |
4. PB | Q65HB9 | Phosphate import ATP-binding protein PstB 2 | 4.75e-12 | 5.55e-06 | 4.33e-20 | NA |
4. PB | Q72GX5 | Phosphate import ATP-binding protein PstB | 1.69e-14 | 5.81e-06 | 1.59e-22 | NA |
4. PB | Q3YW48 | Nickel import ATP-binding protein NikE | 6.11e-15 | 1.77e-03 | 2.39e-18 | NA |
4. PB | Q2J220 | Phosphate import ATP-binding protein PstB | 2.79e-12 | 6.21e-06 | 6.25e-19 | NA |
4. PB | P23888 | Polysialic acid transport ATP-binding protein KpsT | 5.73e-11 | 1.21e-02 | 1.54e-04 | NA |
4. PB | Q7NZI7 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.31e-05 | 2.64e-16 | NA |
4. PB | P9WQK1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 2.22e-16 | 4.58e-02 | 8.32e-21 | NA |
4. PB | Q9HS13 | Phosphate import ATP-binding protein PstB 1 | 3.33e-16 | 1.70e-08 | 1.32e-18 | NA |
4. PB | Q3J376 | Phosphate import ATP-binding protein PstB | 1.13e-14 | 5.74e-05 | 7.74e-14 | NA |
4. PB | P46342 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 1.15e-04 | 2.01e-22 | NA |
4. PB | Q3AXX4 | Phosphate import ATP-binding protein PstB | 4.33e-15 | 5.15e-04 | 7.55e-18 | NA |
4. PB | Q604C1 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.71e-02 | 5.80e-15 | NA |
4. PB | Q12L15 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.08e-04 | 2.57e-23 | NA |
4. PB | Q9PPV2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.92e-08 | 6.21e-06 | 2.75e-30 | NA |
4. PB | P0A2V2 | Octopine permease ATP-binding protein P | 0.00e+00 | 2.11e-02 | 1.83e-18 | NA |
4. PB | Q8FVN0 | Nickel import ATP-binding protein NikE | 4.44e-16 | 3.43e-04 | 1.42e-18 | NA |
4. PB | P69880 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.84e-10 | 1.65e-18 | NA |
4. PB | Q9PJX9 | Probable metal transport system ATP-binding protein TC_0697 | 4.79e-14 | 1.18e-02 | 3.35e-10 | NA |
4. PB | Q14J44 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.30e-02 | 8.59e-19 | NA |
4. PB | Q2SUW7 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 2.58e-10 | 2.11e-18 | NA |
4. PB | Q9Z651 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.23e-14 | 6.18e-04 | 1.37e-05 | NA |
4. PB | Q28Q03 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.92e-05 | 1.16e-13 | NA |
4. PB | Q8ZX91 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.07e-03 | 1.73e-13 | NA |
4. PB | Q98FL5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 8.59e-05 | 5.25e-20 | NA |
4. PB | Q88KY4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 2.00e-02 | 9.56e-21 | NA |
4. PB | Q9Z810 | Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 | 6.47e-14 | 8.23e-03 | 2.10e-17 | NA |
4. PB | Q3ZWN4 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.35e-03 | 2.12e-16 | NA |
4. PB | Q39S52 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.72e-03 | 6.63e-18 | NA |
4. PB | Q8UI76 | Phosphate import ATP-binding protein PstB | 6.81e-09 | 1.16e-05 | 1.36e-16 | NA |
4. PB | O34946 | High-affinity zinc uptake system ATP-binding protein ZnuC | 8.22e-13 | 3.84e-04 | 3.28e-21 | NA |
4. PB | Q5FFT1 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.48e-05 | 8.49e-17 | NA |
4. PB | Q7VMV4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 1.77e-03 | 8.67e-19 | NA |
4. PB | Q6NDA6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.81e-12 | 5.76e-04 | 1.24e-10 | NA |
4. PB | Q13W55 | Phosphate import ATP-binding protein PstB | 2.22e-16 | 6.21e-10 | 1.56e-19 | NA |
4. PB | Q4A5A4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | 3.12e-02 | 1.24e-43 | NA |
4. PB | Q1MIJ4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 6.57e-04 | 1.27e-09 | NA |
4. PB | Q6FFZ1 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.77e-09 | 2.98e-05 | 4.09e-20 | NA |
4. PB | Q1C5N7 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | 5.36e-07 | 9.86e-23 | NA |
4. PB | Q9F9B0 | Fructose import ATP-binding protein FrcA | 2.83e-10 | 1.31e-02 | 7.32e-16 | NA |
4. PB | P0DTT6 | Xylose/arabinose import ATP-binding protein XylG | 7.19e-10 | 1.84e-02 | 1.74e-13 | NA |
4. PB | P63369 | Phosphate import ATP-binding protein PstB 2 | 1.11e-16 | 1.23e-04 | 3.09e-20 | NA |
4. PB | Q1RD37 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.42e-02 | 6.53e-18 | NA |
4. PB | Q5HAV5 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 4.48e-05 | 8.49e-17 | NA |
4. PB | Q5N1G5 | Phosphate import ATP-binding protein PstB | 3.89e-15 | 3.57e-03 | 7.42e-19 | NA |
4. PB | Q87C88 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 2.40e-06 | 4.61e-18 | NA |
4. PB | Q30PC0 | Phosphate import ATP-binding protein PstB | 0.00e+00 | 1.17e-06 | 3.75e-17 | NA |
4. PB | Q2IGQ6 | Phosphate import ATP-binding protein PstB | 1.11e-16 | 1.74e-05 | 7.47e-20 | NA |
4. PB | Q9CPN2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.81e-13 | 4.38e-02 | 6.55e-06 | NA |
4. PB | Q8P8V9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | 4.85e-04 | 2.17e-14 | NA |
5. P | Q2RYF0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.03e-13 | 3.12e-03 | NA | NA |
5. P | Q21QL9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.55e-13 | 4.83e-02 | NA | NA |
5. P | Q2G9A9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.98e-11 | 6.56e-03 | NA | NA |
5. P | Q5PI55 | Cytochrome c biogenesis ATP-binding export protein CcmA 1 | 1.07e-13 | 3.77e-02 | NA | NA |
5. P | Q0A808 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.95e-13 | 1.83e-03 | NA | NA |
5. P | Q5LR15 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.44e-12 | 6.44e-04 | NA | NA |
5. P | P61378 | Cytochrome c biogenesis ATP-binding export protein CcmA 2 | 8.67e-14 | 2.75e-02 | NA | NA |
5. P | Q57M97 | Cytochrome c biogenesis ATP-binding export protein CcmA 1 | 1.11e-13 | 3.90e-02 | NA | NA |
5. P | Q166I9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.48e-13 | 1.78e-02 | NA | NA |
5. P | Q1GS38 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.34e-14 | 4.12e-02 | NA | NA |
5. P | Q3JCI7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.74e-13 | 5.54e-03 | NA | NA |
5. P | Q8ZKZ9 | Cytochrome c biogenesis ATP-binding export protein CcmA 1 | 1.14e-13 | 4.35e-02 | NA | NA |
5. P | Q5PKT6 | Cytochrome c biogenesis ATP-binding export protein CcmA 2 | 8.57e-14 | 2.08e-02 | NA | NA |
5. P | P61377 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.02e-14 | 2.75e-02 | NA | NA |
6. F | A1ABP5 | Vitamin B12 import ATP-binding protein BtuD | 9.97e-14 | NA | NA | 0.7778 |
6. F | B7US48 | Vitamin B12 import ATP-binding protein BtuD | 9.75e-14 | NA | NA | 0.7774 |
6. F | Q1RB86 | Vitamin B12 import ATP-binding protein BtuD | 9.24e-14 | NA | NA | 0.7775 |
6. F | Q8X5W0 | Vitamin B12 import ATP-binding protein BtuD | 8.96e-14 | NA | NA | 0.7772 |
6. F | Q32FJ0 | Vitamin B12 import ATP-binding protein BtuD | 8.89e-14 | NA | NA | 0.7772 |
6. F | A7ZMH7 | Vitamin B12 import ATP-binding protein BtuD | 8.86e-14 | NA | NA | 0.7773 |
6. F | O34977 | Uncharacterized ABC transporter ATP-binding protein YthP | 6.84e-11 | NA | NA | 0.7535 |
7. B | Q3IM24 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 5.88e-16 | NA |
7. B | Q8Z8A4 | Molybdenum import ATP-binding protein ModC | 8.15e-12 | NA | 1.61e-11 | NA |
7. B | Q81GC1 | Spermidine/putrescine import ATP-binding protein PotA | 8.44e-15 | NA | 5.06e-22 | NA |
7. B | A0A0H3JXA3 | Metal-staphylopine import system ATP-binding protein CntD | 1.44e-15 | NA | 7.41e-16 | NA |
7. B | O66646 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.31e-15 | NA |
7. B | P75095 | Putative ABC transporter ATP-binding protein MG014 homolog | 1.21e-09 | NA | 2.42e-15 | NA |
7. B | O31151 | UvrABC system protein A | 9.89e-03 | NA | 0.011 | NA |
7. B | Q56342 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.78e-06 | NA | 8.40e-13 | NA |
7. B | Q168E3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.44e-08 | NA |
7. B | Q2SU77 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.25e-14 | NA | 2.82e-21 | NA |
7. B | Q8FUU5 | Zinc import ATP-binding protein ZnuC | 6.47e-14 | NA | 1.14e-15 | NA |
7. B | Q00449 | Multidrug resistance protein homolog 49 | 2.85e-06 | NA | 5.13e-20 | NA |
7. B | Q81HW8 | Ribose import ATP-binding protein RbsA | 1.35e-06 | NA | 4.83e-11 | NA |
7. B | A1URR2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.22e-12 | NA | 1.41e-27 | NA |
7. B | A0A0H2ZH52 | Di/tripeptide transport ATP-binding protein DppF | 6.27e-13 | NA | 1.03e-16 | NA |
7. B | Q02Z10 | Spermidine/putrescine import ATP-binding protein PotA | 2.14e-11 | NA | 1.78e-26 | NA |
7. B | Q1RC47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 1.17e-12 | NA | 1.13e-18 | NA |
7. B | Q8U9B0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 1.79e-06 | NA | 3.47e-10 | NA |
7. B | Q7N8M2 | Methionine import ATP-binding protein MetN | 1.91e-13 | NA | 8.22e-29 | NA |
7. B | P32721 | D-allose import ATP-binding protein AlsA | 5.69e-06 | NA | 1.28e-12 | NA |
7. B | Q8YBN6 | Putative peptide import ATP-binding protein BMEII0863 | 7.04e-11 | NA | 1.64e-12 | NA |
7. B | A0LM36 | Macrolide export ATP-binding/permease protein MacB | 4.16e-07 | NA | 5.08e-12 | NA |
7. B | Q9HYT0 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 1.88e-07 | NA |
7. B | A0A1U8QKX8 | ABC multidrug transporter atrB | 1.82e-03 | NA | 3.61e-04 | NA |
7. B | Q9KLQ5 | Fe(3+) ions import ATP-binding protein FbpC | 4.36e-12 | NA | 2.78e-22 | NA |
7. B | Q0HFA0 | Molybdenum import ATP-binding protein ModC | 3.23e-12 | NA | 2.00e-20 | NA |
7. B | Q1MAL7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.03e-11 | NA | 5.34e-07 | NA |
7. B | Q4JTG9 | Methionine import ATP-binding protein MetN | 5.13e-11 | NA | 1.63e-25 | NA |
7. B | P47325 | Oligopeptide transport ATP-binding protein OppD | 1.43e-09 | NA | 1.49e-13 | NA |
7. B | Q58283 | Uncharacterized ABC transporter ATP-binding protein MJ0873 | 4.55e-15 | NA | 7.25e-21 | NA |
7. B | Q72FW5 | Spermidine/putrescine import ATP-binding protein PotA | 5.71e-12 | NA | 3.31e-24 | NA |
7. B | P54592 | Uncharacterized ABC transporter ATP-binding protein YhcH | 7.96e-13 | NA | 1.28e-21 | NA |
7. B | Q89EW7 | Molybdenum import ATP-binding protein ModC 2 | 1.26e-04 | NA | 3.60e-18 | NA |
7. B | Q608V9 | Molybdenum import ATP-binding protein ModC | 2.12e-11 | NA | 1.19e-20 | NA |
7. B | O65934 | ABC transporter ATP-binding/permease protein Rv1747 | 1.19e-06 | NA | 1.06e-12 | NA |
7. B | Q83KD5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.20e-13 | NA | 0.001 | NA |
7. B | Q63Q62 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.57e-14 | NA | 3.52e-21 | NA |
7. B | Q8GU83 | ABC transporter G family member 41 | 3.08e-04 | NA | 0.029 | NA |
7. B | Q9K789 | Methionine import ATP-binding protein MetN | 2.33e-15 | NA | 3.28e-27 | NA |
7. B | A1AA20 | Spermidine/putrescine import ATP-binding protein PotA | 1.19e-11 | NA | 5.01e-24 | NA |
7. B | Q58663 | Probable branched-chain amino acid transport ATP-binding protein LivG | 1.39e-13 | NA | 2.17e-11 | NA |
7. B | Q6LK34 | Galactose/methyl galactoside import ATP-binding protein MglA 1 | 1.90e-06 | NA | 1.62e-10 | NA |
7. B | Q2NSR0 | Hemin import ATP-binding protein HmuV | 9.99e-16 | NA | 1.51e-18 | NA |
7. B | Q1IGM2 | Taurine import ATP-binding protein TauB | 3.32e-13 | NA | 2.19e-19 | NA |
7. B | Q4L884 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.18e-36 | NA |
7. B | Q8NY21 | Methionine import ATP-binding protein MetN 1 | 4.09e-14 | NA | 7.62e-24 | NA |
7. B | B5X0E4 | ATP-binding cassette sub-family B member 5 | 9.52e-07 | NA | 5.84e-23 | NA |
7. B | Q9MAH4 | ABC transporter G family member 10 | 2.02e-06 | NA | 6.29e-08 | NA |
7. B | O14286 | Iron-sulfur clusters transporter atm1, mitochondrial | 4.48e-10 | NA | 1.00e-21 | NA |
7. B | Q1C9V1 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.33e-06 | NA | 9.12e-15 | NA |
7. B | Q8Z245 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.71e-11 | NA | 4.65e-21 | NA |
7. B | Q6G7A0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | NA |
7. B | Q8XED0 | Macrolide export ATP-binding/permease protein MacB | 1.24e-07 | NA | 1.69e-15 | NA |
7. B | Q9KUI0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.44e-09 | NA | 9.74e-26 | NA |
7. B | Q8Y7R4 | Putative ABC transporter ATP-binding protein lmo1207 | 0.00e+00 | NA | 4.18e-26 | NA |
7. B | Q9FLT5 | ABC transporter A family member 9 | 2.59e-06 | NA | 1.29e-11 | NA |
7. B | Q4QM77 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.72e-06 | NA | 1.99e-12 | NA |
7. B | P63353 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.89e-15 | NA | 1.75e-25 | NA |
7. B | Q8DFC3 | Methionine import ATP-binding protein MetN | 2.87e-13 | NA | 5.89e-25 | NA |
7. B | Q7ANN4 | Type I secretion system ATP-binding protein PrsD | 3.17e-11 | NA | 6.22e-17 | NA |
7. B | B1XG16 | Vitamin B12 import ATP-binding protein BtuD | 8.56e-14 | NA | 0.001 | NA |
7. B | P35020 | Probable ATP-dependent transporter ycf16 | 3.16e-13 | NA | 3.77e-11 | NA |
7. B | Q58639 | Uncharacterized ABC transporter ATP-binding protein MJ1242 | 1.23e-07 | NA | 8.69e-21 | NA |
7. B | Q9NP78 | ABC-type oligopeptide transporter ABCB9 | 4.12e-09 | NA | 1.13e-15 | NA |
7. B | Q1QTX6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.97e-11 | NA | 3.70e-21 | NA |
7. B | C3LLU1 | Vitamin B12 import ATP-binding protein BtuD | 8.33e-15 | NA | 9.25e-08 | NA |
7. B | P63390 | Probable ATP-binding protein YheS | 3.15e-06 | NA | 1.11e-06 | NA |
7. B | P63381 | UvrABC system protein A | 1.83e-02 | NA | 0.003 | NA |
7. B | Q1JNE0 | Methionine import ATP-binding protein MetN | 2.57e-13 | NA | 6.27e-29 | NA |
7. B | Q1C1B8 | Ribose import ATP-binding protein RbsA | 4.48e-07 | NA | 1.45e-13 | NA |
7. B | Q7W6G5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.20e-12 | NA | 6.87e-21 | NA |
7. B | Q8UC12 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.76e-11 | NA | 5.71e-08 | NA |
7. B | Q1M7W6 | Nod factor export ATP-binding protein I | 6.75e-14 | NA | 1.09e-25 | NA |
7. B | B6HV31 | ABC-type transporter adrC | 2.30e-03 | NA | 0.012 | NA |
7. B | A0AGP9 | Spermidine/putrescine import ATP-binding protein PotA | 4.87e-12 | NA | 1.02e-25 | NA |
7. B | Q47908 | ATP-dependent lipid A-core flippase | 3.72e-10 | NA | 3.54e-24 | NA |
7. B | Q54QY9 | ABC transporter H family member 4 | 1.09e-03 | NA | 1.43e-05 | NA |
7. B | Q3KJQ7 | Taurine import ATP-binding protein TauB | 1.57e-12 | NA | 6.54e-19 | NA |
7. B | Q8VQK6 | Putative peptide import ATP-binding protein BruAb2_1033 | 3.80e-11 | NA | 8.46e-17 | NA |
7. B | O42943 | Uncharacterized ABC transporter ATP-binding protein C16H5.08c | 1.92e-06 | NA | 6.84e-06 | NA |
7. B | Q61102 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 5.26e-10 | NA | 5.50e-22 | NA |
7. B | Q4WPP6 | ABC multidrug transporter mdr2 | 6.77e-09 | NA | 1.34e-23 | NA |
7. B | Q39JR1 | Arabinose import ATP-binding protein AraG 1 | 6.62e-05 | NA | 1.68e-06 | NA |
7. B | Q18AM3 | Spermidine/putrescine import ATP-binding protein PotA | 5.51e-12 | NA | 1.81e-19 | NA |
7. B | A0RBB0 | Spermidine/putrescine import ATP-binding protein PotA | 7.44e-15 | NA | 3.78e-21 | NA |
7. B | P21629 | High-affinity branched-chain amino acid transport ATP-binding protein BraF | 0.00e+00 | NA | 1.77e-13 | NA |
7. B | Q55BC0 | ABC transporter A family member 8 | 3.65e-07 | NA | 6.09e-14 | NA |
7. B | Q9KN37 | Ribose import ATP-binding protein RbsA | 3.37e-07 | NA | 3.61e-13 | NA |
7. B | Q324F4 | Molybdenum import ATP-binding protein ModC | 4.81e-12 | NA | 1.96e-12 | NA |
7. B | Q4W9C7 | ABC multidrug transporter G | 3.28e-04 | NA | 3.60e-06 | NA |
7. B | Q1CDJ0 | Ribose import ATP-binding protein RbsA | 1.19e-06 | NA | 1.45e-13 | NA |
7. B | Q8T9W1 | Serine protease/ABC transporter B family protein tagD | 2.39e-03 | NA | 1.08e-13 | NA |
7. B | Q5L3Q9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.64e-45 | NA |
7. B | Q8U7G2 | Methionine import ATP-binding protein MetN | 9.88e-15 | NA | 9.62e-20 | NA |
7. B | Q08D64 | ATP-binding cassette sub-family B member 6 | 1.08e-08 | NA | 2.34e-21 | NA |
7. B | Q2L0H5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.03e-11 | NA | 3.23e-22 | NA |
7. B | Q8EAN3 | Molybdenum import ATP-binding protein ModC | 6.04e-12 | NA | 5.35e-19 | NA |
7. B | Q1M589 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 4.14e-10 | NA | 3.47e-21 | NA |
7. B | P18767 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.47e-11 | NA | 6.52e-18 | NA |
7. B | Q399X3 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 2.06e-06 | NA | 7.25e-15 | NA |
7. B | G7CBF6 | Mycobactin import ATP-binding/permease protein IrtB | 2.03e-09 | NA | 1.06e-19 | NA |
7. B | Q4KBU0 | Methionine import ATP-binding protein MetN 3 | 1.53e-12 | NA | 3.87e-19 | NA |
7. B | Q57R58 | Macrolide export ATP-binding/permease protein MacB | 2.76e-08 | NA | 5.49e-16 | NA |
7. B | Q55DQ2 | ABC transporter G family member 11 | 5.95e-04 | NA | 0.024 | NA |
7. B | F1M3J4 | ATP-binding cassette subfamily C member 4 | 7.96e-06 | NA | 1.33e-14 | NA |
7. B | P61222 | ATP-binding cassette sub-family E member 1 | 1.23e-02 | NA | 1.14e-07 | NA |
7. B | P51241 | Probable ATP-dependent transporter ycf16 | 2.00e-14 | NA | 2.26e-09 | NA |
7. B | Q9R1X5 | ATP-binding cassette sub-family C member 5 | 3.52e-06 | NA | 3.16e-16 | NA |
7. B | P9WQL4 | Probable ribonucleotide transport ATP-binding protein mkl | 2.80e-13 | NA | 7.91e-20 | NA |
7. B | Q7N3Q4 | Vitamin B12 import ATP-binding protein BtuD | 1.59e-13 | NA | 2.04e-06 | NA |
7. B | Q47F10 | Phosphonates import ATP-binding protein PhnC | 5.55e-16 | NA | 5.90e-09 | NA |
7. B | Q9ESR9 | ATP-binding cassette sub-family A member 2 | 1.81e-02 | NA | 5.58e-17 | NA |
7. B | P63373 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 9.93e-21 | NA |
7. B | P0A194 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 0.00e+00 | NA | 1.82e-15 | NA |
7. B | Q9RDI1 | Ribose import ATP-binding protein RbsA 2 | 5.52e-07 | NA | 1.96e-13 | NA |
7. B | A1C8C8 | ABC-type transporter oblD | 4.51e-03 | NA | 0.005 | NA |
7. B | Q65UW1 | Galactose/methyl galactoside import ATP-binding protein MglA | 3.35e-06 | NA | 7.98e-13 | NA |
7. B | Q8E3S6 | Putative ABC transporter ATP-binding protein gbs1680 | 5.78e-09 | NA | 6.89e-31 | NA |
7. B | Q9FWX8 | ABC transporter B family member 12 | 6.81e-07 | NA | 1.67e-24 | NA |
7. B | Q2T4B3 | Macrolide export ATP-binding/permease protein MacB | 2.13e-09 | NA | 7.96e-10 | NA |
7. B | Q1MAB5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.85e-11 | NA | 7.77e-19 | NA |
7. B | Q8DU24 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 3.18e-21 | NA |
7. B | Q63120 | ATP-binding cassette sub-family C member 2 | 3.33e-06 | NA | 6.83e-16 | NA |
7. B | Q0BG60 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 2.09e-06 | NA | 2.73e-15 | NA |
7. B | Q1CNC6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 8.01e-11 | NA | 1.51e-19 | NA |
7. B | P47260 | Putative ABC transporter ATP-binding protein MG014 | 1.79e-10 | NA | 3.10e-16 | NA |
7. B | Q0I3Y9 | Spermidine/putrescine import ATP-binding protein PotA | 7.50e-12 | NA | 2.53e-27 | NA |
7. B | Q0TI47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 1.46e-12 | NA | 6.66e-19 | NA |
7. B | Q0SFW6 | Methionine import ATP-binding protein MetN 2 | 6.01e-14 | NA | 5.32e-26 | NA |
7. B | Q7N6F9 | Macrolide export ATP-binding/permease protein MacB | 2.05e-08 | NA | 2.81e-16 | NA |
7. B | Q6G2E2 | Methionine import ATP-binding protein MetN | 3.58e-13 | NA | 1.52e-25 | NA |
7. B | Q7FB56 | Putative ABC transporter C family member 15 | 1.16e-06 | NA | 5.49e-15 | NA |
7. B | Q1JUP7 | Arabinose import ATP-binding protein AraG | 3.86e-06 | NA | 1.04e-11 | NA |
7. B | Q48GY7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 4.82e-07 | NA | 1.82e-12 | NA |
7. B | A1B677 | Macrolide export ATP-binding/permease protein MacB 1/2 | 3.47e-09 | NA | 1.04e-11 | NA |
7. B | Q0P9X7 | Probable ABC transporter ATP-binding protein PEB1C | 0.00e+00 | NA | 5.76e-24 | NA |
7. B | P9WQK3 | Energy-dependent translational throttle protein EttA | 1.26e-04 | NA | 6.10e-09 | NA |
7. B | Q5BAY0 | ABC multidrug transporter atrD | 2.74e-06 | NA | 2.00e-24 | NA |
7. B | Q6GH27 | Nickel import system ATP-binding protein NikD | 9.58e-12 | NA | 6.64e-09 | NA |
7. B | Q6HP89 | Methionine import ATP-binding protein MetN 1 | 9.99e-16 | NA | 1.18e-27 | NA |
7. B | Q8FFR2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.35e-13 | NA | 0.003 | NA |
7. B | Q2EHL8 | Macrolide export ATP-binding/permease protein MacB | 3.82e-08 | NA | 7.10e-16 | NA |
7. B | Q6NDQ0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.30e-11 | NA | 2.28e-25 | NA |
7. B | P0CZ37 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.65e-21 | NA |
7. B | Q815Y7 | Methionine import ATP-binding protein MetN 3 | 7.77e-16 | NA | 3.13e-25 | NA |
7. B | Q7MEV1 | Ribose import ATP-binding protein RbsA | 8.68e-07 | NA | 6.71e-11 | NA |
7. B | Q9PR37 | Spermidine/putrescine import ATP-binding protein PotA | 9.90e-05 | NA | 3.46e-13 | NA |
7. B | Q57SD6 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 2.55e-10 | NA | 3.60e-22 | NA |
7. B | Q8CF82 | Cholesterol transporter ABCA5 | 3.10e-04 | NA | 1.21e-15 | NA |
7. B | Q5HRU5 | Methionine import ATP-binding protein MetN 1 | 4.13e-13 | NA | 3.59e-21 | NA |
7. B | Q9RR46 | Glycine betaine/carnitine transport ATP-binding protein GbuA | 6.17e-13 | NA | 4.56e-29 | NA |
7. B | Q1QVQ7 | Methionine import ATP-binding protein MetN | 1.78e-15 | NA | 4.64e-20 | NA |
7. B | Q6LG59 | Galactose/methyl galactoside import ATP-binding protein MglA 2 | 4.78e-06 | NA | 2.01e-12 | NA |
7. B | P35071 | Cystic fibrosis transmembrane conductance regulator | 1.02e-04 | NA | 7.22e-10 | NA |
7. B | Q9EXN5 | Probable microcin-H47 secretion/processing ATP-binding protein MchF | 6.04e-08 | NA | 1.74e-13 | NA |
7. B | Q5E0T4 | Molybdenum import ATP-binding protein ModC | 7.79e-12 | NA | 2.59e-17 | NA |
7. B | Q9WYV0 | UvrABC system protein A | 6.64e-03 | NA | 3.53e-04 | NA |
7. B | O34863 | UvrABC system protein A | 1.40e-02 | NA | 0.014 | NA |
7. B | Q87AL9 | Methionine import ATP-binding protein MetN | 5.55e-16 | NA | 1.51e-25 | NA |
7. B | Q98M36 | UvrABC system protein A | 1.20e-02 | NA | 0.028 | NA |
7. B | Q2QLB4 | Cystic fibrosis transmembrane conductance regulator | 9.10e-05 | NA | 4.97e-11 | NA |
7. B | Q32JQ8 | Methionine import ATP-binding protein MetN | 4.03e-13 | NA | 1.74e-24 | NA |
7. B | Q73F11 | Methionine import ATP-binding protein MetN 1 | 2.86e-14 | NA | 2.55e-20 | NA |
7. B | Q8UAK2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 1.92e-06 | NA | 1.02e-13 | NA |
7. B | O34512 | Uncharacterized ABC transporter ATP-binding protein YfmM | 2.44e-06 | NA | 1.17e-08 | NA |
7. B | Q20Y31 | Phosphonates import ATP-binding protein PhnC 2 | 4.66e-15 | NA | 2.03e-16 | NA |
7. B | O86311 | Multidrug efflux system ATP-binding protein Rv1218c | 1.27e-10 | NA | 1.78e-09 | NA |
7. B | Q0S9A4 | Ribose import ATP-binding protein RbsA | 1.42e-05 | NA | 2.16e-09 | NA |
7. B | Q0BIE1 | Arabinose import ATP-binding protein AraG 1 | 5.31e-06 | NA | 5.75e-08 | NA |
7. B | Q11SW8 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 3.51e-16 | NA |
7. B | P54683 | Serine protease/ABC transporter B family protein tagB | 2.09e-04 | NA | 9.22e-15 | NA |
7. B | P72335 | Nod factor export ATP-binding protein I | 1.75e-14 | NA | 1.45e-24 | NA |
7. B | Q5HQ70 | Spermidine/putrescine import ATP-binding protein PotA | 2.11e-12 | NA | 2.80e-18 | NA |
7. B | Q1BGC0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 5.60e-04 | NA | 7.99e-10 | NA |
7. B | Q3YUV0 | Maltose/maltodextrin import ATP-binding protein MalK | 3.29e-11 | NA | 7.18e-24 | NA |
7. B | Q9ZR72 | ABC transporter B family member 1 | 1.99e-06 | NA | 8.11e-23 | NA |
7. B | Q9KZW2 | Phosphate import ATP-binding protein PstB | 3.11e-15 | NA | 2.03e-19 | NA |
7. B | Q03PF2 | Spermidine/putrescine import ATP-binding protein PotA | 2.50e-14 | NA | 6.64e-22 | NA |
7. B | Q108U0 | Cystic fibrosis transmembrane conductance regulator | 9.41e-05 | NA | 5.58e-11 | NA |
7. B | Q5PJX5 | Ribose import ATP-binding protein RbsA | 4.54e-07 | NA | 2.62e-12 | NA |
7. B | Q0TIU8 | Spermidine/putrescine import ATP-binding protein PotA | 1.16e-11 | NA | 4.73e-24 | NA |
7. B | P37313 | Dipeptide transport ATP-binding protein DppF | 9.68e-13 | NA | 4.05e-21 | NA |
7. B | Q6D4W8 | Arabinose import ATP-binding protein AraG | 1.97e-06 | NA | 2.85e-14 | NA |
7. B | P32010 | Daunorubicin/doxorubicin resistance ATP-binding protein DrrA | 4.75e-11 | NA | 1.83e-13 | NA |
7. B | Q3Z2S7 | Arabinose import ATP-binding protein AraG | 4.54e-06 | NA | 9.81e-11 | NA |
7. B | Q9DC29 | ATP-binding cassette sub-family B member 6 | 9.42e-09 | NA | 7.82e-22 | NA |
7. B | Q2IXX0 | Macrolide export ATP-binding/permease protein MacB | 1.37e-08 | NA | 1.60e-14 | NA |
7. B | Q27256 | Protein white | 1.90e-06 | NA | 3.10e-05 | NA |
7. B | O86751 | Fe(3+) ions import ATP-binding protein FbpC | 1.77e-14 | NA | 2.97e-22 | NA |
7. B | Q9KLL9 | Molybdenum import ATP-binding protein ModC | 1.20e-11 | NA | 1.14e-19 | NA |
7. B | P0AAH6 | Peptide transport system ATP-binding protein SapD | 6.11e-11 | NA | 1.52e-16 | NA |
7. B | Q0K4I1 | Phosphonates import ATP-binding protein PhnC 1 | 1.11e-15 | NA | 1.18e-07 | NA |
7. B | Q63NR0 | Hemin import ATP-binding protein HmuV | 3.00e-15 | NA | 8.88e-04 | NA |
7. B | Q2K2X0 | Molybdenum import ATP-binding protein ModC | 5.83e-12 | NA | 5.41e-17 | NA |
7. B | Q57RB2 | Glutathione import ATP-binding protein GsiA | 6.62e-07 | NA | 2.43e-18 | NA |
7. B | P32386 | ATP-dependent bile acid permease | 2.72e-05 | NA | 5.81e-20 | NA |
7. B | P54719 | Uncharacterized ABC transporter ATP-binding protein YfiC | 1.03e-11 | NA | 6.79e-18 | NA |
7. B | P43535 | Protein GCN20 | 1.32e-05 | NA | 4.62e-07 | NA |
7. B | Q8X5D9 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.05e-06 | NA | 1.66e-13 | NA |
7. B | Q1JGY7 | Spermidine/putrescine import ATP-binding protein PotA | 3.55e-12 | NA | 7.14e-27 | NA |
7. B | Q2KAW9 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 2.40e-06 | NA | 3.99e-09 | NA |
7. B | Q54VC1 | ABC transporter C family member 15 | 3.02e-06 | NA | 1.28e-18 | NA |
7. B | Q9FWX7 | ABC transporter B family member 11 | 1.59e-06 | NA | 1.21e-24 | NA |
7. B | Q0I2Z4 | Fe(3+) ions import ATP-binding protein FbpC | 7.23e-12 | NA | 9.79e-21 | NA |
7. B | O80946 | ABC transporter G family member 1 | 4.02e-05 | NA | 2.96e-06 | NA |
7. B | Q2SZC2 | Arabinose import ATP-binding protein AraG 1 | 9.65e-06 | NA | 4.26e-07 | NA |
7. B | Q1J450 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q2SJ99 | Ribose import ATP-binding protein RbsA | 9.13e-06 | NA | 3.75e-14 | NA |
7. B | Q3Z006 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.39e-13 | NA | 0.002 | NA |
7. B | Q8XHV3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.32e-44 | NA |
7. B | Q5MZ53 | Bicarbonate transport ATP-binding protein CmpD | 1.92e-12 | NA | 1.32e-24 | NA |
7. B | Q322L1 | Arabinose import ATP-binding protein AraG | 4.96e-06 | NA | 1.09e-10 | NA |
7. B | P22520 | Colicin V secretion/processing ATP-binding protein CvaB | 2.26e-08 | NA | 2.84e-13 | NA |
7. B | Q9HYF9 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 3.14e-10 | NA | 5.69e-13 | NA |
7. B | Q48C94 | Taurine import ATP-binding protein TauB | 3.70e-13 | NA | 7.12e-19 | NA |
7. B | Q4KDI2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 5.28e-07 | NA | 2.87e-11 | NA |
7. B | Q1CNR8 | Maltose/maltodextrin import ATP-binding protein MalK | 3.46e-11 | NA | 2.75e-26 | NA |
7. B | Q1C951 | Molybdenum import ATP-binding protein ModC | 9.20e-12 | NA | 4.09e-19 | NA |
7. B | Q8X6W1 | Glutathione import ATP-binding protein GsiA | 6.51e-07 | NA | 2.59e-18 | NA |
7. B | Q65F80 | Methionine import ATP-binding protein MetN 2 | 8.88e-16 | NA | 1.22e-28 | NA |
7. B | P30769 | Probable ribonucleotide transport ATP-binding protein mkl | 5.55e-13 | NA | 9.67e-19 | NA |
7. B | Q8G0T8 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.37e-11 | NA | 2.58e-19 | NA |
7. B | Q48J29 | Molybdenum import ATP-binding protein ModC | 2.67e-12 | NA | 5.90e-18 | NA |
7. B | Q8CRB0 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | NA | 1.44e-10 | NA |
7. B | P63352 | Vitamin B12 import ATP-binding protein BtuD | 6.26e-14 | NA | 2.78e-06 | NA |
7. B | O52618 | Nod factor export ATP-binding protein I | 8.80e-11 | NA | 6.65e-22 | NA |
7. B | O42690 | Opaque-specific ABC transporter CDR3 | 3.90e-03 | NA | 0.042 | NA |
7. B | Q7NQN5 | Spermidine/putrescine import ATP-binding protein PotA | 1.83e-11 | NA | 5.14e-21 | NA |
7. B | Q6DB03 | Xylose import ATP-binding protein XylG | 3.78e-06 | NA | 9.06e-12 | NA |
7. B | Q2IBE4 | Cystic fibrosis transmembrane conductance regulator | 8.46e-05 | NA | 8.97e-12 | NA |
7. B | P21630 | High-affinity branched-chain amino acid transport ATP-binding protein BraG | 0.00e+00 | NA | 1.02e-11 | NA |
7. B | P9WQL7 | Fluoroquinolones export ATP-binding protein Rv2688c | 1.03e-09 | NA | 7.09e-19 | NA |
7. B | Q39AT4 | Methionine import ATP-binding protein MetN 2 | 1.02e-14 | NA | 3.04e-21 | NA |
7. B | Q88RL1 | Zinc import ATP-binding protein ZnuC | 1.93e-14 | NA | 2.05e-15 | NA |
7. B | Q2SMT0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 4.01e-06 | NA | 3.53e-12 | NA |
7. B | Q8UCM5 | Hemin import ATP-binding protein HmuV | 1.07e-14 | NA | 2.78e-09 | NA |
7. B | Q1XDP6 | Probable ATP-dependent transporter ycf16 | 3.54e-13 | NA | 7.47e-10 | NA |
7. B | Q9NUQ8 | ATP-binding cassette sub-family F member 3 | 1.35e-06 | NA | 1.75e-08 | NA |
7. B | Q8P8M1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.52e-13 | NA | 4.40e-09 | NA |
7. B | F2PRR1 | ABC multidrug transporter MDR2 | 3.65e-06 | NA | 1.33e-19 | NA |
7. B | O84337 | UvrABC system protein A | 1.61e-01 | NA | 0.049 | NA |
7. B | Q0TNZ3 | Spermidine/putrescine import ATP-binding protein PotA | 3.81e-12 | NA | 3.01e-22 | NA |
7. B | Q7UPK3 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 8.85e-12 | NA | 1.11e-11 | NA |
7. B | A1USS5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.07e-11 | NA | 2.57e-21 | NA |
7. B | Q00552 | Cystic fibrosis transmembrane conductance regulator | 8.63e-05 | NA | 1.85e-11 | NA |
7. B | Q839D4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.10e-52 | NA |
7. B | Q3J3V9 | Ribose import ATP-binding protein RbsA | 8.78e-06 | NA | 1.32e-14 | NA |
7. B | A0R4C0 | Phosphate import ATP-binding protein PstB | 2.00e-15 | NA | 4.56e-11 | NA |
7. B | Q7W1F4 | Molybdenum import ATP-binding protein ModC | 6.03e-12 | NA | 4.21e-17 | NA |
7. B | Q6LKD4 | Fe(3+) ions import ATP-binding protein FbpC | 3.98e-12 | NA | 3.10e-19 | NA |
7. B | Q8K448 | Cholesterol transporter ABCA5 | 1.44e-04 | NA | 4.38e-16 | NA |
7. B | Q46577 | UvrABC system protein A | 1.19e-02 | NA | 0.022 | NA |
7. B | A1A9B7 | Macrolide export ATP-binding/permease protein MacB 1 | 1.20e-07 | NA | 2.84e-16 | NA |
7. B | P0A4W5 | Uncharacterized ABC transporter ATP-binding protein Mb1304c | 2.07e-10 | NA | 1.73e-15 | NA |
7. B | P0C529 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.15e-11 | NA | 1.29e-18 | NA |
7. B | Q9NGP5 | ABC transporter G family member 2 | 2.84e-04 | NA | 0.005 | NA |
7. B | Q83J33 | Xylose import ATP-binding protein XylG | 4.50e-06 | NA | 5.16e-12 | NA |
7. B | O93796 | Elongation factor 3 | 1.49e-03 | NA | 0.002 | NA |
7. B | Q0WER5 | Arabinose import ATP-binding protein AraG | 1.80e-05 | NA | 6.74e-17 | NA |
7. B | Q66H39 | ATP-binding cassette sub-family F member 3 | 1.35e-06 | NA | 5.82e-08 | NA |
7. B | Q1CR30 | Methionine import ATP-binding protein MetN | 1.01e-13 | NA | 3.58e-23 | NA |
7. B | Q8YIT2 | Macrolide export ATP-binding/permease protein MacB | 4.45e-08 | NA | 1.62e-09 | NA |
7. B | Q8G847 | Fructose import ATP-binding protein FruK | 8.24e-06 | NA | 3.55e-13 | NA |
7. B | P14788 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.62e-10 | NA | 3.15e-28 | NA |
7. B | Q87HN4 | Molybdenum import ATP-binding protein ModC | 6.79e-12 | NA | 1.19e-20 | NA |
7. B | Q2YRG7 | Macrolide export ATP-binding/permease protein MacB | 4.24e-08 | NA | 2.85e-09 | NA |
7. B | Q8GU82 | ABC transporter G family member 45 | 5.06e-04 | NA | 0.035 | NA |
7. B | Q8TQ05 | Putative ABC transporter ATP-binding protein MA_1747 | 1.87e-08 | NA | 1.47e-30 | NA |
7. B | Q5PJL1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.75e-11 | NA | 1.91e-21 | NA |
7. B | Q9FKF2 | ABC transporter A family member 11 | 1.63e-06 | NA | 7.16e-11 | NA |
7. B | Q13ZJ1 | Nod factor export ATP-binding protein I | 3.45e-14 | NA | 3.77e-17 | NA |
7. B | O32188 | Probable siderophore transport system ATP-binding protein YusV | 0.00e+00 | NA | 2.07e-16 | NA |
7. B | P45094 | Dipeptide transport ATP-binding protein DppF | 1.80e-13 | NA | 3.95e-23 | NA |
7. B | P40550 | ATP-dependent permease PDR11 | 4.15e-03 | NA | 4.33e-05 | NA |
7. B | Q0K998 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.17e-11 | NA | 1.17e-23 | NA |
7. B | Q97UY8 | Glucose import ATP-binding protein GlcV | 5.25e-11 | NA | 4.49e-21 | NA |
7. B | Q54T02 | ABC transporter G family member 24 | 5.08e-04 | NA | 5.03e-05 | NA |
7. B | Q5E715 | Methionine import ATP-binding protein MetN | 2.74e-13 | NA | 3.89e-25 | NA |
7. B | P0AAH7 | Peptide transport system ATP-binding protein SapD | 6.75e-11 | NA | 1.52e-16 | NA |
7. B | Q62K91 | Ribose import ATP-binding protein RbsA | 1.45e-04 | NA | 2.49e-12 | NA |
7. B | P30963 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.32e-12 | NA | 0.006 | NA |
7. B | Q72RM8 | UvrABC system protein A | 4.50e-03 | NA | 0.019 | NA |
7. B | Q8D0W8 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.24e-13 | NA | 1.25e-25 | NA |
7. B | Q5XBY7 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.72e-21 | NA |
7. B | Q8UKE4 | Macrolide export ATP-binding/permease protein MacB | 9.87e-08 | NA | 2.53e-12 | NA |
7. B | Q8RFN2 | Methionine import ATP-binding protein MetN | 1.60e-13 | NA | 2.51e-28 | NA |
7. B | Q2YKX3 | Fe(3+) ions import ATP-binding protein FbpC | 5.22e-14 | NA | 5.34e-24 | NA |
7. B | Q89TQ9 | Molybdenum import ATP-binding protein ModC 1 | 4.73e-11 | NA | 0.001 | NA |
7. B | Q2FII2 | Methionine import ATP-binding protein MetN 2 | 3.84e-13 | NA | 1.65e-26 | NA |
7. B | Q2QL83 | Cystic fibrosis transmembrane conductance regulator | 8.48e-05 | NA | 3.40e-11 | NA |
7. B | Q4WUS1 | ABC multidrug transporter I | 8.30e-04 | NA | 0.001 | NA |
7. B | Q1CG91 | Methionine import ATP-binding protein MetN 1 | 5.54e-13 | NA | 5.57e-19 | NA |
7. B | Q9CP98 | Ribose import ATP-binding protein RbsA 1 | 4.40e-07 | NA | 1.18e-12 | NA |
7. B | P0CZ29 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.37e-66 | NA |
7. B | Q6Y306 | ATP-binding cassette sub-family C member 12 | 1.76e-06 | NA | 2.31e-14 | NA |
7. B | Q7Z991 | ABC transporter domain-containing protein C20G4.01 | 4.48e-09 | NA | 1.85e-07 | NA |
7. B | Q8D9J4 | Spermidine/putrescine import ATP-binding protein PotA | 4.46e-11 | NA | 4.66e-27 | NA |
7. B | Q6GJL2 | Methionine import ATP-binding protein MetN 1 | 4.03e-14 | NA | 1.37e-23 | NA |
7. B | Q5RKI8 | Mitochondrial potassium channel ATP-binding subunit | 4.53e-09 | NA | 2.22e-15 | NA |
7. B | Q8Z864 | Glutathione import ATP-binding protein GsiA | 7.16e-07 | NA | 2.84e-18 | NA |
7. B | Q8ELR4 | Spermidine/putrescine import ATP-binding protein PotA | 1.27e-14 | NA | 2.11e-23 | NA |
7. B | Q0B7X0 | Ribose import ATP-binding protein RbsA 2 | 9.23e-06 | NA | 6.34e-14 | NA |
7. B | Q8XXY9 | Nod factor export ATP-binding protein I | 3.64e-11 | NA | 2.26e-23 | NA |
7. B | Q2FH57 | Nickel import system ATP-binding protein NikD | 1.14e-11 | NA | 6.22e-08 | NA |
7. B | A0A0U1LQE1 | ABC transporter cctS | 1.46e-05 | NA | 1.10e-15 | NA |
7. B | Q0HHH4 | ATP-dependent lipid A-core flippase | 5.25e-11 | NA | 1.66e-21 | NA |
7. B | Q5LXJ4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 6.20e-47 | NA |
7. B | Q9M0G9 | ABC transporter B family member 24, mitochondrial | 1.49e-10 | NA | 1.89e-22 | NA |
7. B | Q7MIR0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.41e-14 | NA | 1.82e-05 | NA |
7. B | Q7NX01 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 7.16e-12 | NA | 4.24e-28 | NA |
7. B | B5QVV9 | Vitamin B12 import ATP-binding protein BtuD | 6.21e-14 | NA | 2.63e-06 | NA |
7. B | Q8E2L3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.27e-41 | NA |
7. B | A3CMQ7 | Spermidine/putrescine import ATP-binding protein PotA | 3.10e-12 | NA | 2.32e-24 | NA |
7. B | A0A2U8U2K9 | ABC transporter asL7 | 7.25e-04 | NA | 0.048 | NA |
7. B | Q4L9P7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.83e-11 | NA |
7. B | P0CZ34 | Spermidine/putrescine import ATP-binding protein PotA | 2.61e-12 | NA | 4.40e-27 | NA |
7. B | Q1BWI2 | Nod factor export ATP-binding protein I | 4.24e-14 | NA | 1.15e-20 | NA |
7. B | Q06034 | Multidrug resistance protein 1 | 9.66e-06 | NA | 5.06e-17 | NA |
7. B | G5EE72 | Multidrug resistance-associated protein 5 | 2.12e-06 | NA | 6.70e-17 | NA |
7. B | P23596 | Proteases secretion ATP-binding protein PrtD | 1.43e-11 | NA | 7.22e-12 | NA |
7. B | Q8NSN2 | Methionine import ATP-binding protein MetN | 6.21e-12 | NA | 3.21e-28 | NA |
7. B | Q09427 | ATP-binding cassette sub-family C member 8 | 4.37e-06 | NA | 2.12e-11 | NA |
7. B | Q8K268 | ATP-binding cassette sub-family F member 3 | 1.46e-06 | NA | 2.54e-09 | NA |
7. B | Q7VUJ5 | Molybdenum import ATP-binding protein ModC | 6.47e-12 | NA | 3.21e-17 | NA |
7. B | Q3A558 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.06e-16 | NA |
7. B | P68579 | SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT | 3.60e-08 | NA | 2.34e-09 | NA |
7. B | Q28QF9 | Hemin import ATP-binding protein HmuV | 4.46e-14 | NA | 2.68e-07 | NA |
7. B | Q32DZ9 | Macrolide export ATP-binding/permease protein MacB | 8.08e-08 | NA | 9.89e-16 | NA |
7. B | Q2FRT7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.36e-48 | NA |
7. B | P14175 | Glycine betaine/proline betaine transport system ATP-binding protein ProV | 4.02e-12 | NA | 5.93e-30 | NA |
7. B | K0E4D9 | ABC transporter ecdL | 9.51e-06 | NA | 2.03e-12 | NA |
7. B | Q8UBN2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 3.89e-06 | NA | 2.56e-11 | NA |
7. B | Q0SY86 | Xylose import ATP-binding protein XylG | 4.47e-06 | NA | 8.58e-12 | NA |
7. B | Q07DV2 | Cystic fibrosis transmembrane conductance regulator | 8.22e-05 | NA | 2.02e-11 | NA |
7. B | Q4UJW4 | UvrABC system protein A | 1.75e-02 | NA | 0.012 | NA |
7. B | P0AAG9 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.43e-06 | NA | 1.74e-13 | NA |
7. B | Q2QLF9 | Cystic fibrosis transmembrane conductance regulator | 1.01e-04 | NA | 1.76e-11 | NA |
7. B | Q5KYQ7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 3.17e-06 | NA | 4.43e-11 | NA |
7. B | Q7WGW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.84e-13 | NA | 1.68e-31 | NA |
7. B | Q3YW77 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.83e-11 | NA | 4.23e-23 | NA |
7. B | Q5W274 | Pleiotropic drug resistance protein 3 | 3.01e-04 | NA | 0.004 | NA |
7. B | B5FJ99 | Vitamin B12 import ATP-binding protein BtuD | 6.59e-14 | NA | 2.78e-06 | NA |
7. B | P33593 | Nickel import ATP-binding protein NikD | 2.55e-15 | NA | 1.85e-13 | NA |
7. B | Q8YM92 | Spermidine/putrescine import ATP-binding protein PotA | 5.77e-14 | NA | 4.56e-23 | NA |
7. B | Q32IG0 | Molybdenum import ATP-binding protein ModC | 5.34e-12 | NA | 1.73e-12 | NA |
7. B | P9WQI2 | Trehalose import ATP-binding protein SugC | 6.07e-12 | NA | 2.09e-21 | NA |
7. B | Q0B5V4 | Arabinose import ATP-binding protein AraG 2 | 1.73e-06 | NA | 1.12e-11 | NA |
7. B | Q6G475 | Hemin import ATP-binding protein HmuV | 2.56e-14 | NA | 3.56e-06 | NA |
7. B | Q1GAN9 | Methionine import ATP-binding protein MetN | 5.43e-12 | NA | 2.47e-21 | NA |
7. B | P44656 | Uncharacterized ABC transporter ATP-binding protein HI_0354 | 3.42e-10 | NA | 9.71e-13 | NA |
7. B | A1UG51 | Spermidine/putrescine import ATP-binding protein PotA | 8.90e-11 | NA | 1.46e-17 | NA |
7. B | P0A698 | UvrABC system protein A | 1.51e-02 | NA | 0.036 | NA |
7. B | Q58967 | Putative ABC transporter ATP-binding protein MJ1572 | 0.00e+00 | NA | 2.57e-29 | NA |
7. B | Q74L62 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.53e-69 | NA |
7. B | P45861 | Uncharacterized ABC transporter ATP-binding protein YwjA | 1.27e-11 | NA | 1.13e-20 | NA |
7. B | Q32EX7 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.77e-17 | NA |
7. B | Q3B5J7 | Macrolide export ATP-binding/permease protein MacB | 1.09e-07 | NA | 6.52e-15 | NA |
7. B | Q8GQ92 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.88e-15 | NA | 3.75e-05 | NA |
7. B | Q8ETV6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.85e-48 | NA |
7. B | B2RX12 | ATP-binding cassette sub-family C member 3 | 2.68e-06 | NA | 7.06e-17 | NA |
7. B | O15440 | ATP-binding cassette sub-family C member 5 | 3.05e-06 | NA | 3.62e-16 | NA |
7. B | A0B1M7 | Ribose import ATP-binding protein RbsA 2 | 7.65e-06 | NA | 3.56e-12 | NA |
7. B | Q13VD7 | Methionine import ATP-binding protein MetN 1 | 4.59e-14 | NA | 1.05e-25 | NA |
7. B | Q1JGL3 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.67e-21 | NA |
7. B | Q03PY6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 8.45e-46 | NA |
7. B | Q254K9 | Methionine import ATP-binding protein MetN | 5.82e-13 | NA | 6.96e-19 | NA |
7. B | O15438 | ATP-binding cassette sub-family C member 3 | 2.86e-06 | NA | 9.50e-20 | NA |
7. B | Q8P2L5 | Oligopeptide transport ATP-binding protein OppF | 1.06e-13 | NA | 1.22e-18 | NA |
7. B | Q13FD9 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 1.21e-06 | NA | 7.33e-13 | NA |
7. B | P19566 | Maltose/maltodextrin import ATP-binding protein MalK | 1.23e-14 | NA | 5.35e-25 | NA |
7. B | Q2K342 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.25e-11 | NA | 9.94e-19 | NA |
7. B | Q54BU4 | ABC transporter B family member 1 | 2.60e-07 | NA | 5.35e-18 | NA |
7. B | Q8Z2R4 | Ribose import ATP-binding protein RbsA | 4.20e-07 | NA | 2.70e-12 | NA |
7. B | Q3JHM1 | Hemin import ATP-binding protein HmuV | 2.15e-14 | NA | 8.88e-04 | NA |
7. B | Q0RYP7 | Fe(3+) ions import ATP-binding protein FbpC 3 | 4.60e-13 | NA | 6.05e-24 | NA |
7. B | A0A125QXJ1 | ATP-binding cassette sub-family B member 6 | 8.56e-09 | NA | 3.92e-21 | NA |
7. B | Q83LR7 | Macrolide export ATP-binding/permease protein MacB | 1.11e-07 | NA | 1.27e-16 | NA |
7. B | Q14H97 | Methionine import ATP-binding protein MetN | 2.89e-13 | NA | 1.74e-23 | NA |
7. B | O32169 | Methionine import ATP-binding protein MetN | 2.66e-15 | NA | 1.94e-28 | NA |
7. B | Q9FLT4 | ABC transporter A family member 10 | 5.04e-06 | NA | 9.83e-09 | NA |
7. B | Q04CG8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 4.73e-16 | NA |
7. B | Q8T690 | ABC transporter G family member 3 | 5.10e-04 | NA | 1.57e-06 | NA |
7. B | Q9ZKW3 | Probable iron chelatin transport ATP-binding protein jhp_0821 | 2.33e-15 | NA | 0.013 | NA |
7. B | Q9A1G5 | Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242 | 7.21e-10 | NA | 4.60e-07 | NA |
7. B | Q6WB63 | Phosphonates import ATP-binding protein PhnC | 6.77e-15 | NA | 2.05e-15 | NA |
7. B | P07821 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 0.00e+00 | NA | 1.19e-11 | NA |
7. B | Q99VG8 | Methionine import ATP-binding protein MetN 2 | 3.35e-13 | NA | 2.16e-26 | NA |
7. B | Q4QK57 | Spermidine/putrescine import ATP-binding protein PotA | 1.80e-11 | NA | 2.53e-28 | NA |
7. B | Q16928 | Protein white | 8.11e-06 | NA | 0.006 | NA |
7. B | Q577J5 | Putative peptide import ATP-binding protein BruAb2_0796 | 6.29e-11 | NA | 3.09e-12 | NA |
7. B | Q2J1U0 | Molybdenum import ATP-binding protein ModC | 1.68e-07 | NA | 4.56e-16 | NA |
7. B | Q1BG93 | Xylose import ATP-binding protein XylG | 7.50e-06 | NA | 1.66e-10 | NA |
7. B | P0CZ26 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.10e-44 | NA |
7. B | P77268 | Probable D,D-dipeptide transport ATP-binding protein DdpD | 6.55e-12 | NA | 3.95e-14 | NA |
7. B | B7VPD0 | Vitamin B12 import ATP-binding protein BtuD | 2.05e-13 | NA | 1.24e-07 | NA |
7. B | Q24XJ2 | Spermidine/putrescine import ATP-binding protein PotA | 1.30e-14 | NA | 4.74e-23 | NA |
7. B | A0PY57 | Spermidine/putrescine import ATP-binding protein PotA | 5.04e-12 | NA | 4.77e-22 | NA |
7. B | Q8ZGX6 | Molybdenum import ATP-binding protein ModC | 5.89e-12 | NA | 4.09e-19 | NA |
7. B | Q32AY3 | Hemin import ATP-binding protein HmuV | 3.22e-15 | NA | 7.46e-18 | NA |
7. B | Q8YUV1 | Phosphonates import ATP-binding protein PhnC 1 | 1.81e-14 | NA | 9.24e-21 | NA |
7. B | Q1CIX6 | Arabinose import ATP-binding protein AraG | 1.78e-05 | NA | 6.74e-17 | NA |
7. B | Q86UK0 | Glucosylceramide transporter ABCA12 | 4.42e-03 | NA | 7.75e-13 | NA |
7. B | A2RI78 | Dipeptide transport ATP-binding protein DppF | 1.47e-14 | NA | 4.01e-16 | NA |
7. B | Q5ANA3 | Pleiotropic ABC efflux transporter of multiple drugs CDR1 | 1.27e-03 | NA | 0.005 | NA |
7. B | Q1B3B4 | Phosphate import ATP-binding protein PstB | 1.89e-15 | NA | 4.69e-11 | NA |
7. B | O15439 | ATP-binding cassette sub-family C member 4 | 8.75e-06 | NA | 3.22e-15 | NA |
7. B | Q8RHK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.30e-36 | NA |
7. B | Q57855 | Uncharacterized ABC transporter ATP-binding protein MJ0412 | 2.63e-12 | NA | 2.26e-23 | NA |
7. B | P44785 | Methionine import ATP-binding protein MetN | NA | NA | 5.34e-27 | NA |
7. B | Q5P4W2 | Molybdenum import ATP-binding protein ModC | 5.04e-08 | NA | 1.89e-21 | NA |
7. B | Q60AI1 | Spermidine/putrescine import ATP-binding protein PotA | 1.91e-09 | NA | 7.09e-21 | NA |
7. B | Q8FRX8 | Methionine import ATP-binding protein MetN | 2.74e-12 | NA | 1.85e-27 | NA |
7. B | Q8REE1 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.07e-06 | NA | 9.49e-15 | NA |
7. B | Q8X8K4 | Uncharacterized ABC transporter ATP-binding protein YcjV | 1.23e-12 | NA | 6.05e-19 | NA |
7. B | Q16BC5 | Phosphonates import ATP-binding protein PhnC 1 | 2.22e-16 | NA | 8.60e-16 | NA |
7. B | Q99X73 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 2.06e-09 | NA |
7. B | Q1RD28 | Spermidine/putrescine import ATP-binding protein PotA | 1.61e-11 | NA | 5.01e-24 | NA |
7. B | Q5RFQ9 | Mitochondrial potassium channel ATP-binding subunit | 1.58e-09 | NA | 9.14e-16 | NA |
7. B | Q31J97 | Hemin import ATP-binding protein HmuV | 2.66e-15 | NA | 2.14e-09 | NA |
7. B | Q8FJL0 | Glutathione import ATP-binding protein GsiA | 2.62e-06 | NA | 1.22e-18 | NA |
7. B | Q6FYL0 | Macrolide export ATP-binding/permease protein MacB | 1.34e-09 | NA | 6.10e-18 | NA |
7. B | P09833 | Molybdenum import ATP-binding protein ModC | 4.95e-12 | NA | 1.68e-12 | NA |
7. B | Q31ZK0 | Spermidine/putrescine import ATP-binding protein PotA | 1.10e-11 | NA | 3.26e-24 | NA |
7. B | Q8H8V7 | ABC transporter G family member 5 | 2.18e-06 | NA | 0.002 | NA |
7. B | Q1WVI7 | Spermidine/putrescine import ATP-binding protein PotA | 1.24e-14 | NA | 8.99e-27 | NA |
7. B | Q74R28 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.46e-10 | NA | 1.51e-19 | NA |
7. B | Q04DA7 | Methionine import ATP-binding protein MetN 2 | 6.47e-14 | NA | 6.72e-29 | NA |
7. B | Q9C8G9 | ABC transporter C family member 1 | 6.50e-06 | NA | 9.36e-16 | NA |
7. B | Q3IL62 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.79e-18 | NA |
7. B | Q8D740 | Molybdenum import ATP-binding protein ModC | 1.40e-11 | NA | 1.18e-18 | NA |
7. B | Q0T810 | Methionine import ATP-binding protein MetN | 3.93e-13 | NA | 8.00e-24 | NA |
7. B | B8ALI0 | ABC transporter G family member 5 | 7.66e-05 | NA | 0.002 | NA |
7. B | Q9FIB4 | ABC transporter F family member 2 | 2.44e-06 | NA | 1.11e-08 | NA |
7. B | Q00PJ2 | Cystic fibrosis transmembrane conductance regulator | 2.44e-05 | NA | 8.14e-12 | NA |
7. B | P26363 | Cystic fibrosis transmembrane conductance regulator | 7.69e-05 | NA | 1.82e-09 | NA |
7. B | Q6D1C4 | Methionine import ATP-binding protein MetN 3 | 2.65e-13 | NA | 4.52e-24 | NA |
7. B | F2RP52 | ABC multidrug transporter MDR2 | 3.50e-06 | NA | 1.33e-19 | NA |
7. B | Q3Z057 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.27e-06 | NA | 1.74e-13 | NA |
7. B | Q5WY52 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.84e-13 | NA | 0.016 | NA |
7. B | Q928L8 | Methionine import ATP-binding protein MetN 2 | 2.22e-16 | NA | 4.86e-27 | NA |
7. B | Q8XVS2 | Arabinose import ATP-binding protein AraG | 5.06e-06 | NA | 9.42e-09 | NA |
7. B | Q9WY65 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.85e-34 | NA |
7. B | Q5M5Z2 | Methionine import ATP-binding protein MetN | 2.03e-13 | NA | 2.85e-22 | NA |
7. B | Q9M3B9 | ABC transporter B family member 20 | 9.78e-06 | NA | 7.46e-15 | NA |
7. B | Q6F9A8 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.27e-13 | NA | 1.93e-23 | NA |
7. B | Q6NJ07 | Methionine import ATP-binding protein MetN | 1.38e-12 | NA | 3.50e-26 | NA |
7. B | Q2QLE5 | Cystic fibrosis transmembrane conductance regulator | 9.13e-05 | NA | 6.52e-12 | NA |
7. B | Q88HL1 | Nickel import ATP-binding protein NikD | 4.44e-15 | NA | 1.27e-10 | NA |
7. B | Q1R9L8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.37e-13 | NA | 0.001 | NA |
7. B | Q92337 | ATP-binding cassette transporter abc1 | 3.11e-06 | NA | 8.40e-16 | NA |
7. B | Q217B2 | Hemin import ATP-binding protein HmuV | 1.53e-14 | NA | 1.42e-12 | NA |
7. B | Q54RU1 | ABC transporter B family member 6 | 3.09e-09 | NA | 9.71e-25 | NA |
7. B | Q21Y06 | Phosphonates import ATP-binding protein PhnC 2 | 6.84e-12 | NA | 3.47e-08 | NA |
7. B | Q9Y8G1 | ABC multidrug transporter atrD | 2.75e-06 | NA | 1.98e-24 | NA |
7. B | Q2W1R8 | Molybdenum import ATP-binding protein ModC | 2.99e-12 | NA | 1.59e-20 | NA |
7. B | Q1BZA2 | Arabinose import ATP-binding protein AraG 1 | 4.91e-06 | NA | 5.27e-06 | NA |
7. B | Q8UF86 | UvrABC system protein A | 1.23e-02 | NA | 0.016 | NA |
7. B | Q8R4P9 | ATP-binding cassette sub-family C member 10 | 6.67e-06 | NA | 2.23e-21 | NA |
7. B | Q66C83 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.30e-06 | NA | 9.12e-15 | NA |
7. B | P25371 | Probable ATP-dependent permease | 5.46e-05 | NA | 5.37e-07 | NA |
7. B | Q1C1S0 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.23e-10 | NA | 2.76e-18 | NA |
7. B | Q668K6 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.57e-13 | NA | 7.32e-26 | NA |
7. B | Q8KLG1 | Nod factor export ATP-binding protein I | 1.12e-13 | NA | 4.41e-22 | NA |
7. B | Q8UBB7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 1.03e-10 | NA | 9.61e-27 | NA |
7. B | Q65T42 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.08e-11 | NA | 9.03e-23 | NA |
7. B | A6TEB8 | Autoinducer 2 import ATP-binding protein LsrA | 2.48e-06 | NA | 6.91e-10 | NA |
7. B | Q54NL1 | ABC transporter C family member 9 | 4.28e-06 | NA | 1.21e-18 | NA |
7. B | O06476 | Uncharacterized ABC transporter ATP-binding protein YfmR | 5.55e-05 | NA | 2.92e-10 | NA |
7. B | Q0TC10 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.64e-11 | NA | 4.60e-22 | NA |
7. B | P37009 | Fe(3+) ions import ATP-binding protein FbpC | 3.24e-12 | NA | 1.85e-21 | NA |
7. B | P0A9W5 | Energy-dependent translational throttle protein EttA | 7.28e-05 | NA | 5.98e-12 | NA |
7. B | Q839D5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 5.39e-75 | NA |
7. B | B1IRU7 | Autoinducer 2 import ATP-binding protein LsrA | 1.22e-06 | NA | 1.66e-14 | NA |
7. B | Q6D8T5 | Macrolide export ATP-binding/permease protein MacB | 5.71e-10 | NA | 1.97e-19 | NA |
7. B | Q74PI5 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.53e-10 | NA | 2.76e-18 | NA |
7. B | Q71WU0 | UvrABC system protein A | 1.09e-02 | NA | 0.044 | NA |
7. B | Q7WID6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.67e-12 | NA | 1.91e-21 | NA |
7. B | Q88UV2 | Methionine import ATP-binding protein MetN 2 | 7.77e-16 | NA | 1.14e-25 | NA |
7. B | Q7JII8 | Cystic fibrosis transmembrane conductance regulator | 8.82e-05 | NA | 2.41e-11 | NA |
7. B | Q8F435 | UvrABC system protein A | 4.56e-03 | NA | 0.019 | NA |
7. B | Q1M360 | Ribose import ATP-binding protein RbsA 3 | 1.26e-05 | NA | 5.99e-14 | NA |
7. B | Q6F9P2 | Methionine import ATP-binding protein MetN 2 | 3.84e-14 | NA | 9.02e-21 | NA |
7. B | Q5HG40 | Nickel import system ATP-binding protein NikD | 1.70e-11 | NA | 6.22e-08 | NA |
7. B | Q9C7F2 | ABC transporter B family member 14 | 5.37e-06 | NA | 4.78e-26 | NA |
7. B | Q8Y003 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 2.91e-06 | NA | 2.58e-15 | NA |
7. B | Q9LZB8 | ABC transporter B family member 29, chloroplastic | 2.15e-10 | NA | 1.58e-19 | NA |
7. B | Q032H3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 6.00e-42 | NA |
7. B | P26050 | Nod factor export ATP-binding protein I | 2.63e-14 | NA | 2.58e-20 | NA |
7. B | Q93SS1 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 3.50e-12 | NA |
7. B | Q08381 | Molybdenum import ATP-binding protein ModC | 5.86e-11 | NA | 6.34e-15 | NA |
7. B | Q9L0Q1 | Diacetylchitobiose uptake system ATP-binding protein MsiK | 1.39e-11 | NA | 1.55e-15 | NA |
7. B | P75094 | Putative ABC transporter ATP-binding protein MG015 homolog | 1.88e-10 | NA | 2.67e-09 | NA |
7. B | Q8DWR4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.27e-41 | NA |
7. B | Q99PE8 | ATP-binding cassette sub-family G member 5 | 5.86e-06 | NA | 7.88e-09 | NA |
7. B | Q8TI15 | Putative ABC transporter ATP-binding protein MA_4342 | 0.00e+00 | NA | 1.03e-32 | NA |
7. B | Q9JUX4 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.05e-13 | NA | 1.64e-21 | NA |
7. B | Q0BH79 | Methionine import ATP-binding protein MetN 1 | 6.96e-14 | NA | 1.39e-25 | NA |
7. B | Q896Y2 | Galactose/methyl galactoside import ATP-binding protein MglA | 7.87e-07 | NA | 4.43e-09 | NA |
7. B | Q32IB5 | Glutathione import ATP-binding protein GsiA | 7.34e-07 | NA | 3.69e-18 | NA |
7. B | Q5PCG9 | Methionine import ATP-binding protein MetN 2 | 5.49e-13 | NA | 4.53e-25 | NA |
7. B | P12866 | Alpha-factor-transporting ATPase | 6.26e-07 | NA | 1.14e-18 | NA |
7. B | Q5U820 | Cystic fibrosis transmembrane conductance regulator | 8.40e-05 | NA | 2.60e-09 | NA |
7. B | Q58488 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 5.51e-44 | NA |
7. B | P18813 | Maltose/maltodextrin import ATP-binding protein MalK (Fragment) | 9.85e-13 | NA | 9.72e-20 | NA |
7. B | P44884 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.85e-06 | NA | 1.99e-12 | NA |
7. B | P15031 | Fe(3+) dicitrate transport ATP-binding protein FecE | 1.11e-16 | NA | 3.23e-14 | NA |
7. B | Q6G194 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.59e-11 | NA | 1.49e-25 | NA |
7. B | Q8CK44 | Ribose import ATP-binding protein RbsA 1 | 1.20e-06 | NA | 2.19e-13 | NA |
7. B | Q57T09 | Methionine import ATP-binding protein MetN 1 | 2.92e-13 | NA | 1.66e-25 | NA |
7. B | Q9CC24 | UvrABC system protein A | 2.24e-02 | NA | 0.004 | NA |
7. B | O74676 | ABC transporter CDR4 | 3.95e-03 | NA | 0.016 | NA |
7. B | Q9KIF7 | Glycine betaine transport ATP-binding protein OpuAA | 7.32e-13 | NA | 6.18e-24 | NA |
7. B | Q87RS1 | Methionine import ATP-binding protein MetN | 2.91e-13 | NA | 2.34e-22 | NA |
7. B | Q7NUJ3 | Macrolide export ATP-binding/permease protein MacB | 2.04e-08 | NA | 7.78e-11 | NA |
7. B | P36636 | Peptide transport system ATP-binding protein SapD | 5.69e-11 | NA | 3.13e-14 | NA |
7. B | Q7NA79 | Ribose import ATP-binding protein RbsA | 5.13e-07 | NA | 3.63e-11 | NA |
7. B | O60706 | ATP-binding cassette sub-family C member 9 | 3.47e-06 | NA | 4.01e-12 | NA |
7. B | P63389 | Probable ATP-binding protein YheS | 2.39e-06 | NA | 1.11e-06 | NA |
7. B | P63355 | Methionine import ATP-binding protein MetN | 5.06e-13 | NA | 2.43e-24 | NA |
7. B | A2RKA7 | Nucleoside import ATP-binding protein NupA | 2.66e-06 | NA | 3.98e-17 | NA |
7. B | Q39BJ8 | Arabinose import ATP-binding protein AraG 2 | 4.00e-06 | NA | 5.84e-12 | NA |
7. B | Q9KXJ6 | Putative ABC transporter ATP-binding protein SCO2324 | 8.43e-07 | NA | 1.91e-23 | NA |
7. B | Q8R7Y5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.58e-47 | NA |
7. B | Q7CHQ3 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.25e-06 | NA | 9.12e-15 | NA |
7. B | Q2NUD6 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.00e-06 | NA | 4.88e-14 | NA |
7. B | Q5PJE7 | Autoinducer 2 import ATP-binding protein LsrA | 7.54e-06 | NA | 4.00e-11 | NA |
7. B | Q5MK06 | Macrolide export ATP-binding/permease protein MacB | 1.04e-08 | NA | 1.06e-14 | NA |
7. B | Q9X196 | Spermidine/putrescine import ATP-binding protein PotA | 8.41e-11 | NA | 1.30e-24 | NA |
7. B | Q1MBG4 | Arabinose import ATP-binding protein AraG | 3.94e-06 | NA | 4.00e-12 | NA |
7. B | Q8XE58 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.19e-13 | NA | 0.001 | NA |
7. B | A0K4E8 | Arabinose import ATP-binding protein AraG 1 | 4.86e-06 | NA | 5.27e-06 | NA |
7. B | P75796 | Glutathione import ATP-binding protein GsiA | 9.27e-07 | NA | 1.08e-18 | NA |
7. B | Q57GZ7 | Maltose/maltodextrin import ATP-binding protein MalK | 1.35e-14 | NA | 5.35e-25 | NA |
7. B | Q87MK8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.77e-15 | NA | 2.88e-06 | NA |
7. B | Q7A5Q8 | Nickel import system ATP-binding protein NikD | 1.23e-11 | NA | 3.41e-08 | NA |
7. B | Q8DRS0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.22e-42 | NA |
7. B | Q2YPX5 | UvrABC system protein A | 1.56e-02 | NA | 0.024 | NA |
7. B | Q4KK46 | Methionine import ATP-binding protein MetN 2 | 1.44e-15 | NA | 6.96e-22 | NA |
7. B | Q6FAN3 | Methionine import ATP-binding protein MetN 1 | 3.00e-15 | NA | 2.98e-26 | NA |
7. B | Q6ME20 | Methionine import ATP-binding protein MetN | 2.50e-13 | NA | 3.14e-21 | NA |
7. B | A3PRY1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.45e-12 | NA | 6.95e-25 | NA |
7. B | Q3MAR5 | Spermidine/putrescine import ATP-binding protein PotA | 7.47e-14 | NA | 3.72e-23 | NA |
7. B | Q9Y8G2 | ABC multidrug transporter atrC | 2.00e-06 | NA | 1.43e-20 | NA |
7. B | Q5HGY5 | Spermidine/putrescine import ATP-binding protein PotA | 4.10e-12 | NA | 4.16e-18 | NA |
7. B | Q8XAY7 | Autoinducer 2 import ATP-binding protein LsrA | 1.15e-06 | NA | 6.98e-15 | NA |
7. B | P34358 | ABC transporter ced-7 | 1.74e-04 | NA | 7.70e-18 | NA |
7. B | A0A1U8QG99 | ABC multidrug transporter atrC | 1.51e-06 | NA | 1.43e-20 | NA |
7. B | Q1MQ44 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-11 | NA | 4.47e-25 | NA |
7. B | Q325U1 | Methionine import ATP-binding protein MetN | 5.09e-13 | NA | 1.38e-24 | NA |
7. B | Q7A342 | Putative ABC transporter ATP-binding protein SA2476 | 2.07e-07 | NA | 6.15e-27 | NA |
7. B | Q5L222 | Spermidine/putrescine import ATP-binding protein PotA | 1.28e-14 | NA | 1.67e-23 | NA |
7. B | Q32HC7 | Arabinose import ATP-binding protein AraG | 3.62e-06 | NA | 3.43e-11 | NA |
7. B | Q55774 | Uncharacterized ABC transporter ATP-binding protein sll0182 | 1.94e-08 | NA | 8.90e-06 | NA |
7. B | Q31VH5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.85e-11 | NA | 3.87e-23 | NA |
7. B | P0CZ27 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.10e-44 | NA |
7. B | Q0TQU8 | Galactose/methyl galactoside import ATP-binding protein MglA | 3.67e-06 | NA | 5.02e-14 | NA |
7. B | Q9K619 | Bacitracin export ATP-binding protein BceA | 5.00e-15 | NA | 1.89e-16 | NA |
7. B | Q38UU0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.42e-44 | NA |
7. B | P33310 | ATP-dependent permease MDL1, mitochondrial | 2.97e-09 | NA | 5.53e-21 | NA |
7. B | P22040 | Uncharacterized ABC transporter ATP-binding protein sll0415 | 1.99e-08 | NA | 1.23e-17 | NA |
7. B | P69876 | Spermidine/putrescine import ATP-binding protein PotA | 1.11e-11 | NA | 4.73e-24 | NA |
7. B | P91660 | Probable multidrug resistance-associated protein lethal(2)03659 | 9.00e-06 | NA | 2.08e-12 | NA |
7. B | Q9KQE3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.69e-14 | NA | 7.59e-07 | NA |
7. B | A0B297 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 1.69e-06 | NA | 1.44e-15 | NA |
7. B | Q8GZ52 | ABC transporter G family member 30 | 4.68e-04 | NA | 0.021 | NA |
7. B | Q8G838 | Putative ABC transporter ATP-binding protein BL0043 | 1.91e-05 | NA | 1.20e-39 | NA |
7. B | Q55GB1 | ABC transporter G family member 15 | 1.05e-03 | NA | 4.58e-04 | NA |
7. B | Q3K8M7 | Arabinose import ATP-binding protein AraG | 1.62e-06 | NA | 1.24e-11 | NA |
7. B | Q830W6 | Spermidine/putrescine import ATP-binding protein PotA | 1.67e-14 | NA | 2.13e-21 | NA |
7. B | P59852 | Lactococcin-G-processing and transport ATP-binding protein LagD | 3.55e-09 | NA | 2.45e-23 | NA |
7. B | Q8E281 | Ribose import ATP-binding protein RbsA | 1.57e-05 | NA | 2.80e-11 | NA |
7. B | P0CZ42 | Probable ABC transporter ATP-binding protein SpyM3_0208 | 8.71e-10 | NA | 4.60e-07 | NA |
7. B | P47546 | Putative ABC transporter ATP-binding protein MG304 | 0.00e+00 | NA | 1.51e-38 | NA |
7. B | Q578E9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.07e-11 | NA | 1.83e-29 | NA |
7. B | Q0TPX5 | Ribose import ATP-binding protein RbsA | 9.20e-07 | NA | 5.94e-19 | NA |
7. B | P44410 | UvrABC system protein A | 5.29e-02 | NA | 0.016 | NA |
7. B | P9WQK6 | UvrABC system protein A | 1.96e-02 | NA | 0.003 | NA |
7. B | Q825P1 | Ribose import ATP-binding protein RbsA 2 | 1.61e-06 | NA | 6.66e-13 | NA |
7. B | Q67SV5 | Methionine import ATP-binding protein MetN | 1.39e-12 | NA | 1.32e-22 | NA |
7. B | Q97N50 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.04e-67 | NA |
7. B | Q92S10 | Ribose import ATP-binding protein RbsA 1 | 3.79e-06 | NA | 5.36e-10 | NA |
7. B | P59738 | Molybdenum import ATP-binding protein ModC | 5.20e-12 | NA | 1.60e-12 | NA |
7. B | Q92G36 | Zinc import ATP-binding protein ZnuC | 4.27e-10 | NA | 4.25e-18 | NA |
7. B | Q8T689 | ABC transporter G family member 4 | 3.08e-07 | NA | 4.48e-08 | NA |
7. B | Q00752 | Multiple sugar-binding transport ATP-binding protein MsmK | 9.92e-10 | NA | 6.35e-22 | NA |
7. B | P77257 | Autoinducer 2 import ATP-binding protein LsrA | 1.22e-06 | NA | 3.50e-14 | NA |
7. B | Q92887 | ATP-binding cassette sub-family C member 2 | 3.93e-06 | NA | 3.04e-14 | NA |
7. B | Q6LX68 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 3.01e-47 | NA |
7. B | Q1JII9 | Methionine import ATP-binding protein MetN | 2.49e-13 | NA | 1.13e-28 | NA |
7. B | P44662 | Probable iron transport system ATP-binding protein HI_0361 | 8.09e-14 | NA | 1.27e-16 | NA |
7. B | Q83F44 | Methionine import ATP-binding protein MetN | 1.40e-14 | NA | 3.48e-25 | NA |
7. B | Q89LP2 | Methionine import ATP-binding protein MetN | 3.28e-13 | NA | 9.80e-21 | NA |
7. B | Q1J8E4 | Methionine import ATP-binding protein MetN | 2.55e-13 | NA | 1.93e-28 | NA |
7. B | Q67RG2 | Phosphate import ATP-binding protein PstB 1 | 2.22e-16 | NA | 1.74e-14 | NA |
7. B | Q0SWH9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.31e-40 | NA |
7. B | Q73EL7 | Methionine import ATP-binding protein MetN 2 | 2.00e-15 | NA | 1.09e-27 | NA |
7. B | Q2NU23 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.40e-16 | NA |
7. B | Q5H0W2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.36e-13 | NA | 5.94e-10 | NA |
7. B | Q5R9Z5 | ATP-binding cassette sub-family F member 3 | 1.47e-06 | NA | 4.24e-08 | NA |
7. B | A7FMJ7 | Autoinducer 2 import ATP-binding protein LsrA | 6.52e-06 | NA | 1.34e-09 | NA |
7. B | Q1LKJ2 | Nod factor export ATP-binding protein I | 7.12e-14 | NA | 1.69e-18 | NA |
7. B | Q2UPC0 | ABC transporter aclQ | 7.29e-09 | NA | 1.76e-24 | NA |
7. B | Q8FW07 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.01e-11 | NA | 1.83e-29 | NA |
7. B | Q5PMK1 | Spermidine/putrescine import ATP-binding protein PotA | 1.63e-11 | NA | 9.55e-24 | NA |
7. B | Q578M5 | Putative ATP-binding protein BruAb2_0487 | 2.75e-12 | NA | 4.33e-20 | NA |
7. B | O95255 | ATP-binding cassette sub-family C member 6 | 2.50e-06 | NA | 8.50e-15 | NA |
7. B | Q48FT0 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 6.78e-13 | NA | 4.25e-22 | NA |
7. B | Q7MFC4 | Maltose/maltodextrin import ATP-binding protein MalK | 2.61e-11 | NA | 1.36e-25 | NA |
7. B | Q9C7F8 | ABC transporter B family member 13 | 7.78e-06 | NA | 2.55e-26 | NA |
7. B | O83527 | UvrABC system protein A | 1.33e-02 | NA | 3.95e-04 | NA |
7. B | Q8Z7H7 | Spermidine/putrescine import ATP-binding protein PotA | 1.40e-11 | NA | 8.83e-24 | NA |
7. B | Q0SML1 | Spermidine/putrescine import ATP-binding protein PotA | 5.67e-12 | NA | 1.18e-26 | NA |
7. B | P9WQI5 | Uncharacterized ABC transporter ATP-binding protein Rv2564 | 1.33e-13 | NA | 6.58e-15 | NA |
7. B | Q0TBN5 | Xylose import ATP-binding protein XylG | 4.40e-06 | NA | 4.02e-12 | NA |
7. B | B8NDS8 | ABC multidrug transporter atrF | 1.30e-03 | NA | 2.62e-09 | NA |
7. B | E9PU17 | ATP-binding cassette sub-family A member 17 | 1.74e-03 | NA | 7.55e-17 | NA |
7. B | Q55DA0 | ABC transporter G family member 22 | 7.05e-07 | NA | 1.89e-08 | NA |
7. B | O80725 | ABC transporter B family member 4 | 4.28e-06 | NA | 2.57e-23 | NA |
7. B | Q65S66 | Fe(3+) ions import ATP-binding protein FbpC | 2.48e-12 | NA | 2.13e-23 | NA |
7. B | Q8U6M1 | Fe(3+) ions import ATP-binding protein FbpC | 2.26e-11 | NA | 5.95e-24 | NA |
7. B | Q2FW35 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.11e-38 | NA |
7. B | P78363 | Retinal-specific phospholipid-transporting ATPase ABCA4 | 6.75e-03 | NA | 2.42e-16 | NA |
7. B | O88269 | ATP-binding cassette sub-family C member 6 | 2.69e-06 | NA | 3.38e-15 | NA |
7. B | Q24QI5 | Methionine import ATP-binding protein MetN | 6.20e-14 | NA | 6.02e-20 | NA |
7. B | Q045Z8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.39e-71 | NA |
7. B | Q8G7F4 | Phosphate import ATP-binding protein PstB | 1.77e-14 | NA | 4.46e-16 | NA |
7. B | O70127 | Bile salt export pump | 1.18e-06 | NA | 4.38e-17 | NA |
7. B | Q8LPJ4 | ABC transporter E family member 2 | 3.66e-04 | NA | 1.06e-08 | NA |
7. B | O60102 | Translation initiation factor rli1 | 1.15e-03 | NA | 4.41e-06 | NA |
7. B | O34510 | Fe(3+)-citrate import ATP-binding protein YfmF | 1.11e-16 | NA | 3.32e-17 | NA |
7. B | Q8FVM9 | Nickel import ATP-binding protein NikD | 4.55e-15 | NA | 3.70e-12 | NA |
7. B | P63374 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 9.93e-21 | NA |
7. B | Q81VM2 | Methionine import ATP-binding protein MetN 1 | 2.78e-14 | NA | 6.42e-20 | NA |
7. B | Q138A9 | Hemin import ATP-binding protein HmuV | 1.73e-14 | NA | 2.46e-12 | NA |
7. B | Q8P4S7 | Methionine import ATP-binding protein MetN | 6.66e-16 | NA | 6.01e-28 | NA |
7. B | Q1LJ08 | Phosphonates import ATP-binding protein PhnC 2 | 1.11e-16 | NA | 8.23e-16 | NA |
7. B | Q56953 | Chelated iron transport system membrane protein YfeB | 7.73e-14 | NA | 2.31e-12 | NA |
7. B | Q62M41 | Methionine import ATP-binding protein MetN 1 | 4.29e-14 | NA | 4.38e-26 | NA |
7. B | Q48IS7 | Arabinose import ATP-binding protein AraG | 1.39e-06 | NA | 1.73e-10 | NA |
7. B | Q7JUN3 | ATP-binding cassette sub-family D member | 6.86e-07 | NA | 1.80e-06 | NA |
7. B | Q3EDJ0 | ABC transporter I family member 19 | 4.18e-08 | NA | 2.77e-06 | NA |
7. B | Q63QQ7 | Arabinose import ATP-binding protein AraG | 3.56e-06 | NA | 8.69e-07 | NA |
7. B | Q3BNZ3 | Methionine import ATP-binding protein MetN | 5.55e-16 | NA | 1.50e-27 | NA |
7. B | Q46YX6 | Nod factor export ATP-binding protein I | 2.20e-13 | NA | 1.48e-14 | NA |
7. B | Q0VQ44 | Molybdenum import ATP-binding protein ModC | 5.79e-12 | NA | 6.25e-10 | NA |
7. B | Q6GHY6 | Spermidine/putrescine import ATP-binding protein PotA | 1.79e-11 | NA | 4.16e-18 | NA |
7. B | Q6HBS0 | Methionine import ATP-binding protein MetN 2 | 7.77e-16 | NA | 2.30e-25 | NA |
7. B | Q1I966 | Macrolide export ATP-binding/permease protein MacB 1 | 9.93e-08 | NA | 2.80e-14 | NA |
7. B | Q576H3 | Xylose import ATP-binding protein XylG | 1.44e-05 | NA | 3.34e-09 | NA |
7. B | Q8D3S8 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 3.58e-09 | NA |
7. B | Q7U172 | Phosphate import ATP-binding protein PstB 1 | 1.78e-15 | NA | 5.53e-12 | NA |
7. B | Q823C4 | Methionine import ATP-binding protein MetN | 5.38e-12 | NA | 2.99e-16 | NA |
7. B | Q8T6J1 | ABC transporter A family member 6 | 9.66e-05 | NA | 3.37e-11 | NA |
7. B | Q7FMW4 | ABC transporter G family member 38 | 9.22e-04 | NA | 0.005 | NA |
7. B | Q0BIZ6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.00e-11 | NA | 6.82e-22 | NA |
7. B | Q0BMC9 | Methionine import ATP-binding protein MetN | 2.79e-13 | NA | 7.79e-25 | NA |
7. B | Q2K9A3 | Ribose import ATP-binding protein RbsA 1 | 8.53e-06 | NA | 1.08e-08 | NA |
7. B | Q9PR42 | UvrABC system protein A | 1.31e-02 | NA | 0.021 | NA |
7. B | P0AAF4 | Arabinose import ATP-binding protein AraG | 2.24e-06 | NA | 1.32e-10 | NA |
7. B | Q65UE1 | Spermidine/putrescine import ATP-binding protein PotA | 7.22e-12 | NA | 2.64e-27 | NA |
7. B | Q9U2G5 | Multidrug resistance protein mrp-7 | 3.51e-05 | NA | 3.90e-14 | NA |
7. B | Q556W2 | ABC transporter G family member 17 | 2.51e-03 | NA | 0.007 | NA |
7. B | Q12BC9 | Phosphonates import ATP-binding protein PhnC | 7.55e-15 | NA | 5.55e-05 | NA |
7. B | Q5LBT4 | Spermidine/putrescine import ATP-binding protein PotA | 4.55e-13 | NA | 1.98e-25 | NA |
7. B | Q2J3F7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.20e-12 | NA | 3.43e-08 | NA |
7. B | Q9STT8 | ABC transporter A family member 4 | 9.10e-07 | NA | 1.07e-07 | NA |
7. B | Q6F813 | Macrolide export ATP-binding/permease protein MacB | 3.14e-09 | NA | 2.27e-16 | NA |
7. B | Q881Q1 | Macrolide export ATP-binding/permease protein MacB 2 | 1.21e-07 | NA | 1.55e-12 | NA |
7. B | P47288 | Spermidine/putrescine import ATP-binding protein PotA | 1.20e-05 | NA | 4.20e-13 | NA |
7. B | Q87PH3 | Spermidine/putrescine import ATP-binding protein PotA | 9.76e-12 | NA | 1.43e-24 | NA |
7. B | Q04HV7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.04e-67 | NA |
7. B | I1S2J9 | ABC transporter FGM5 | 1.68e-05 | NA | 1.85e-05 | NA |
7. B | Q0KDG3 | Methionine import ATP-binding protein MetN | 3.45e-14 | NA | 1.49e-25 | NA |
7. B | Q98KI3 | Molybdenum import ATP-binding protein ModC | 1.81e-11 | NA | 7.41e-16 | NA |
7. B | Q66FU4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.23e-10 | NA | 8.35e-20 | NA |
7. B | A0A1U9YI12 | ABC-type transmembrane transporter verA | 4.30e-06 | NA | 2.76e-29 | NA |
7. B | P16970 | ATP-binding cassette sub-family D member 3 | 1.27e-07 | NA | 1.85e-04 | NA |
7. B | Q57S53 | Methionine import ATP-binding protein MetN 2 | 5.14e-13 | NA | 1.78e-25 | NA |
7. B | Q89WG0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.01e-11 | NA | 2.05e-24 | NA |
7. B | Q1C138 | Autoinducer 2 import ATP-binding protein LsrA | 2.29e-05 | NA | 1.41e-09 | NA |
7. B | Q8T6J0 | ABC transporter A family member 7 | 2.35e-07 | NA | 1.88e-07 | NA |
7. B | Q7A5Q9 | Nickel import system ATP-binding protein NikE | 4.44e-16 | NA | 3.50e-14 | NA |
7. B | Q9CM47 | Macrolide export ATP-binding/permease protein MacB | 1.97e-08 | NA | 1.27e-14 | NA |
7. B | Q9M3D6 | ABC transporter G family member 19 | 3.68e-05 | NA | 7.64e-07 | NA |
7. B | Q1ARR5 | Ribose import ATP-binding protein RbsA 3 | 7.18e-06 | NA | 1.04e-18 | NA |
7. B | Q6GH28 | Nickel import system ATP-binding protein NikE | 2.22e-16 | NA | 1.30e-13 | NA |
7. B | P21447 | ATP-dependent translocase ABCB1 | 1.70e-06 | NA | 2.98e-20 | NA |
7. B | Q81GU1 | Sulfate/thiosulfate import ATP-binding protein CysA | 7.77e-16 | NA | 9.95e-29 | NA |
7. B | P63400 | Uncharacterized ABC transporter ATP-binding protein Mb2353c | 3.05e-06 | NA | 4.78e-16 | NA |
7. B | P21448 | ATP-dependent translocase ABCB1 | 5.30e-07 | NA | 6.73e-22 | NA |
7. B | Q8E8K8 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 1.97e-11 | NA | 4.15e-27 | NA |
7. B | Q07UI9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.83e-12 | NA | 9.03e-27 | NA |
7. B | Q9LZ98 | ABC transporter I family member 20 | 4.49e-08 | NA | 1.32e-11 | NA |
7. B | Q8NXH5 | Methionine import ATP-binding protein MetN 2 | 3.62e-13 | NA | 1.65e-26 | NA |
7. B | Q8PK53 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.89e-13 | NA | 1.63e-08 | NA |
7. B | F2SG60 | ABC multidrug transporter MDR3 | 2.67e-03 | NA | 0.004 | NA |
7. B | A0A059JJ46 | ABC multidrug transporter MDR2 | 3.01e-06 | NA | 3.16e-19 | NA |
7. B | Q4ZYK8 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 1.24e-08 | NA |
7. B | P49938 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 1.11e-16 | NA | 6.09e-19 | NA |
7. B | Q9CM08 | Galactose/methyl galactoside import ATP-binding protein MglA | 5.71e-06 | NA | 1.09e-11 | NA |
7. B | Q8J2Q1 | ABC transporter FUM19 | 3.66e-05 | NA | 7.25e-07 | NA |
7. B | Q5H503 | Methionine import ATP-binding protein MetN | 5.55e-16 | NA | 4.24e-27 | NA |
7. B | P94420 | Petrobactin import ATP-binding protein YclP | 0.00e+00 | NA | 1.18e-15 | NA |
7. B | Q9XF19 | ABC transporter I family member 21 | 4.50e-08 | NA | 6.38e-06 | NA |
7. B | Q8Y8T6 | Spermidine/putrescine import ATP-binding protein PotA | 1.17e-14 | NA | 7.35e-26 | NA |
7. B | Q5NFU5 | Methionine import ATP-binding protein MetN | 2.13e-13 | NA | 3.84e-24 | NA |
7. B | Q928A5 | UvrABC system protein A | 2.14e-02 | NA | 0.045 | NA |
7. B | Q9LSJ6 | ABC transporter B family member 17 | 5.33e-07 | NA | 1.12e-22 | NA |
7. B | Q9ZCC4 | Zinc import ATP-binding protein ZnuC | 1.45e-09 | NA | 2.56e-17 | NA |
7. B | O95342 | Bile salt export pump | 1.03e-06 | NA | 2.35e-17 | NA |
7. B | Q42093 | ABC transporter C family member 2 | 7.56e-06 | NA | 1.52e-16 | NA |
7. B | Q8DMY0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.28e-46 | NA |
7. B | Q7JII7 | Cystic fibrosis transmembrane conductance regulator | 7.29e-05 | NA | 2.41e-11 | NA |
7. B | Q8EIL8 | Macrolide export ATP-binding/permease protein MacB | 3.56e-09 | NA | 2.68e-15 | NA |
7. B | Q4UQD2 | Methionine import ATP-binding protein MetN | 5.55e-16 | NA | 6.01e-28 | NA |
7. B | Q0T4L9 | Autoinducer 2 import ATP-binding protein LsrA | 1.46e-06 | NA | 7.95e-14 | NA |
7. B | Q03518 | Antigen peptide transporter 1 | 5.08e-09 | NA | 2.11e-18 | NA |
7. B | Q73XU8 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.86e-11 | NA | 2.68e-26 | NA |
7. B | Q1JLT7 | Spermidine/putrescine import ATP-binding protein PotA | 2.63e-12 | NA | 7.14e-27 | NA |
7. B | P36879 | Uncharacterized ABC transporter ATP-binding protein YadG | 4.44e-16 | NA | 1.08e-13 | NA |
7. B | Q92DL6 | Spermidine/putrescine import ATP-binding protein PotA | 1.33e-14 | NA | 2.16e-25 | NA |
7. B | Q53193 | Probable peptide ABC transporter ATP-binding protein y4tR | 4.98e-12 | NA | 8.50e-14 | NA |
7. B | Q7VV72 | Methionine import ATP-binding protein MetN | 1.65e-14 | NA | 2.50e-25 | NA |
7. B | P0AAG0 | Dipeptide transport ATP-binding protein DppD | 1.30e-11 | NA | 2.32e-14 | NA |
7. B | Q8YDH1 | Putative peptide import ATP-binding protein BMEII0205 | 2.94e-13 | NA | 5.03e-21 | NA |
7. B | Q91V24 | ATP-binding cassette sub-family A member 7 | 4.48e-03 | NA | 2.53e-14 | NA |
7. B | Q04BY7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.44e-71 | NA |
7. B | O75027 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 4.09e-09 | NA | 5.96e-23 | NA |
7. B | P38735 | ABC transporter ATP-binding protein/permease VMR1 | 1.98e-05 | NA | 2.85e-19 | NA |
7. B | Q7MG07 | Galactose/methyl galactoside import ATP-binding protein MglA | 3.17e-06 | NA | 3.41e-12 | NA |
7. B | A0L0V9 | Macrolide export ATP-binding/permease protein MacB | 1.25e-09 | NA | 8.24e-16 | NA |
7. B | Q9DBM0 | ATP-binding cassette sub-family G member 8 | 1.37e-05 | NA | 6.84e-05 | NA |
7. B | Q8FVT0 | Putative ATP-binding protein BRA0745/BS1330_II0738 | 2.36e-12 | NA | 4.05e-20 | NA |
7. B | Q9BZC7 | ATP-binding cassette sub-family A member 2 | 1.76e-02 | NA | 7.25e-17 | NA |
7. B | A0A348AXX9 | ABC-type transporter TR06 | 8.18e-07 | NA | 5.13e-20 | NA |
7. B | P53978 | Elongation factor 3B | 1.29e-03 | NA | 0.002 | NA |
7. B | P77737 | Oligopeptide transport ATP-binding protein OppF | 1.52e-12 | NA | 7.57e-15 | NA |
7. B | Q00554 | Cystic fibrosis transmembrane conductance regulator | 8.51e-05 | NA | 2.11e-11 | NA |
7. B | Q63FX9 | Ribose import ATP-binding protein RbsA | 1.36e-06 | NA | 1.53e-10 | NA |
7. B | Q2P7S3 | Methionine import ATP-binding protein MetN | 6.66e-16 | NA | 5.61e-27 | NA |
7. B | Q9M1H3 | ABC transporter F family member 4 | 6.96e-06 | NA | 3.82e-04 | NA |
7. B | Q4AA74 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.40e-35 | NA |
7. B | P43672 | ATP-binding protein Uup | 2.35e-05 | NA | 3.86e-08 | NA |
7. B | Q882I8 | Arabinose import ATP-binding protein AraG | 2.13e-06 | NA | 1.57e-10 | NA |
7. B | Q9LHD1 | ABC transporter B family member 15 | 4.51e-07 | NA | 9.42e-24 | NA |
7. B | Q7AH43 | Fe(3+) ions import ATP-binding protein FbpC | 1.95e-14 | NA | 4.65e-22 | NA |
7. B | Q08201 | Phosphatidylcholine translocator ABCB4 | 1.94e-06 | NA | 1.71e-21 | NA |
7. B | Q5FM62 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.94e-39 | NA |
7. B | Q6D4E2 | Spermidine/putrescine import ATP-binding protein PotA | 3.54e-10 | NA | 1.18e-23 | NA |
7. B | P63358 | Probable ribonucleotide transport ATP-binding protein mkl | 7.89e-13 | NA | 7.91e-20 | NA |
7. B | Q1QE80 | Spermidine/putrescine import ATP-binding protein PotA | 2.02e-10 | NA | 4.50e-21 | NA |
7. B | Q4WT65 | ABC multidrug transporter B | 1.60e-05 | NA | 2.55e-16 | NA |
7. B | Q48PN3 | Methionine import ATP-binding protein MetN 2 | 2.29e-11 | NA | 7.87e-19 | NA |
7. B | Q9H221 | ATP-binding cassette sub-family G member 8 | 1.09e-05 | NA | 1.06e-05 | NA |
7. B | Q8Y4F6 | UvrABC system protein A | 1.09e-02 | NA | 0.041 | NA |
7. B | Q8RWI9 | ABC transporter G family member 15 | 2.91e-05 | NA | 0.003 | NA |
7. B | Q14Q07 | Spermidine/putrescine import ATP-binding protein PotA | 3.78e-12 | NA | 3.86e-20 | NA |
7. B | Q8WWZ4 | ATP-binding cassette sub-family A member 10 | 4.37e-05 | NA | 1.13e-13 | NA |
7. B | Q5AV01 | ABC transporter atnG | 1.01e-05 | NA | 2.34e-17 | NA |
7. B | Q2YX74 | Spermidine/putrescine import ATP-binding protein PotA | 2.03e-11 | NA | 4.16e-18 | NA |
7. B | Q04BG2 | Spermidine/putrescine import ATP-binding protein PotA | 1.20e-14 | NA | 1.11e-23 | NA |
7. B | Q5PID0 | Methionine import ATP-binding protein MetN 1 | 2.93e-13 | NA | 3.54e-25 | NA |
7. B | Q01937 | Lactose transport ATP-binding protein LacK | 2.07e-11 | NA | 7.97e-25 | NA |
7. B | Q3IX40 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 8.93e-11 | NA | 2.69e-25 | NA |
7. B | F2SQT8 | ABC multidrug transporter MDR5 | 1.66e-06 | NA | 1.66e-19 | NA |
7. B | Q9QY30 | Bile salt export pump | 1.68e-06 | NA | 9.96e-15 | NA |
7. B | Q2QLH0 | Cystic fibrosis transmembrane conductance regulator | 8.18e-05 | NA | 5.68e-11 | NA |
7. B | Q890R3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.77e-43 | NA |
7. B | Q1R9S4 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.15e-06 | NA | 1.97e-13 | NA |
7. B | Q1R0Z6 | Phosphonates import ATP-binding protein PhnC | 6.77e-15 | NA | 1.76e-12 | NA |
7. B | Q99UA2 | Nickel import system ATP-binding protein NikD | 2.05e-11 | NA | 3.41e-08 | NA |
7. B | Q7A1Z1 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 2.06e-09 | NA |
7. B | Q9LYS2 | ABC transporter C family member 10 | 4.03e-06 | NA | 2.94e-11 | NA |
7. B | P0AAH5 | Peptide transport system ATP-binding protein SapD | 6.46e-11 | NA | 1.52e-16 | NA |
7. B | Q7W4E1 | Methionine import ATP-binding protein MetN | 2.00e-14 | NA | 2.50e-25 | NA |
7. B | Q6F0V4 | Spermidine/putrescine import ATP-binding protein PotA | 2.42e-14 | NA | 7.14e-21 | NA |
7. B | P55096 | ATP-binding cassette sub-family D member 3 | 1.22e-07 | NA | 0.001 | NA |
7. B | P45171 | Spermidine/putrescine import ATP-binding protein PotA | 6.08e-11 | NA | 4.15e-29 | NA |
7. B | Q8LPT1 | ABC transporter B family member 6 | 7.76e-06 | NA | 1.28e-16 | NA |
7. B | P47365 | Putative carbohydrate transport ATP-binding protein MG119 | 6.03e-05 | NA | 3.25e-15 | NA |
7. B | P9WQJ9 | Mycobactin import ATP-binding/permease protein IrtA | 3.24e-07 | NA | 2.33e-22 | NA |
7. B | Q9NRK6 | ATP-binding cassette sub-family B member 10, mitochondrial | 1.01e-08 | NA | 1.05e-20 | NA |
7. B | P14772 | Bile pigment transporter 1 | 3.75e-06 | NA | 7.26e-12 | NA |
7. B | Q57PU4 | Vitamin B12 import ATP-binding protein BtuD | 5.86e-14 | NA | 2.78e-06 | NA |
7. B | Q7M8U0 | Macrolide export ATP-binding/permease protein MacB | 3.08e-10 | NA | 4.99e-12 | NA |
7. B | P69874 | Spermidine/putrescine import ATP-binding protein PotA | 1.12e-11 | NA | 4.73e-24 | NA |
7. B | Q927N9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.32e-38 | NA |
7. B | P23924 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.04e-06 | NA | 1.93e-14 | NA |
7. B | Q9LSJ2 | ABC transporter B family member 22 | 6.49e-07 | NA | 6.72e-23 | NA |
7. B | Q0TGT7 | Arabinose import ATP-binding protein AraG | 2.24e-06 | NA | 6.93e-11 | NA |
7. B | Q8FUW8 | Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 | 5.74e-11 | NA | 8.46e-17 | NA |
7. B | Q2G506 | ATM1-type heavy metal exporter | 1.01e-10 | NA | 2.61e-23 | NA |
7. B | Q74I62 | Putative ABC transporter ATP-binding protein LJ_1704 | 6.28e-08 | NA | 3.94e-29 | NA |
7. B | Q6HNE7 | Ribose import ATP-binding protein RbsA | 1.27e-06 | NA | 1.70e-10 | NA |
7. B | P06611 | Vitamin B12 import ATP-binding protein BtuD | 7.99e-14 | NA | 0.001 | NA |
7. B | Q1RFY9 | Methionine import ATP-binding protein MetN | 5.19e-13 | NA | 2.43e-24 | NA |
7. B | Q55EH8 | ABC transporter G family member 23 | 9.24e-08 | NA | 6.63e-16 | NA |
7. B | Q631Y4 | Methionine import ATP-binding protein MetN 3 | 2.78e-15 | NA | 4.26e-26 | NA |
7. B | Q62K82 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.11e-15 | NA | 2.05e-28 | NA |
7. B | Q8S628 | ABC transporter G family member 51 | 3.43e-04 | NA | 0.004 | NA |
7. B | P29551 | Elongation factor 3 | 1.10e-03 | NA | 0.005 | NA |
7. B | Q8VI47 | ATP-binding cassette sub-family C member 2 | 3.58e-06 | NA | 8.34e-13 | NA |
7. B | Q9Y7M7 | ATP-dependent permease MDL1, mitochondrial | 1.51e-10 | NA | 8.04e-26 | NA |
7. B | Q667L9 | Methionine import ATP-binding protein MetN 2 | 2.23e-13 | NA | 1.04e-28 | NA |
7. B | Q0B1U4 | Xylose import ATP-binding protein XylG | 6.24e-06 | NA | 2.68e-10 | NA |
7. B | Q73DH7 | Ribose import ATP-binding protein RbsA | 1.41e-06 | NA | 1.60e-10 | NA |
7. B | Q65VG9 | Methionine import ATP-binding protein MetN | 2.59e-13 | NA | 1.38e-26 | NA |
7. B | Q8RI39 | Spermidine/putrescine import ATP-binding protein PotA | 4.82e-11 | NA | 6.90e-21 | NA |
7. B | Q0I074 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.02e-13 | NA | 3.71e-10 | NA |
7. B | Q8Y455 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.03e-39 | NA |
7. B | Q99XI2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | P26905 | Dipeptide transport ATP-binding protein DppD | 7.92e-12 | NA | 3.24e-16 | NA |
7. B | O94489 | Elongation factor 3 | 7.78e-03 | NA | 1.73e-05 | NA |
7. B | P55469 | Uncharacterized ABC transporter ATP-binding protein y4gM | 7.17e-10 | NA | 6.26e-17 | NA |
7. B | Q53I83 | Methionine import ATP-binding protein MetN | 5.96e-12 | NA | 7.90e-20 | NA |
7. B | P33941 | ABC transporter ATP-binding/permease protein YojI | 2.47e-10 | NA | 4.11e-20 | NA |
7. B | A4WER4 | Autoinducer 2 import ATP-binding protein LsrA | 3.90e-06 | NA | 3.69e-07 | NA |
7. B | A0A059J0G5 | ABC multidrug transporter MDR1 | 5.79e-03 | NA | 0.008 | NA |
7. B | Q88WA5 | Methionine import ATP-binding protein MetN 1 | 1.55e-15 | NA | 1.01e-25 | NA |
7. B | Q0TFP1 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.94e-13 | NA | 0.001 | NA |
7. B | Q92VJ2 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 2.75e-11 | NA | 2.39e-25 | NA |
7. B | Q8CQS7 | Methionine import ATP-binding protein MetN 2 | 7.48e-14 | NA | 3.59e-21 | NA |
7. B | A0A0M4FLW6 | ABC transporter G family member STR2 | 9.91e-07 | NA | 2.71e-05 | NA |
7. B | Q1LX78 | Cystic fibrosis transmembrane conductance regulator | 4.23e-05 | NA | 4.08e-10 | NA |
7. B | Q02ME3 | Methionine import ATP-binding protein MetN 1 | 3.22e-13 | NA | 1.56e-22 | NA |
7. B | Q57242 | ATP-binding protein Uup | 3.96e-05 | NA | 1.72e-07 | NA |
7. B | Q05360 | Protein white | NA | NA | 1.87e-08 | NA |
7. B | Q6UR05 | Multidrug resistance-associated protein 1 | 2.25e-06 | NA | 2.24e-13 | NA |
7. B | Q8T6B4 | ABC transporter F family member 4 | 2.72e-04 | NA | 0.019 | NA |
7. B | Q63TY1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.44e-15 | NA | 1.76e-28 | NA |
7. B | Q2IYS5 | Phosphonates import ATP-binding protein PhnC 1 | 2.22e-16 | NA | 3.50e-16 | NA |
7. B | Q9QYM0 | ATP-binding cassette sub-family C member 5 | 3.38e-06 | NA | 6.78e-16 | NA |
7. B | O26236 | Putative ABC transporter ATP-binding protein MTH_133 | 0.00e+00 | NA | 4.93e-42 | NA |
7. B | Q7A679 | Spermidine/putrescine import ATP-binding protein PotA | 1.07e-11 | NA | 4.16e-18 | NA |
7. B | Q07DY5 | Cystic fibrosis transmembrane conductance regulator | 9.36e-05 | NA | 1.99e-11 | NA |
7. B | Q5PGP3 | Glutathione import ATP-binding protein GsiA | 6.84e-07 | NA | 2.84e-18 | NA |
7. B | Q2YVT7 | Methionine import ATP-binding protein MetN 1 | 3.53e-14 | NA | 3.78e-23 | NA |
7. B | Q8T9W4 | ABC transporter B family member 3 | 7.40e-06 | NA | 8.04e-18 | NA |
7. B | B1JLQ0 | Autoinducer 2 import ATP-binding protein LsrA | 1.48e-04 | NA | 1.47e-09 | NA |
7. B | Q9M1C7 | ABC transporter C family member 9 | 4.22e-05 | NA | 1.46e-15 | NA |
7. B | Q99V03 | Spermidine/putrescine import ATP-binding protein PotA | 3.70e-12 | NA | 4.16e-18 | NA |
7. B | Q5ZWE4 | Spermidine/putrescine import ATP-binding protein PotA | 7.23e-12 | NA | 1.54e-26 | NA |
7. B | O94911 | ABC-type organic anion transporter ABCA8 | 1.79e-04 | NA | 2.30e-17 | NA |
7. B | Q92NU9 | Macrolide export ATP-binding/permease protein MacB | 8.30e-08 | NA | 3.80e-12 | NA |
7. B | Q8Y4L8 | Methionine import ATP-binding protein MetN 2 | 5.55e-16 | NA | 2.23e-27 | NA |
7. B | Q8VQK7 | Putative peptide import ATP-binding protein BruAb2_1034 | 1.80e-13 | NA | 7.37e-22 | NA |
7. B | Q5WNX0 | Bacitracin transport ATP-binding protein BcrA | 1.55e-12 | NA | 1.10e-12 | NA |
7. B | P10907 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.72e-11 | NA | 4.36e-23 | NA |
7. B | Q54V86 | ABC transporter C family member 13 | 1.77e-06 | NA | 2.30e-17 | NA |
7. B | Q71ED1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 3.31e-12 | NA | 1.46e-22 | NA |
7. B | Q6LTL7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.16e-12 | NA | 1.43e-10 | NA |
7. B | Q8LGU1 | ABC transporter C family member 8 | 1.94e-05 | NA | 1.84e-13 | NA |
7. B | B5BA33 | Vitamin B12 import ATP-binding protein BtuD | 5.96e-14 | NA | 4.77e-06 | NA |
7. B | Q578S8 | Nickel import ATP-binding protein NikD | 5.88e-15 | NA | 2.82e-12 | NA |
7. B | Q1BJW2 | Arabinose import ATP-binding protein AraG 2 | 3.59e-06 | NA | 2.32e-11 | NA |
7. B | Q92GP9 | Putative export ATP-binding/permease protein RC1073 | 8.48e-10 | NA | 1.75e-19 | NA |
7. B | Q54W24 | ABC transporter B family member 4 | 1.73e-08 | NA | 2.93e-22 | NA |
7. B | P56899 | UvrABC system protein A | 1.60e-02 | NA | 0.013 | NA |
7. B | P77481 | Putative uncharacterized ABC transporter ATP-binding protein YcjV | 1.43e-12 | NA | 6.17e-19 | NA |
7. B | Q80WJ6 | ATP-binding cassette sub-family C member 12 | 1.71e-06 | NA | 4.16e-14 | NA |
7. B | Q7CMM8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q9MUN1 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.50e-12 | NA | 1.31e-26 | NA |
7. B | Q7MLB8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.41e-12 | NA | 1.41e-25 | NA |
7. B | Q2SJY7 | Spermidine/putrescine import ATP-binding protein PotA | 1.34e-11 | NA | 4.89e-24 | NA |
7. B | Q8FFB3 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.89e-11 | NA | 3.26e-23 | NA |
7. B | Q1J6D2 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.67e-21 | NA |
7. B | Q5HIL5 | Methionine import ATP-binding protein MetN 1 | 2.56e-14 | NA | 3.05e-24 | NA |
7. B | Q79EE4 | Osmoprotective compounds uptake ATP-binding protein GgtA | 2.15e-14 | NA | 1.67e-17 | NA |
7. B | Q724C0 | Methionine import ATP-binding protein MetN 1 | 8.27e-14 | NA | 4.27e-24 | NA |
7. B | Q8ZAS8 | Maltose/maltodextrin import ATP-binding protein MalK | 2.72e-11 | NA | 2.75e-26 | NA |
7. B | Q478L3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.26e-13 | NA | 0.002 | NA |
7. B | P63398 | Fatty acid ABC transporter ATP-binding/permease protein | 3.18e-11 | NA | 3.77e-18 | NA |
7. B | A0A179H0T5 | ABC multidrug transporter lscH | 2.01e-05 | NA | 2.29e-07 | NA |
7. B | Q0TMS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.32e-44 | NA |
7. B | P0A4W3 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.40e-10 | NA | 7.91e-25 | NA |
7. B | P43071 | Multidrug resistance protein CDR1 | 5.86e-03 | NA | 0.002 | NA |
7. B | Q3JHZ1 | Ribose import ATP-binding protein RbsA 2 | 6.08e-06 | NA | 5.10e-10 | NA |
7. B | P36370 | Antigen peptide transporter 1 | 1.52e-08 | NA | 1.38e-15 | NA |
7. B | Q8PGE8 | Methionine import ATP-binding protein MetN | 6.66e-16 | NA | 2.17e-27 | NA |
7. B | Q8ZQR6 | Molybdenum import ATP-binding protein ModC | 8.03e-12 | NA | 2.51e-12 | NA |
7. B | Q7W9U5 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.81e-13 | NA | 7.28e-31 | NA |
7. B | Q82WT5 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.44e-15 | NA | 8.11e-30 | NA |
7. B | Q160M2 | Spermidine/putrescine import ATP-binding protein PotA | 2.94e-14 | NA | 6.89e-21 | NA |
7. B | Q2M3G0 | ATP-binding cassette sub-family B member 5 | 4.98e-07 | NA | 5.04e-20 | NA |
7. B | Q8PY26 | Putative ABC transporter ATP-binding protein MM_1038 | 0.00e+00 | NA | 1.12e-34 | NA |
7. B | Q9VL32 | ATP-binding cassette sub-family C member Sur | 7.26e-03 | NA | 8.82e-14 | NA |
7. B | Q9C8K2 | ABC transporter G family member 12 | 1.54e-06 | NA | 0.003 | NA |
7. B | Q8YCB1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 9.46e-12 | NA | 3.42e-29 | NA |
7. B | Q8ZH38 | Methionine import ATP-binding protein MetN 1 | 2.30e-13 | NA | 1.70e-27 | NA |
7. B | Q56A55 | Mitochondrial potassium channel ATP-binding subunit | 6.51e-10 | NA | 1.71e-19 | NA |
7. B | Q2J534 | Phosphate import ATP-binding protein PstB | 1.55e-15 | NA | 8.44e-16 | NA |
7. B | Q97Q42 | Spermidine/putrescine import ATP-binding protein PotA | 4.86e-12 | NA | 1.13e-24 | NA |
7. B | Q032A0 | Methionine import ATP-binding protein MetN | 1.89e-14 | NA | 6.20e-23 | NA |
7. B | P42064 | Oligopeptide transport ATP-binding protein AppD | 1.00e-11 | NA | 3.55e-17 | NA |
7. B | Q8FBS3 | Ribose import ATP-binding protein RbsA | 2.03e-06 | NA | 8.74e-14 | NA |
7. B | A0A3G9H9H1 | ABC transporter ALT5 | 2.85e-04 | NA | 5.51e-08 | NA |
7. B | P0CZ31 | Methionine import ATP-binding protein MetN | 2.27e-13 | NA | 2.31e-28 | NA |
7. B | A0B344 | Methionine import ATP-binding protein MetN 2 | 7.58e-11 | NA | 1.82e-22 | NA |
7. B | P13569 | Cystic fibrosis transmembrane conductance regulator | 7.56e-05 | NA | 1.12e-11 | NA |
7. B | Q8FCE2 | Xylose import ATP-binding protein XylG | 4.55e-06 | NA | 4.02e-12 | NA |
7. B | Q6G5J0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 9.76e-12 | NA | 2.78e-25 | NA |
7. B | Q3Z3Q4 | Macrolide export ATP-binding/permease protein MacB | 1.25e-07 | NA | 3.31e-16 | NA |
7. B | Q04F14 | Methionine import ATP-binding protein MetN 1 | 4.61e-13 | NA | 1.95e-26 | NA |
7. B | Q1BQ82 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 3.11e-07 | NA | 1.44e-15 | NA |
7. B | P31134 | Putrescine transport ATP-binding protein PotG | 4.44e-09 | NA | 4.34e-27 | NA |
7. B | P45051 | Oligopeptide transport ATP-binding protein OppF | 1.52e-12 | NA | 2.42e-19 | NA |
7. B | Q63H29 | Methionine import ATP-binding protein MetN 1 | 2.90e-14 | NA | 5.35e-20 | NA |
7. B | Q668L6 | Macrolide export ATP-binding/permease protein MacB 2 | 2.00e-08 | NA | 3.28e-15 | NA |
7. B | Q63A38 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.92e-11 | NA | 2.90e-22 | NA |
7. B | Q8GNH6 | Nod factor export ATP-binding protein I | 7.35e-10 | NA | 6.30e-24 | NA |
7. B | Q1DDP4 | Methionine import ATP-binding protein MetN | 1.58e-12 | NA | 1.26e-23 | NA |
7. B | Q7WFU9 | Methionine import ATP-binding protein MetN | 4.17e-14 | NA | 2.50e-25 | NA |
7. B | P9WQL5 | Probable ribonucleotide transport ATP-binding protein mkl | 5.98e-11 | NA | 7.91e-20 | NA |
7. B | Q1AXG5 | Ribose import ATP-binding protein RbsA 1 | 1.94e-06 | NA | 3.84e-14 | NA |
7. B | Q5HHK4 | Methionine import ATP-binding protein MetN 2 | 3.67e-13 | NA | 1.65e-26 | NA |
7. B | Q92TS8 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 8.69e-07 | NA | 1.83e-12 | NA |
7. B | A4TQL5 | Autoinducer 2 import ATP-binding protein LsrA | 1.49e-04 | NA | 1.41e-09 | NA |
7. B | Q8E3S0 | Methionine import ATP-binding protein MetN | 1.06e-13 | NA | 6.69e-28 | NA |
7. B | Q4L4R9 | Methionine import ATP-binding protein MetN | 3.42e-13 | NA | 1.34e-24 | NA |
7. B | Q0T2X5 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.40e-06 | NA | 1.57e-13 | NA |
7. B | P0C2H2 | Macrolide export ATP-binding/permease protein MacB | 2.16e-08 | NA | 4.87e-16 | NA |
7. B | Q8MIB3 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 3.23e-07 | NA | 0.035 | NA |
7. B | Q83LT3 | Glutathione import ATP-binding protein GsiA | 8.58e-07 | NA | 4.55e-19 | NA |
7. B | Q3JZP8 | Methionine import ATP-binding protein MetN | 2.67e-13 | NA | 9.49e-28 | NA |
7. B | Q62GB4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.57e-14 | NA | 2.58e-21 | NA |
7. B | P63394 | Mycobactin import ATP-binding/permease protein IrtB | 1.10e-09 | NA | 3.40e-17 | NA |
7. B | Q47RE8 | Methionine import ATP-binding protein MetN | 2.63e-12 | NA | 4.92e-21 | NA |
7. B | Q5M244 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 6.20e-47 | NA |
7. B | P44735 | Ribose import ATP-binding protein RbsA | 1.05e-06 | NA | 1.83e-13 | NA |
7. B | Q9KTJ5 | Methionine import ATP-binding protein MetN | 2.55e-13 | NA | 2.32e-23 | NA |
7. B | Q55108 | Bicarbonate transport ATP-binding protein CmpD | 1.93e-12 | NA | 1.32e-24 | NA |
7. B | Q03519 | Antigen peptide transporter 2 | 3.97e-09 | NA | 3.46e-15 | NA |
7. B | Q9FT51 | ABC transporter G family member 27 | 8.70e-06 | NA | 2.54e-05 | NA |
7. B | Q09YH0 | Cystic fibrosis transmembrane conductance regulator | 8.64e-05 | NA | 1.52e-11 | NA |
7. B | Q7WIP8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.30e-13 | NA | 0.006 | NA |
7. B | Q9SJK6 | Putative white-brown complex homolog protein 30 | 3.61e-05 | NA | 0.009 | NA |
7. B | Q9HY19 | Spermidine/putrescine import ATP-binding protein PotA 2 | 1.23e-11 | NA | 8.01e-23 | NA |
7. B | Q04BY6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.25e-34 | NA |
7. B | Q5KUX3 | Ribose import ATP-binding protein RbsA | 3.20e-06 | NA | 6.06e-12 | NA |
7. B | Q2IBF6 | Cystic fibrosis transmembrane conductance regulator | 8.68e-05 | NA | 1.15e-11 | NA |
7. B | P0AAG5 | Multidrug resistance-like ATP-binding protein MdlB | 2.82e-09 | NA | 8.00e-19 | NA |
7. B | A7KVC2 | ABC transporter C family MRP4 | 4.93e-06 | NA | 2.21e-13 | NA |
7. B | P33916 | Uncharacterized ABC transporter ATP-binding protein YejF | 7.65e-08 | NA | 1.89e-16 | NA |
7. B | Q45460 | Choline transport ATP-binding protein OpuBA | 8.79e-12 | NA | 4.74e-22 | NA |
7. B | Q54BT3 | ABC transporter B family member 2 | 6.54e-06 | NA | 3.74e-20 | NA |
7. B | Q0I5E9 | Methionine import ATP-binding protein MetN | 2.80e-13 | NA | 7.81e-25 | NA |
7. B | Q8YCG3 | Fe(3+) ions import ATP-binding protein FbpC | 5.20e-14 | NA | 1.91e-23 | NA |
7. B | Q492R2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.66e-14 | NA |
7. B | I1R9B3 | ABC-type transporter FGSG_00046 | 3.85e-06 | NA | 2.53e-10 | NA |
7. B | P77795 | Uncharacterized ABC transporter ATP-binding protein YdcT | 2.26e-12 | NA | 1.53e-25 | NA |
7. B | Q2YXY9 | Nickel import system ATP-binding protein NikD | 2.51e-11 | NA | 9.89e-09 | NA |
7. B | Q1C5W7 | Macrolide export ATP-binding/permease protein MacB 2 | 2.20e-08 | NA | 3.72e-15 | NA |
7. B | Q8LPK2 | ABC transporter B family member 2 | 1.77e-06 | NA | 8.08e-21 | NA |
7. B | A1TXH7 | Spermidine/putrescine import ATP-binding protein PotA | 3.17e-11 | NA | 1.70e-21 | NA |
7. B | Q47087 | Achromobactin transport ATP-binding protein CbrD | 8.88e-16 | NA | 8.55e-16 | NA |
7. B | Q98GF5 | Phosphonates import ATP-binding protein PhnC | 1.69e-14 | NA | 1.67e-10 | NA |
7. B | Q7M8M4 | Phosphonates import ATP-binding protein PhnC | 4.22e-15 | NA | 9.61e-18 | NA |
7. B | P40860 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.60e-13 | NA | 8.72e-23 | NA |
7. B | Q2FHY1 | Spermidine/putrescine import ATP-binding protein PotA | 3.98e-12 | NA | 4.16e-18 | NA |
7. B | O54187 | Putative ABC transporter ATP-binding protein SCO5958 | 0.00e+00 | NA | 1.94e-25 | NA |
7. B | D3ZCM3 | ATP-binding cassette subfamily G member 4 | 4.67e-07 | NA | 7.38e-07 | NA |
7. B | Q5WC31 | Ribose import ATP-binding protein RbsA | 3.64e-06 | NA | 1.25e-11 | NA |
7. B | Q03ZQ0 | Spermidine/putrescine import ATP-binding protein PotA | 5.17e-14 | NA | 7.00e-22 | NA |
7. B | P22638 | Heterocyst differentiation ATP-binding protein HepA | 7.48e-10 | NA | 1.44e-21 | NA |
7. B | Q2K0S7 | Ribose import ATP-binding protein RbsA 3 | 2.50e-06 | NA | 9.08e-10 | NA |
7. B | Q6GKG3 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.90e-09 | NA |
7. B | O26096 | Methionine import ATP-binding protein MetN | 1.06e-13 | NA | 2.04e-22 | NA |
7. B | Q21XK2 | Methionine import ATP-binding protein MetN | 2.22e-14 | NA | 3.06e-21 | NA |
7. B | Q2SVU4 | Ribose import ATP-binding protein RbsA 1 | 1.14e-05 | NA | 9.67e-14 | NA |
7. B | Q04B25 | Methionine import ATP-binding protein MetN | 5.38e-12 | NA | 3.09e-21 | NA |
7. B | Q12R52 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 4.02e-17 | NA |
7. B | P78966 | Mating factor M secretion protein mam1 | 3.57e-06 | NA | 3.90e-19 | NA |
7. B | O26543 | UvrABC system protein A | 1.48e-02 | NA | 5.43e-05 | NA |
7. B | Q87DT9 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.12e-13 | NA | 1.73e-25 | NA |
7. B | Q0T6D3 | Glutathione import ATP-binding protein GsiA | 8.93e-07 | NA | 4.39e-19 | NA |
7. B | Q04FM1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.19e-42 | NA |
7. B | Q8FWP1 | Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 | 6.51e-11 | NA | 5.99e-12 | NA |
7. B | Q164K3 | Ribose import ATP-binding protein RbsA | 2.08e-06 | NA | 1.12e-11 | NA |
7. B | Q68W42 | Putative export ATP-binding/permease protein RT0691 | 6.31e-11 | NA | 5.49e-21 | NA |
7. B | P9WQL8 | Doxorubicin resistance ATP-binding protein DrrA | 2.21e-13 | NA | 4.91e-11 | NA |
7. B | Q9S4Z0 | Methionine import ATP-binding protein MetN | 7.98e-11 | NA | 2.17e-19 | NA |
7. B | Q8Z990 | Methionine import ATP-binding protein MetN 1 | 3.88e-13 | NA | 3.14e-25 | NA |
7. B | Q2K396 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.47e-11 | NA | 7.14e-08 | NA |
7. B | Q5XDV5 | Probable ABC transporter ATP-binding protein M6_Spy0273 | 8.30e-10 | NA | 4.60e-07 | NA |
7. B | Q8T5Z7 | ABC transporter A family member 1 | 2.66e-06 | NA | 2.44e-12 | NA |
7. B | Q10185 | ATP-binding cassette transporter abc2 | 2.32e-06 | NA | 3.12e-16 | NA |
7. B | P16679 | Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL | 1.93e-14 | NA | 5.21e-09 | NA |
7. B | A0KGB3 | Macrolide export ATP-binding/permease protein MacB 1 | 7.49e-09 | NA | 3.19e-12 | NA |
7. B | Q5LZU2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | NA | 5.34e-19 | NA |
7. B | Q8YA75 | Methionine import ATP-binding protein MetN 1 | 3.15e-14 | NA | 3.51e-24 | NA |
7. B | Q66AF5 | Arabinose import ATP-binding protein AraG | 1.81e-05 | NA | 6.74e-17 | NA |
7. B | Q5XDU4 | Oligopeptide transport ATP-binding protein OppF | 1.16e-13 | NA | 1.10e-18 | NA |
7. B | Q49ZD9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.62e-40 | NA |
7. B | Q1JBV6 | Spermidine/putrescine import ATP-binding protein PotA | 2.53e-12 | NA | 7.14e-27 | NA |
7. B | Q89NX6 | Macrolide export ATP-binding/permease protein MacB | 8.48e-09 | NA | 1.17e-15 | NA |
7. B | Q39T41 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 2.29e-13 | NA |
7. B | P25997 | Elongation factor 3 | 1.11e-03 | NA | 0.002 | NA |
7. B | Q8RXN0 | ABC transporter G family member 11 | 3.23e-05 | NA | 7.72e-06 | NA |
7. B | Q8DY54 | Methionine import ATP-binding protein MetN | 2.44e-10 | NA | 9.49e-28 | NA |
7. B | P47660 | UvrABC system protein A | 1.07e-02 | NA | 7.34e-05 | NA |
7. B | Q17VE0 | Methionine import ATP-binding protein MetN | 2.00e-13 | NA | 3.23e-21 | NA |
7. B | Q86HQ2 | ABC transporter G family member 8 | 1.10e-05 | NA | 1.24e-07 | NA |
7. B | Q831K6 | Methionine import ATP-binding protein MetN 2 | 8.88e-16 | NA | 2.00e-28 | NA |
7. B | Q4ZQZ7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.28e-12 | NA | 9.02e-06 | NA |
7. B | Q4ZZK0 | Methionine import ATP-binding protein MetN 2 | 2.54e-11 | NA | 6.77e-19 | NA |
7. B | P50980 | Oligopeptide transport ATP-binding protein OppD | 1.14e-12 | NA | 7.04e-18 | NA |
7. B | P16676 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.31e-13 | NA | 3.42e-23 | NA |
7. B | Q93D97 | Putative ABC transporter ATP-binding protein SMU_1934c | 3.57e-09 | NA | 8.50e-33 | NA |
7. B | Q7VMF9 | Macrolide export ATP-binding/permease protein MacB | 3.37e-09 | NA | 8.54e-18 | NA |
7. B | Q8XJX3 | Ribose import ATP-binding protein RbsA | 6.16e-07 | NA | 6.11e-19 | NA |
7. B | Q47CB7 | Molybdenum import ATP-binding protein ModC | 2.07e-11 | NA | 1.84e-21 | NA |
7. B | Q9FNU2 | ABC transporter B family member 25 | 1.13e-11 | NA | 1.02e-17 | NA |
7. B | Q54K24 | ABC transporter C family member 14 | 1.40e-06 | NA | 1.10e-16 | NA |
7. B | Q5JEB0 | Molybdate/tungstate import ATP-binding protein WtpC | 4.43e-14 | NA | 1.32e-22 | NA |
7. B | Q4WSI1 | ABC multidrug transporter mdr4 | 1.02e-06 | NA | 2.27e-17 | NA |
7. B | Q9LHK4 | Putative ABC transporter B family member 8 | 5.15e-07 | NA | 1.02e-17 | NA |
7. B | F1MWM0 | Retinal-specific phospholipid-transporting ATPase ABCA4 | NA | NA | 1.95e-16 | NA |
7. B | Q54VJ0 | ABC transporter C family member 2 | 4.63e-06 | NA | 7.28e-18 | NA |
7. B | Q6MIP7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.15e-14 | NA |
7. B | Q6G9I1 | Nickel import system ATP-binding protein NikE | 0.00e+00 | NA | 3.47e-14 | NA |
7. B | Q1CFH7 | Methionine import ATP-binding protein MetN 2 | 2.17e-13 | NA | 1.70e-27 | NA |
7. B | Q9CHL8 | Multidrug resistance ABC transporter ATP-binding and permease protein | 5.45e-10 | NA | 1.86e-18 | NA |
7. B | Q8VZZ4 | ABC transporter C family member 6 | 4.84e-06 | NA | 9.00e-15 | NA |
7. B | P0A2U8 | Oligopeptide transport ATP-binding protein AmiE | 4.92e-11 | NA | 4.61e-17 | NA |
7. B | Q5Z293 | Phosphate import ATP-binding protein PstB | 2.66e-15 | NA | 1.45e-12 | NA |
7. B | F2RSQ6 | ABC multidrug transporter MDR1 | 5.44e-03 | NA | 0.008 | NA |
7. B | Q8FHR3 | Uncharacterized ABC transporter ATP-binding protein YcjV | 7.46e-13 | NA | 6.35e-19 | NA |
7. B | H6TB12 | Sophorolipid transporter | 1.72e-06 | NA | 1.33e-20 | NA |
7. B | D4AYW0 | ABC transporter G family member ARB_01379 | 5.96e-04 | NA | 1.47e-08 | NA |
7. B | Q09YJ4 | Cystic fibrosis transmembrane conductance regulator | 1.07e-04 | NA | 4.22e-10 | NA |
7. B | Q57IS3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.83e-11 | NA | 3.07e-21 | NA |
7. B | Q2QL74 | Cystic fibrosis transmembrane conductance regulator | 2.59e-05 | NA | 4.26e-10 | NA |
7. B | Q12M46 | ATP-dependent lipid A-core flippase | 9.09e-12 | NA | 5.93e-19 | NA |
7. B | Q8XKQ2 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.92e-06 | NA | 4.27e-14 | NA |
7. B | Q55DR1 | ABC transporter G family member 14 | 5.93e-04 | NA | 0.023 | NA |
7. B | Q5E5I1 | Hemin import ATP-binding protein HmuV | 7.22e-15 | NA | 1.14e-14 | NA |
7. B | Q1MAA2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 1.75e-06 | NA | 5.79e-12 | NA |
7. B | Q9KL04 | Maltose/maltodextrin import ATP-binding protein MalK | 3.73e-11 | NA | 6.75e-25 | NA |
7. B | Q99PE7 | ATP-binding cassette sub-family G member 5 | 8.73e-06 | NA | 2.03e-09 | NA |
7. B | Q9NUT2 | Mitochondrial potassium channel ATP-binding subunit | 1.41e-08 | NA | 1.43e-15 | NA |
7. B | A1K323 | Macrolide export ATP-binding/permease protein MacB | 1.07e-07 | NA | 2.83e-12 | NA |
7. B | Q8D4H4 | Galactose/methyl galactoside import ATP-binding protein MglA | 5.04e-06 | NA | 3.66e-12 | NA |
7. B | Q9KSD1 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.76e-06 | NA | 1.52e-13 | NA |
7. B | Q323M3 | Macrolide export ATP-binding/permease protein MacB | 1.33e-07 | NA | 3.61e-15 | NA |
7. B | Q6AE21 | Methionine import ATP-binding protein MetN | 2.13e-14 | NA | 9.19e-26 | NA |
7. B | A0A0H2VFI8 | Energy-dependent translational throttle protein EttA | 1.80e-03 | NA | 2.95e-11 | NA |
7. B | P40416 | Iron-sulfur clusters transporter ATM1, mitochondrial | 6.51e-09 | NA | 1.35e-24 | NA |
7. B | Q49XC6 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 3.53e-11 | NA |
7. B | Q8EK40 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.74e-13 | NA | 6.22e-09 | NA |
7. B | Q1QDA8 | Macrolide export ATP-binding/permease protein MacB | 2.78e-07 | NA | 4.47e-19 | NA |
7. B | Q4FU75 | Macrolide export ATP-binding/permease protein MacB | 1.71e-07 | NA | 9.35e-19 | NA |
7. B | Q92W56 | Arabinose import ATP-binding protein AraG | 3.99e-06 | NA | 4.16e-12 | NA |
7. B | Q7VLS9 | Zinc import ATP-binding protein ZnuC | 5.62e-11 | NA | 2.45e-08 | NA |
7. B | Q07LR5 | Methionine import ATP-binding protein MetN | 1.52e-12 | NA | 8.61e-23 | NA |
7. B | P16677 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 6.75e-12 | NA |
7. B | Q8KFD6 | Putative ABC transporter ATP-binding protein CT0391 | 0.00e+00 | NA | 6.04e-35 | NA |
7. B | P0AAH4 | Putrescine export system ATP-binding protein SapD | 6.22e-11 | NA | 1.52e-16 | NA |
7. B | Q6N0P7 | Molybdenum import ATP-binding protein ModC | 1.17e-10 | NA | 1.73e-15 | NA |
7. B | Q8UH62 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 2.05e-11 | NA | 1.49e-27 | NA |
7. B | Q02XM9 | Ribose import ATP-binding protein RbsA | 4.16e-06 | NA | 6.08e-14 | NA |
7. B | Q3JHC9 | Methionine import ATP-binding protein MetN 2 | 4.70e-13 | NA | 9.49e-23 | NA |
7. B | A1BE50 | Macrolide export ATP-binding/permease protein MacB | 3.14e-08 | NA | 2.22e-22 | NA |
7. B | Q704E8 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 3.34e-09 | NA | 8.37e-23 | NA |
7. B | Q1PEH6 | ABC transporter A family member 3 | 7.15e-06 | NA | 1.72e-07 | NA |
7. B | Q7XA72 | ABC transporter G family member 21 | 1.59e-06 | NA | 0.002 | NA |
7. B | P0CZ30 | Methionine import ATP-binding protein MetN | 1.36e-13 | NA | 2.31e-28 | NA |
7. B | Q99758 | Phospholipid-transporting ATPase ABCA3 | 1.74e-04 | NA | 2.23e-18 | NA |
7. B | Q8FVV5 | Fe(3+) ions import ATP-binding protein FbpC | 5.78e-14 | NA | 1.09e-22 | NA |
7. B | Q63MM6 | Macrolide export ATP-binding/permease protein MacB | 5.19e-08 | NA | 1.20e-13 | NA |
7. B | Q7N986 | Maltose/maltodextrin import ATP-binding protein MalK | 1.41e-14 | NA | 7.77e-23 | NA |
7. B | P9WQK2 | Energy-dependent translational throttle protein EttA | 1.22e-04 | NA | 6.10e-09 | NA |
7. B | P33931 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.24e-13 | NA | 0.001 | NA |
7. B | Q9FUT3 | ABC transporter B family member 23, mitochondrial | 1.73e-10 | NA | 1.94e-22 | NA |
7. B | Q552P3 | ABC transporter A family member 11 | 2.06e-05 | NA | 3.59e-14 | NA |
7. B | Q7DM58 | ABC transporter C family member 4 | 5.45e-06 | NA | 1.31e-16 | NA |
7. B | Q5FMM1 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 3.01e-13 | NA |
7. B | Q9LK62 | ABC transporter C family member 7 | 7.45e-06 | NA | 1.95e-15 | NA |
7. B | O06980 | Uncharacterized ABC transporter ATP-binding protein YvcR | 1.50e-14 | NA | 1.33e-16 | NA |
7. B | Q96J66 | ATP-binding cassette sub-family C member 11 | 5.12e-06 | NA | 7.13e-13 | NA |
7. B | P63377 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.65e-21 | NA |
7. B | Q8Z2X5 | Autoinducer 2 import ATP-binding protein LsrA | 2.31e-06 | NA | 8.24e-11 | NA |
7. B | Q3JGG7 | Macrolide export ATP-binding/permease protein MacB | 5.51e-10 | NA | 1.20e-13 | NA |
7. B | Q7UU57 | Ribose import ATP-binding protein RbsA | 1.99e-06 | NA | 1.02e-12 | NA |
7. B | Q9M2V6 | ABC transporter G family member 17 | 4.39e-07 | NA | 2.09e-07 | NA |
7. B | P31060 | ABC transporter ATP-binding protein ModF | 6.22e-06 | NA | 1.07e-06 | NA |
7. B | Q8SQI5 | Probable ABC transporter ECU01_0200/ECU01_1410 | 1.05e-11 | NA | 1.14e-20 | NA |
7. B | Q63563 | ATP-binding cassette sub-family C member 9 | 3.23e-06 | NA | 8.18e-15 | NA |
7. B | Q8Z8R5 | Methionine import ATP-binding protein MetN 2 | 5.68e-13 | NA | 3.98e-25 | NA |
7. B | Q7CFR2 | Xylose import ATP-binding protein XylG | 3.77e-06 | NA | 4.91e-13 | NA |
7. B | Q9KHT9 | Carnitine transport ATP-binding protein OpuCA | 3.98e-10 | NA | 4.98e-18 | NA |
7. B | A3DDF6 | Spermidine/putrescine import ATP-binding protein PotA | 1.50e-12 | NA | 2.75e-16 | NA |
7. B | P75355 | Putative ABC transporter ATP-binding protein MG304 homolog | 0.00e+00 | NA | 2.71e-41 | NA |
7. B | Q4QP85 | Fe(3+) ions import ATP-binding protein FbpC | 7.36e-14 | NA | 1.68e-22 | NA |
7. B | O66911 | UvrABC system protein A | 3.85e-03 | NA | 0.008 | NA |
7. B | P0A9W4 | Energy-dependent translational throttle protein EttA | 7.14e-05 | NA | 5.98e-12 | NA |
7. B | Q0WJP9 | Autoinducer 2 import ATP-binding protein LsrA | 1.47e-04 | NA | 1.41e-09 | NA |
7. B | Q44613 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.14e-14 | NA |
7. B | Q67JX3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.71e-56 | NA |
7. B | Q8TTN2 | Putative ABC transporter ATP-binding protein MA_0394 | 0.00e+00 | NA | 5.55e-38 | NA |
7. B | P76027 | Oligopeptide transport ATP-binding protein OppD | 1.39e-11 | NA | 1.77e-14 | NA |
7. B | Q1GHE5 | Ribose import ATP-binding protein RbsA | 1.23e-05 | NA | 8.90e-13 | NA |
7. B | Q9NP58 | ATP-binding cassette sub-family B member 6 | 4.23e-09 | NA | 2.39e-21 | NA |
7. B | Q1GC08 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 4.38e-16 | NA |
7. B | Q57RH4 | Molybdenum import ATP-binding protein ModC | 8.26e-12 | NA | 2.51e-12 | NA |
7. B | Q9VSS1 | Protein Pixie | 6.21e-04 | NA | 4.09e-08 | NA |
7. B | P9WQM1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.16e-10 | NA | 7.91e-25 | NA |
7. B | Q9CIS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.04e-43 | NA |
7. B | Q8XNY7 | Putative ABC transporter ATP-binding protein CPE0195 | 0.00e+00 | NA | 5.50e-39 | NA |
7. B | Q9SGY1 | ABC transporter B family member 10 | 1.50e-06 | NA | 6.78e-21 | NA |
7. B | Q5M4F2 | Phosphate import ATP-binding protein PstB 2 | 0.00e+00 | NA | 5.34e-19 | NA |
7. B | Q87R20 | Lipoprotein-releasing system ATP-binding protein LolD | 2.22e-16 | NA | 1.49e-18 | NA |
7. B | Q92N13 | Hemin import ATP-binding protein HmuV | 5.00e-15 | NA | 3.62e-06 | NA |
7. B | Q81V82 | Petrobactin import ATP-binding protein FpuD | 0.00e+00 | NA | 3.47e-21 | NA |
7. B | P68580 | Sublancin-168-processing and transport ATP-binding protein sunT | NA | NA | 2.34e-09 | NA |
7. B | Q4ZQE3 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 2.02e-10 | NA | 1.86e-19 | NA |
7. B | Q02R79 | Spermidine/putrescine import ATP-binding protein PotA | 1.25e-11 | NA | 7.13e-23 | NA |
7. B | Q8XZX8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.10e-11 | NA | 1.25e-22 | NA |
7. B | Q07PZ0 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 9.76e-15 | NA |
7. B | P97998 | ATP-dependent permease MDL1 | 1.21e-09 | NA | 1.26e-26 | NA |
7. B | P0A699 | UvrABC system protein A | 1.59e-02 | NA | 0.036 | NA |
7. B | B9G5Y5 | ABC transporter G family member 25 | 1.19e-05 | NA | 0.002 | NA |
7. B | Q2IBA1 | Cystic fibrosis transmembrane conductance regulator | 9.31e-05 | NA | 1.07e-11 | NA |
7. B | Q0TUN8 | Energy-coupling factor transporter ATP-binding protein EcfA3 | 0.00e+00 | NA | 1.15e-39 | NA |
7. B | O69051 | Phosphite import ATP-binding protein PxtA | 0.00e+00 | NA | 1.27e-13 | NA |
7. B | Q6LR20 | Spermidine/putrescine import ATP-binding protein PotA | 1.21e-11 | NA | 3.58e-25 | NA |
7. B | Q6N7Y6 | Hemin import ATP-binding protein HmuV | 5.11e-15 | NA | 2.12e-18 | NA |
7. B | Q4QN44 | Ribose import ATP-binding protein RbsA | 1.06e-06 | NA | 5.67e-13 | NA |
7. B | Q4WTT9 | ABC multidrug transporter mdr1 | 1.01e-06 | NA | 2.25e-23 | NA |
7. B | Q71X09 | Methionine import ATP-binding protein MetN 2 | 5.55e-16 | NA | 4.76e-27 | NA |
7. B | Q8CRI7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.59e-41 | NA |
7. B | P44513 | Fe(3+) ions import ATP-binding protein FbpC 2 | 8.37e-14 | NA | 8.88e-23 | NA |
7. B | Q983H5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 4.78e-11 | NA | 7.19e-19 | NA |
7. B | Q8X5N2 | Hemin import ATP-binding protein HmuV | 8.55e-15 | NA | 2.06e-18 | NA |
7. B | Q5FL41 | Spermidine/putrescine import ATP-binding protein PotA | 8.99e-15 | NA | 1.29e-24 | NA |
7. B | Q3E9B8 | ABC transporter G family member 23 | 3.38e-06 | NA | 2.81e-08 | NA |
7. B | Q88ZJ6 | Spermidine/putrescine import ATP-binding protein PotA | 2.90e-12 | NA | 2.92e-20 | NA |
7. B | P0CI33 | Methionine import ATP-binding protein MetN | 1.81e-14 | NA | 1.52e-23 | NA |
7. B | A5F1V0 | Vitamin B12 import ATP-binding protein BtuD | 7.66e-15 | NA | 5.56e-08 | NA |
7. B | Q8X6U5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.00e-11 | NA | 3.91e-23 | NA |
7. B | Q8T683 | ABC transporter G family member 9 | 1.00e-03 | NA | 0.025 | NA |
7. B | Q2RZ08 | Hemin import ATP-binding protein HmuV | 1.67e-14 | NA | 2.32e-06 | NA |
7. B | D4GP38 | Xylose/arabinose import ATP-binding protein XacJ | 1.06e-13 | NA | 1.26e-26 | NA |
7. B | Q1MCN6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 2.76e-11 | NA | 3.05e-23 | NA |
7. B | Q5NIG3 | ATP-dependent lipid A-core flippase | 2.19e-11 | NA | 1.12e-23 | NA |
7. B | Q8Y0X3 | Methionine import ATP-binding protein MetN | 9.03e-14 | NA | 1.66e-29 | NA |
7. B | Q8D7T7 | Ribose import ATP-binding protein RbsA | 5.67e-07 | NA | 7.95e-11 | NA |
7. B | P16521 | Elongation factor 3A | 1.38e-03 | NA | 0.030 | NA |
7. B | Q65TH4 | Macrolide export ATP-binding/permease protein MacB | 4.67e-08 | NA | 1.33e-16 | NA |
7. B | Q9FJH6 | ABC transporter F family member 1 | 5.66e-06 | NA | 3.17e-06 | NA |
7. B | P74548 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.20e-11 | NA | 1.68e-26 | NA |
7. B | Q98DW6 | Taurine import ATP-binding protein TauB | 1.03e-12 | NA | 2.08e-16 | NA |
7. B | Q02QE8 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 7.66e-08 | NA |
7. B | A9MZG1 | Autoinducer 2 import ATP-binding protein LsrA | 2.54e-06 | NA | 4.00e-11 | NA |
7. B | Q20Z38 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.34e-10 | NA | 4.12e-18 | NA |
7. B | Q8UB29 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 1.84e-11 | NA | 6.97e-28 | NA |
7. B | Q8G0I9 | UvrABC system protein A | 8.75e-03 | NA | 0.025 | NA |
7. B | Q7NTN6 | Ribose import ATP-binding protein RbsA | 4.48e-06 | NA | 1.27e-13 | NA |
7. B | Q7ME63 | Molybdenum import ATP-binding protein ModC | 1.14e-11 | NA | 1.29e-18 | NA |
7. B | Q5P6D5 | Macrolide export ATP-binding/permease protein MacB | 9.61e-08 | NA | 7.11e-12 | NA |
7. B | Q4UMZ3 | Putative export ATP-binding/permease protein RF_0214 | 3.82e-10 | NA | 2.59e-20 | NA |
7. B | Q8DMX9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.04e-67 | NA |
7. B | O51587 | Spermidine/putrescine import ATP-binding protein PotA | 4.70e-12 | NA | 2.85e-26 | NA |
7. B | Q2RWA3 | Methionine import ATP-binding protein MetN | 1.84e-14 | NA | 2.24e-21 | NA |
7. B | Q8PC11 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.93e-13 | NA | 1.34e-26 | NA |
7. B | Q8FB37 | Maltose/maltodextrin import ATP-binding protein MalK | 1.80e-14 | NA | 7.32e-24 | NA |
7. B | Q1R528 | Xylose import ATP-binding protein XylG | 4.68e-06 | NA | 4.20e-12 | NA |
7. B | A1AGY1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 8.54e-11 | NA | 5.59e-22 | NA |
7. B | P18766 | Oligopeptide transport ATP-binding protein AmiF | 1.55e-13 | NA | 2.21e-21 | NA |
7. B | Q07E16 | Cystic fibrosis transmembrane conductance regulator | 7.98e-05 | NA | 3.89e-11 | NA |
7. B | Q13U53 | Arabinose import ATP-binding protein AraG | 6.07e-06 | NA | 3.45e-08 | NA |
7. B | Q54DT1 | ABC transporter A family member 9 | 5.00e-06 | NA | 6.96e-08 | NA |
7. B | Q8CTB2 | Methionine import ATP-binding protein MetN 1 | 7.33e-15 | NA | 6.65e-25 | NA |
7. B | Q21XJ9 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.06e-09 | NA | 1.97e-15 | NA |
7. B | Q555Z5 | ABC transporter A family member 4 | 7.04e-04 | NA | 5.71e-12 | NA |
7. B | P77265 | Multidrug resistance-like ATP-binding protein MdlA | 2.02e-09 | NA | 1.32e-14 | NA |
7. B | Q7MKU3 | Spermidine/putrescine import ATP-binding protein PotA | 9.25e-10 | NA | 4.66e-27 | NA |
7. B | Q5HCL3 | Putative ABC transporter ATP-binding protein SACOL2708 | 1.25e-07 | NA | 9.79e-27 | NA |
7. B | Q8Z4V6 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.23e-13 | NA | 1.20e-22 | NA |
7. B | O88039 | ABC transporter ATP-binding protein RamA | 1.48e-09 | NA | 5.39e-05 | NA |
7. B | Q1BY14 | Methionine import ATP-binding protein MetN 1 | 5.77e-14 | NA | 1.35e-25 | NA |
7. B | C0SP98 | Putative oligopeptide transport ATP-binding protein YkfD | 5.12e-13 | NA | 4.79e-16 | NA |
7. B | Q88CL2 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.44e-16 | NA | 1.52e-27 | NA |
7. B | P30750 | Methionine import ATP-binding protein MetN | 1.73e-13 | NA | 2.66e-24 | NA |
7. B | Q32I01 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.43e-13 | NA | 4.09e-07 | NA |
7. B | P95487 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.64e-13 | NA | 2.49e-06 | NA |
7. B | Q1CA99 | Macrolide export ATP-binding/permease protein MacB 1 | 1.20e-07 | NA | 3.70e-16 | NA |
7. B | Q3B276 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 0.00e+00 | NA | 1.22e-14 | NA |
7. B | P12622 | ATP-binding protein ChvD (Fragment) | 1.51e-03 | NA | 0.015 | NA |
7. B | Q1MA70 | Molybdenum import ATP-binding protein ModC | 7.42e-12 | NA | 7.54e-16 | NA |
7. B | K3VYH8 | ABC transporter FPSE_09185 | 9.67e-07 | NA | 1.44e-24 | NA |
7. B | Q8DUF7 | Spermidine/putrescine import ATP-binding protein PotA | 2.76e-14 | NA | 3.80e-21 | NA |
7. B | Q2NSZ1 | Macrolide export ATP-binding/permease protein MacB | 1.71e-08 | NA | 1.38e-14 | NA |
7. B | Q1GB17 | Spermidine/putrescine import ATP-binding protein PotA | 9.10e-15 | NA | 3.19e-23 | NA |
7. B | Q3KDI1 | Phosphonates import ATP-binding protein PhnC | 3.33e-16 | NA | 1.82e-07 | NA |
7. B | Q9SW08 | ABC transporter G family member 4 | 4.52e-07 | NA | 6.12e-11 | NA |
7. B | O85818 | Spermidine/putrescine import ATP-binding protein PotA | 1.43e-11 | NA | 3.80e-27 | NA |
7. B | Q0HYN8 | Molybdenum import ATP-binding protein ModC | 6.74e-09 | NA | 2.69e-20 | NA |
7. B | Q5D1Z7 | Cystic fibrosis transmembrane conductance regulator | 9.60e-05 | NA | 2.97e-10 | NA |
7. B | Q89UD2 | Sulfate/thiosulfate import ATP-binding protein CysA | 7.47e-12 | NA | 3.78e-26 | NA |
7. B | Q8FJR4 | Molybdenum import ATP-binding protein ModC | 5.13e-12 | NA | 4.86e-12 | NA |
7. B | Q3J1N0 | Methionine import ATP-binding protein MetN | 1.63e-11 | NA | 8.31e-24 | NA |
7. B | Q2YJE7 | Xylose import ATP-binding protein XylG | 6.02e-06 | NA | 3.34e-09 | NA |
7. B | Q722B1 | Spermidine/putrescine import ATP-binding protein PotA | 1.65e-14 | NA | 1.07e-25 | NA |
7. B | Q9SIT6 | ABC transporter G family member 5 | 6.17e-07 | NA | 2.77e-08 | NA |
7. B | Q88YN5 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.27e-11 | NA |
7. B | P0A2V4 | Oligopeptide transport ATP-binding protein OppF | 1.31e-13 | NA | 5.19e-17 | NA |
7. B | A0R6H7 | Mycobactin import ATP-binding/permease protein IrtB | 3.82e-09 | NA | 3.69e-21 | NA |
7. B | Q9TSP5 | Cystic fibrosis transmembrane conductance regulator | 8.43e-05 | NA | 2.19e-11 | NA |
7. B | Q49WM4 | Spermidine/putrescine import ATP-binding protein PotA | 3.58e-12 | NA | 4.02e-21 | NA |
7. B | O05253 | Guanosine import ATP-binding protein NupO | 3.77e-06 | NA | 2.40e-19 | NA |
7. B | P60752 | ATP-dependent lipid A-core flippase | 4.15e-11 | NA | 4.89e-21 | NA |
7. B | P0A9U2 | Probable multidrug ABC transporter ATP-binding protein YbhF | 7.30e-07 | NA | 4.07e-17 | NA |
7. B | Q0SBZ1 | Fe(3+) ions import ATP-binding protein FbpC 1 | 5.32e-13 | NA | 5.96e-25 | NA |
7. B | Q2G2M9 | Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 | 3.41e-12 | NA | 4.40e-22 | NA |
7. B | A7MVV6 | Vitamin B12 import ATP-binding protein BtuD | 6.99e-14 | NA | 1.04e-05 | NA |
7. B | P57013 | Capsule polysaccharide export ATP-binding protein CtrD | 6.02e-12 | NA | 5.26e-10 | NA |
7. B | H2LNR5 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 3.20e-09 | NA | 7.00e-24 | NA |
7. B | O14134 | mRNA export factor elf1 | 2.27e-04 | NA | 0.009 | NA |
7. B | Q2RGX2 | Xylose import ATP-binding protein XylG | 2.34e-06 | NA | 1.85e-14 | NA |
7. B | Q9LV93 | ABC transporter F family member 5 | 3.19e-06 | NA | 1.20e-06 | NA |
7. B | Q2P3U8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.01e-12 | NA | 5.94e-10 | NA |
7. B | P9WQL9 | Doxorubicin resistance ATP-binding protein DrrA | 2.33e-13 | NA | 4.91e-11 | NA |
7. B | P23878 | Ferric enterobactin transport ATP-binding protein FepC | 1.28e-14 | NA | 4.61e-17 | NA |
7. B | Q664X5 | Maltose/maltodextrin import ATP-binding protein MalK | 2.55e-11 | NA | 2.75e-26 | NA |
7. B | Q87GB5 | Maltose/maltodextrin import ATP-binding protein MalK | 3.19e-11 | NA | 3.06e-25 | NA |
7. B | Q6DB87 | Ribose import ATP-binding protein RbsA | 4.64e-07 | NA | 4.11e-15 | NA |
7. B | Q2T4S8 | Arabinose import ATP-binding protein AraG 2 | 1.85e-06 | NA | 1.55e-11 | NA |
7. B | Q5E4V6 | Ribose import ATP-binding protein RbsA | 6.12e-07 | NA | 5.40e-11 | NA |
7. B | A0A1Y0BRF0 | ABC-type transporter adrC | 2.53e-03 | NA | 0.009 | NA |
7. B | P21439 | Phosphatidylcholine translocator ABCB4 | 2.10e-06 | NA | 1.14e-19 | NA |
7. B | Q987E7 | Ribose import ATP-binding protein RbsA 2 | 9.74e-06 | NA | 5.84e-13 | NA |
7. B | Q9PF03 | Methionine import ATP-binding protein MetN | 8.88e-16 | NA | 9.11e-25 | NA |
7. B | Q74IV9 | Methionine import ATP-binding protein MetN | 2.89e-15 | NA | 9.01e-32 | NA |
7. B | Q13TV1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.69e-11 | NA | 3.64e-21 | NA |
7. B | Q9C8J8 | ABC transporter G family member 13 | 6.27e-07 | NA | 0.001 | NA |
7. B | Q7MN25 | Methionine import ATP-binding protein MetN | 2.71e-13 | NA | 6.90e-25 | NA |
7. B | G5EFD4 | Heavy metal tolerance factor 1 | 5.67e-09 | NA | 8.56e-25 | NA |
7. B | E9RBG1 | ABC multidrug transporter C | 2.27e-03 | NA | 0.024 | NA |
7. B | Q6Q876 | Multidrug resistance protein sirA | 1.65e-06 | NA | 2.06e-16 | NA |
7. B | P75552 | Oligopeptide transport ATP-binding protein OppD | 5.81e-09 | NA | 8.96e-13 | NA |
7. B | P0AAF6 | Arginine transport ATP-binding protein ArtP | 0.00e+00 | NA | 3.62e-21 | NA |
7. B | Q1WSB9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.73e-44 | NA |
7. B | Q1JEC9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q2K1C8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 | 4.24e-12 | NA | 1.05e-21 | NA |
7. B | Q9ZU35 | ABC transporter G family member 7 | 1.42e-05 | NA | 0.003 | NA |
7. B | Q8ZKV9 | Ribose import ATP-binding protein RbsA | 4.40e-07 | NA | 3.59e-12 | NA |
7. B | Q31V51 | Xylose import ATP-binding protein XylG | 4.22e-06 | NA | 4.89e-12 | NA |
7. B | Q5YRD1 | Methionine import ATP-binding protein MetN | 2.58e-14 | NA | 2.15e-26 | NA |
7. B | Q5X6P7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.13e-13 | NA | 0.024 | NA |
7. B | Q68VV5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.75e-12 | NA | 4.00e-04 | NA |
7. B | Q58129 | Uncharacterized ABC transporter ATP-binding protein MJ0719 | 1.57e-04 | NA | 5.65e-11 | NA |
7. B | A3CRB8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.74e-50 | NA |
7. B | Q9K876 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.23e-13 | NA | 2.57e-27 | NA |
7. B | A0PXX8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.68e-46 | NA |
7. B | Q7N8B9 | Fe(3+) ions import ATP-binding protein FbpC | 7.92e-12 | NA | 2.89e-21 | NA |
7. B | Q2YKZ7 | Putative ATP-binding protein BAB2_0493 | 2.45e-12 | NA | 4.33e-20 | NA |
7. B | Q8ELA5 | Methionine import ATP-binding protein MetN 4 | 4.47e-14 | NA | 4.96e-23 | NA |
7. B | Q8ENJ6 | UvrABC system protein A | 2.13e-02 | NA | 0.012 | NA |
7. B | Q8T686 | ABC transporter G family member 7 | 3.88e-05 | NA | 1.71e-06 | NA |
7. B | Q49W48 | Methionine import ATP-binding protein MetN | 3.05e-13 | NA | 3.93e-27 | NA |
7. B | Q9KRT4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.16e-12 | NA | 1.06e-26 | NA |
7. B | A0A0H2ZGN6 | Di/tripeptide transport ATP-binding protein DppD | 2.58e-11 | NA | 2.11e-16 | NA |
7. B | Q9MAG3 | ABC transporter G family member 24 | 2.59e-05 | NA | 0.008 | NA |
7. B | Q00553 | Cystic fibrosis transmembrane conductance regulator | 8.38e-05 | NA | 2.41e-11 | NA |
7. B | Q93SH7 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 2.60e-15 | NA |
7. B | Q7TMS5 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.57e-07 | NA | 0.019 | NA |
7. B | Q81J15 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.28e-39 | NA |
7. B | P53049 | Oligomycin resistance ATP-dependent permease YOR1 | 2.77e-05 | NA | 2.50e-14 | NA |
7. B | Q31Z24 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.40e-13 | NA | 0.001 | NA |
7. B | P41233 | Phospholipid-transporting ATPase ABCA1 | 2.15e-03 | NA | 7.01e-19 | NA |
7. B | Q1AVD3 | Ribose import ATP-binding protein RbsA 2 | 9.50e-07 | NA | 7.76e-13 | NA |
7. B | Q609Q1 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.26e-11 | NA | 2.47e-26 | NA |
7. B | Q0BKJ3 | ATP-dependent lipid A-core flippase | 2.06e-11 | NA | 3.79e-23 | NA |
7. B | Q57HW1 | Ribose import ATP-binding protein RbsA | 4.46e-07 | NA | 3.08e-12 | NA |
7. B | Q9LID6 | ABC transporter E family member 1 | 7.23e-04 | NA | 1.08e-07 | NA |
7. B | Q8FWP2 | Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 | 2.22e-13 | NA | 2.50e-15 | NA |
7. B | Q9H172 | ATP-binding cassette sub-family G member 4 | 5.38e-07 | NA | 5.46e-07 | NA |
7. B | Q7N6Z2 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.14e-13 | NA | 1.74e-25 | NA |
7. B | D0MYB4 | Elongation factor 3 | 1.12e-03 | NA | 0.016 | NA |
7. B | P9WQK5 | Uncharacterized ABC transporter ATP-binding protein Rv0073 | 3.33e-16 | NA | 3.08e-12 | NA |
7. B | D4GPW3 | Glucose import ATP-binding protein TsgD13 | 3.84e-06 | NA | 1.13e-08 | NA |
7. B | Q2IN45 | Phosphonates import ATP-binding protein PhnC | 1.88e-08 | NA | 1.30e-12 | NA |
7. B | Q54LE6 | ABC transporter C family member 5 | 3.54e-06 | NA | 9.17e-14 | NA |
7. B | Q160G4 | Hemin import ATP-binding protein HmuV | 3.82e-14 | NA | 3.75e-05 | NA |
7. B | Q98G42 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.28e-11 | NA | 1.13e-22 | NA |
7. B | Q8XAW7 | Ribose import ATP-binding protein RbsA 1 | 4.27e-07 | NA | 8.98e-14 | NA |
7. B | Q8E7N9 | Ribose import ATP-binding protein RbsA | 4.76e-06 | NA | 1.15e-11 | NA |
7. B | Q6AMR9 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.73e-11 | NA |
7. B | Q5E3S7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.27e-14 | NA | 7.81e-07 | NA |
7. B | Q3K3R2 | Ribose import ATP-binding protein RbsA | 2.97e-06 | NA | 9.10e-12 | NA |
7. B | Q6LN52 | Methionine import ATP-binding protein MetN | 5.52e-14 | NA | 3.66e-25 | NA |
7. B | P25256 | Tylosin resistance ATP-binding protein TlrC | 5.67e-06 | NA | 3.01e-04 | NA |
7. B | Q18KE1 | Phosphonates import ATP-binding protein PhnC 1 | 1.11e-16 | NA | 1.02e-16 | NA |
7. B | P45321 | Molybdenum import ATP-binding protein ModC | 2.63e-12 | NA | 6.95e-20 | NA |
7. B | Q1CDC0 | Xylose import ATP-binding protein XylG | 3.62e-06 | NA | 4.91e-13 | NA |
7. B | P34158 | Cystic fibrosis transmembrane conductance regulator | 7.48e-05 | NA | 1.75e-11 | NA |
7. B | B9G300 | ABC transporter G family member 52 | 4.52e-04 | NA | 0.014 | NA |
7. B | Q5WCI1 | Aliphatic sulfonates import ATP-binding protein SsuB 2 | 6.90e-11 | NA | 8.20e-23 | NA |
7. B | Q8XPK6 | Xylose import ATP-binding protein XylG | 1.64e-06 | NA | 1.02e-07 | NA |
7. B | Q3SQZ1 | Macrolide export ATP-binding/permease protein MacB | 5.28e-10 | NA | 3.13e-14 | NA |
7. B | Q6FK23 | Pleiotropic ABC efflux transporter of multiple drugs CDR1 | 2.77e-03 | NA | 0.004 | NA |
7. B | Q68Y13 | Zinc import ATP-binding protein ZnuC | 1.75e-09 | NA | 3.78e-18 | NA |
7. B | Q28689 | ATP-binding cassette sub-family C member 2 | 1.77e-05 | NA | 5.22e-13 | NA |
7. B | P44808 | Probable ATP-binding protein YheS | 2.28e-06 | NA | 1.14e-05 | NA |
7. B | Q6LQ77 | Vitamin B12 import ATP-binding protein BtuD | 2.63e-14 | NA | 3.73e-15 | NA |
7. B | Q72Y96 | Methionine import ATP-binding protein MetN 3 | 8.88e-16 | NA | 6.60e-26 | NA |
7. B | P0AAF3 | Arabinose import ATP-binding protein AraG | 2.14e-06 | NA | 1.32e-10 | NA |
7. B | P9WER4 | ABC-type transporter braE | NA | NA | 2.48e-08 | NA |
7. B | Q64SQ6 | Spermidine/putrescine import ATP-binding protein PotA | 3.06e-14 | NA | 2.18e-25 | NA |
7. B | Q03ZL5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.56e-36 | NA |
7. B | Q8FUR8 | Xylose import ATP-binding protein XylG | 2.98e-06 | NA | 2.45e-09 | NA |
7. B | Q2NRN5 | Methionine import ATP-binding protein MetN | 7.65e-13 | NA | 3.02e-25 | NA |
7. B | Q1M8R6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 6.76e-12 | NA | 1.77e-27 | NA |
7. B | Q9KS33 | Spermidine/putrescine import ATP-binding protein PotA | 9.65e-12 | NA | 1.84e-26 | NA |
7. B | Q81IZ6 | Methionine import ATP-binding protein MetN 1 | 2.58e-14 | NA | 1.91e-20 | NA |
7. B | Q12B04 | Methionine import ATP-binding protein MetN | 2.93e-14 | NA | 9.49e-24 | NA |
7. B | Q8SRV5 | Probable ATP-binding cassette sub-family F member 3 homolog | 3.22e-07 | NA | 1.06e-06 | NA |
7. B | Q1BX03 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 2.25e-06 | NA | 8.14e-15 | NA |
7. B | O27739 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 9.41e-43 | NA |
7. B | Q9ZJ34 | Methionine import ATP-binding protein MetN | 8.73e-14 | NA | 4.73e-22 | NA |
7. B | P97046 | Multidrug resistance ABC transporter ATP-binding and permease protein | 4.29e-10 | NA | 2.90e-18 | NA |
7. B | Q92LX3 | Methionine import ATP-binding protein MetN | 1.98e-13 | NA | 2.19e-23 | NA |
7. B | Q2KVK2 | Methionine import ATP-binding protein MetN | 6.25e-14 | NA | 9.05e-26 | NA |
7. B | Q1R597 | Hemin import ATP-binding protein HmuV | 9.33e-15 | NA | 7.10e-18 | NA |
7. B | Q5E586 | Spermidine/putrescine import ATP-binding protein PotA | 8.75e-12 | NA | 1.62e-23 | NA |
7. B | Q91WA9 | ATP-binding cassette subfamily G member 4 | 5.50e-07 | NA | 1.20e-06 | NA |
7. B | Q6GIH9 | Methionine import ATP-binding protein MetN 2 | 2.85e-13 | NA | 1.48e-26 | NA |
7. B | Q2J2E9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.24e-12 | NA | 1.76e-24 | NA |
7. B | Q5HJM6 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 2.06e-09 | NA |
7. B | Q93YS4 | ABC transporter G family member 22 | 3.70e-07 | NA | 4.25e-06 | NA |
7. B | Q7MLE6 | Vitamin B12 import ATP-binding protein BtuD | 2.08e-13 | NA | 1.40e-06 | NA |
7. B | Q62A98 | Hemin import ATP-binding protein HmuV | 4.85e-14 | NA | 8.88e-04 | NA |
7. B | Q73BM0 | Spermidine/putrescine import ATP-binding protein PotA | 7.55e-15 | NA | 3.78e-21 | NA |
7. B | Q5SSE9 | ATP-binding cassette sub-family A member 13 | NA | NA | 6.82e-12 | NA |
7. B | Q9UG63 | ATP-binding cassette sub-family F member 2 | 2.64e-06 | NA | 0.001 | NA |
7. B | Q7CHF8 | Methionine import ATP-binding protein MetN 2 | 2.76e-13 | NA | 5.57e-19 | NA |
7. B | Q2K6L3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 1.78e-11 | NA | 5.82e-28 | NA |
7. B | Q8K449 | ATP-binding cassette sub-family A member 9 | 5.76e-05 | NA | 1.31e-13 | NA |
7. B | Q7WP62 | Molybdenum import ATP-binding protein ModC | 4.93e-12 | NA | 4.21e-17 | NA |
7. B | Q8LPK0 | ABC transporter A family member 8 | 7.53e-06 | NA | 3.55e-08 | NA |
7. B | Q4GZT4 | Broad substrate specificity ATP-binding cassette transporter ABCG2 | 2.22e-07 | NA | 0.034 | NA |
7. B | Q1RAN8 | Arabinose import ATP-binding protein AraG | 2.25e-06 | NA | 7.06e-11 | NA |
7. B | A0A0M3R8G1 | ABC transporter G family member STR | 4.57e-05 | NA | 4.70e-06 | NA |
7. B | Q2YJJ9 | Putative peptide import ATP-binding protein BAB2_1052 | 1.01e-10 | NA | 8.46e-17 | NA |
7. B | Q9CXJ4 | Mitochondrial potassium channel ATP-binding subunit | 4.64e-09 | NA | 1.13e-16 | NA |
7. B | Q65SW3 | Molybdenum import ATP-binding protein ModC | 2.54e-12 | NA | 4.52e-20 | NA |
7. B | Q8UCD5 | Molybdenum import ATP-binding protein ModC | 1.41e-12 | NA | 1.78e-19 | NA |
7. B | Q6D664 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 8.17e-16 | NA |
7. B | Q87LA0 | UvrABC system protein A | 4.46e-03 | NA | 0.031 | NA |
7. B | Q84K47 | ABC transporter A family member 2 | 2.39e-06 | NA | 1.37e-12 | NA |
7. B | P68188 | Maltose/maltodextrin import ATP-binding protein MalK | 3.35e-11 | NA | 7.18e-24 | NA |
7. B | Q82JY6 | Fe(3+) ions import ATP-binding protein FbpC | 1.71e-14 | NA | 4.47e-22 | NA |
7. B | Q3K0Y6 | Spermidine/putrescine import ATP-binding protein PotA | 2.06e-12 | NA | 7.14e-27 | NA |
7. B | Q9LFG8 | ABC transporter G family member 20 | 5.97e-05 | NA | 2.05e-06 | NA |
7. B | P23886 | ATP-binding/permease protein CydC | 1.13e-11 | NA | 2.93e-16 | NA |
7. B | P34712 | Multidrug resistance protein pgp-1 | 2.42e-06 | NA | 4.30e-23 | NA |
7. B | Q2FZZ2 | Methionine import ATP-binding protein MetN 2 | 2.28e-13 | NA | 1.65e-26 | NA |
7. B | P45843 | Protein scarlet | 2.81e-07 | NA | 1.28e-05 | NA |
7. B | Q8RBQ1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 3.61e-06 | NA | 5.84e-15 | NA |
7. B | Q3SVV2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.03e-13 | NA | 0.022 | NA |
7. B | Q53194 | Probable peptide ABC transporter ATP-binding protein y4tS | 1.66e-13 | NA | 1.75e-20 | NA |
7. B | Q5YZY9 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.27e-11 | NA | 1.15e-24 | NA |
7. B | Q5HLN4 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | NA | 1.56e-10 | NA |
7. B | Q81IN8 | Methionine import ATP-binding protein MetN 2 | 1.78e-15 | NA | 8.19e-27 | NA |
7. B | P63375 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.65e-21 | NA |
7. B | Q5XDS8 | Methionine import ATP-binding protein MetN | 2.42e-13 | NA | 2.89e-29 | NA |
7. B | Q66CL2 | Macrolide export ATP-binding/permease protein MacB 1 | 1.26e-07 | NA | 3.70e-16 | NA |
7. B | Q99WE1 | Methionine import ATP-binding protein MetN 1 | 3.44e-14 | NA | 3.71e-24 | NA |
7. B | Q9USH9 | Uncharacterized ABC transporter ATP-binding protein C825.01 | 2.56e-05 | NA | 4.62e-04 | NA |
7. B | Q13IS7 | Taurine import ATP-binding protein TauB 3 | 5.12e-13 | NA | 1.51e-17 | NA |
7. B | Q8NUH8 | Putative ABC transporter ATP-binding protein MW2603 | 1.97e-07 | NA | 9.16e-27 | NA |
7. B | O21280 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.41e-13 | NA | 7.02e-05 | NA |
7. B | Q8ZRM9 | Methionine import ATP-binding protein MetN 1 | 4.08e-13 | NA | 1.93e-25 | NA |
7. B | Q9SKX0 | ABC transporter C family member 13 | 1.39e-06 | NA | 4.14e-17 | NA |
7. B | Q576K0 | Zinc import ATP-binding protein ZnuC | 4.16e-14 | NA | 1.52e-16 | NA |
7. B | Q54TV1 | ABC transporter G family member 6 | 3.08e-03 | NA | 2.77e-07 | NA |
7. B | Q8T6H8 | ABC transporter C family member 1 | 1.67e-06 | NA | 7.93e-18 | NA |
7. B | Q4WFQ4 | ABC multidrug transporter H | 1.06e-03 | NA | 6.06e-04 | NA |
7. B | P24136 | Oligopeptide transport ATP-binding protein OppD | 7.00e-11 | NA | 1.98e-16 | NA |
7. B | Q99LE6 | ATP-binding cassette sub-family F member 2 | 5.40e-07 | NA | 0.001 | NA |
7. B | Q2RQQ0 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 0.00e+00 | NA | 5.53e-16 | NA |
7. B | Q54CG0 | ABC transporter G family member 10 | 1.49e-03 | NA | 0.001 | NA |
7. B | Q748K0 | Putative ABC transporter ATP-binding protein GSU3001 | 0.00e+00 | NA | 1.81e-33 | NA |
7. B | Q4WA92 | ABC multidrug transporter E | 1.23e-05 | NA | 1.71e-16 | NA |
7. B | P0A9S7 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 0.00e+00 | NA | 5.86e-15 | NA |
7. B | Q3BSL0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.81e-13 | NA | 9.34e-09 | NA |
7. B | P45844 | ATP-binding cassette sub-family G member 1 | 3.95e-05 | NA | 4.74e-11 | NA |
7. B | Q7UC29 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.94e-13 | NA | 1.59e-22 | NA |
7. B | P63354 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.44e-15 | NA | 1.75e-25 | NA |
7. B | Q885N4 | Aliphatic sulfonates import ATP-binding protein SsuB 1 | 7.46e-13 | NA | 1.66e-19 | NA |
7. B | Q1B8V9 | Spermidine/putrescine import ATP-binding protein PotA | 6.84e-10 | NA | 1.46e-17 | NA |
7. B | Q4ZTW1 | Arabinose import ATP-binding protein AraG | 2.32e-06 | NA | 1.91e-10 | NA |
7. B | Q9FNB5 | ABC transporter G family member 6 | 3.15e-05 | NA | 0.045 | NA |
7. B | P9WQL6 | Fluoroquinolones export ATP-binding protein MT2762 | 8.30e-10 | NA | 6.02e-19 | NA |
7. B | P42065 | Oligopeptide transport ATP-binding protein AppF | 1.95e-12 | NA | 7.05e-18 | NA |
7. B | Q5HM28 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 7.75e-41 | NA |
7. B | Q9KFL0 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 1.62e-14 | NA |
7. B | Q9AE30 | Hemin import ATP-binding protein HmuV | 4.64e-14 | NA | 4.31e-13 | NA |
7. B | Q1DCP5 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 1.15e-07 | NA |
7. B | Q9K6J9 | Ribose import ATP-binding protein RbsA | 1.33e-06 | NA | 1.71e-16 | NA |
7. B | Q9QYJ4 | ABC-type oligopeptide transporter ABCB9 | 5.15e-09 | NA | 5.42e-16 | NA |
7. B | Q9FLT8 | ABC transporter A family member 12 | 1.43e-06 | NA | 1.36e-08 | NA |
7. B | Q9V2C0 | Molybdate/tungstate import ATP-binding protein WtpC | 1.89e-14 | NA | 3.49e-22 | NA |
7. B | A1B9K8 | Zinc import ATP-binding protein ZnuC | 3.55e-15 | NA | 2.86e-16 | NA |
7. B | Q8ZQM4 | Glutathione import ATP-binding protein GsiA | 7.14e-07 | NA | 2.89e-18 | NA |
7. B | Q7VI92 | Methionine import ATP-binding protein MetN | 1.80e-13 | NA | 5.98e-19 | NA |
7. B | P78595 | Multidrug resistance protein CDR2 | 3.06e-03 | NA | 0.003 | NA |
7. B | Q0AU85 | Methionine import ATP-binding protein MetN | 1.56e-13 | NA | 7.51e-25 | NA |
7. B | Q9M0D0 | ABC transporter E family member 3 | 5.74e-08 | NA | 2.21e-06 | NA |
7. B | Q8D954 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.34e-12 | NA | 1.31e-25 | NA |
7. B | Q2SMN9 | Macrolide export ATP-binding/permease protein MacB | 7.72e-10 | NA | 2.35e-13 | NA |
7. B | P69877 | Spermidine/putrescine import ATP-binding protein PotA | 1.06e-11 | NA | 4.73e-24 | NA |
7. B | Q87UV4 | Methionine import ATP-binding protein MetN 1 | 1.97e-11 | NA | 1.96e-20 | NA |
7. B | Q5ZX76 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.26e-13 | NA | 0.024 | NA |
7. B | Q8X5U9 | UvrABC system protein A | 1.48e-02 | NA | 0.036 | NA |
7. B | Q8DIA0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.35e-11 | NA | 1.14e-25 | NA |
7. B | Q2SB47 | Hemin import ATP-binding protein HmuV | 4.33e-15 | NA | 4.38e-13 | NA |
7. B | Q483B6 | ATP-dependent lipid A-core flippase 1 | 9.85e-12 | NA | 4.49e-25 | NA |
7. B | O95477 | Phospholipid-transporting ATPase ABCA1 | 7.42e-04 | NA | 7.61e-19 | NA |
7. B | Q3MB44 | Ribose import ATP-binding protein RbsA | 6.83e-06 | NA | 3.67e-11 | NA |
7. B | Q48V78 | Methionine import ATP-binding protein MetN | 2.40e-13 | NA | 5.67e-29 | NA |
7. B | P0A9W3 | Energy-dependent translational throttle protein EttA | 7.01e-04 | NA | 5.98e-12 | NA |
7. B | Q578K3 | Fe(3+) ions import ATP-binding protein FbpC | 4.44e-14 | NA | 5.34e-24 | NA |
7. B | Q54U44 | ABC transporter C family member 12 | 2.64e-06 | NA | 3.67e-14 | NA |
7. B | P0C2H3 | Macrolide export ATP-binding/permease protein MacB 2 | 2.14e-08 | NA | 4.87e-16 | NA |
7. B | P9WQK7 | UvrABC system protein A | 2.30e-02 | NA | 0.003 | NA |
7. B | Q62K72 | Nod factor export ATP-binding protein I | 1.97e-10 | NA | 1.91e-19 | NA |
7. B | Q881C1 | Molybdenum import ATP-binding protein ModC | 2.54e-12 | NA | 9.04e-19 | NA |
7. B | B1XEA1 | Autoinducer 2 import ATP-binding protein LsrA | 1.46e-06 | NA | 3.50e-14 | NA |
7. B | Q1QYT1 | Arabinose import ATP-binding protein AraG | 3.65e-06 | NA | 7.82e-17 | NA |
7. B | Q8YHC4 | UvrABC system protein A | 9.83e-03 | NA | 0.024 | NA |
7. B | Q04HV8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.28e-46 | NA |
7. B | Q6GCY2 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 2.06e-09 | NA |
7. B | P45046 | Xylose import ATP-binding protein XylG | 2.38e-06 | NA | 5.64e-12 | NA |
7. B | Q1GBI9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.25e-34 | NA |
7. B | Q8RGC8 | Fe(3+) ions import ATP-binding protein FbpC | 6.51e-11 | NA | 1.52e-25 | NA |
7. B | Q87FK7 | Arabinose import ATP-binding protein AraG | 5.05e-06 | NA | 6.66e-12 | NA |
7. B | A1U0A9 | Macrolide export ATP-binding/permease protein MacB | 8.42e-09 | NA | 8.15e-12 | NA |
7. B | Q6VMN4 | Xylose import ATP-binding protein XylG | 1.80e-06 | NA | 9.97e-13 | NA |
7. B | A0KE53 | Xylose import ATP-binding protein XylG | 8.05e-06 | NA | 1.66e-10 | NA |
7. B | Q0BUR6 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.23e-13 | NA | 1.65e-21 | NA |
7. B | Q17320 | Protein white | 9.19e-07 | NA | 1.92e-07 | NA |
7. B | O31716 | Uncharacterized ABC transporter ATP-binding protein YkpA | 6.36e-06 | NA | 8.14e-05 | NA |
7. B | Q2A3Z2 | Methionine import ATP-binding protein MetN | 2.17e-13 | NA | 7.79e-25 | NA |
7. B | A1CFM0 | ABC transporter patM | 1.69e-03 | NA | 4.78e-08 | NA |
7. B | Q2G2A7 | Spermidine/putrescine import ATP-binding protein PotA | 3.94e-12 | NA | 4.16e-18 | NA |
7. B | Q93DA2 | Methionine import ATP-binding protein MetN | 2.31e-13 | NA | 1.81e-25 | NA |
7. B | Q9KSL1 | Vitamin B12 import ATP-binding protein BtuD | 7.55e-15 | NA | 9.25e-08 | NA |
7. B | Q57293 | Fe(3+) ions import ATP-binding protein FbpC | 6.11e-15 | NA | 4.47e-19 | NA |
7. B | Q28QL7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.93e-12 | NA | 4.72e-30 | NA |
7. B | Q63TX3 | Nod factor export ATP-binding protein I | 2.08e-10 | NA | 2.02e-19 | NA |
7. B | P36947 | Ribose import ATP-binding protein RbsA | 2.96e-06 | NA | 1.06e-15 | NA |
7. B | Q2FYQ8 | Nickel import system ATP-binding protein NikE | 2.22e-16 | NA | 5.13e-14 | NA |
7. B | Q98K15 | Ribose import ATP-binding protein RbsA 1 | 4.71e-06 | NA | 7.52e-10 | NA |
7. B | Q81C68 | Aliphatic sulfonates import ATP-binding protein SsuB | 1.82e-11 | NA | 1.39e-22 | NA |
7. B | Q9KUW5 | UvrABC system protein A | 4.32e-03 | NA | 0.023 | NA |
7. B | Q134N9 | Methionine import ATP-binding protein MetN | 4.41e-13 | NA | 1.86e-24 | NA |
7. B | Q9KAG5 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 2.32e-06 | NA | 4.23e-12 | NA |
7. B | Q6G2Z5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.80e-11 | NA | 1.26e-20 | NA |
7. B | Q8KF76 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | NA | 6.77e-16 | NA |
7. B | Q20ZP0 | Phosphonates import ATP-binding protein PhnC 1 | 1.44e-15 | NA | 7.05e-12 | NA |
7. B | Q66D71 | Molybdenum import ATP-binding protein ModC | 6.91e-12 | NA | 4.29e-19 | NA |
7. B | P47261 | Putative ABC transporter ATP-binding protein MG015 | 2.58e-11 | NA | 3.71e-11 | NA |
7. B | Q82CM5 | Ribose import ATP-binding protein RbsA 1 | 4.14e-05 | NA | 2.99e-14 | NA |
7. B | Q8FB02 | UvrABC system protein A | 1.50e-02 | NA | 0.038 | NA |
7. B | Q8P2K6 | Methionine import ATP-binding protein MetN | 3.42e-13 | NA | 5.96e-29 | NA |
7. B | Q54R52 | ABC transporter A family member 10 | 2.69e-06 | NA | 3.93e-15 | NA |
7. B | O34697 | Bacitracin export ATP-binding protein BceA | 5.77e-15 | NA | 2.83e-20 | NA |
7. B | A0ALT6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 5.51e-39 | NA |
7. B | Q5HG41 | Nickel import system ATP-binding protein NikE | 1.11e-16 | NA | 5.13e-14 | NA |
7. B | Q9X051 | Ribose import ATP-binding protein RbsA 2 | 3.70e-05 | NA | 5.59e-16 | NA |
7. B | P0CZ35 | Spermidine/putrescine import ATP-binding protein PotA | 2.56e-12 | NA | 4.40e-27 | NA |
7. B | Q99QV7 | Putative ABC transporter ATP-binding protein SAV2684 | 2.13e-07 | NA | 6.15e-27 | NA |
7. B | P63356 | Methionine import ATP-binding protein MetN | 4.90e-13 | NA | 2.43e-24 | NA |
7. B | Q6AJW3 | ATP-dependent lipid A-core flippase | 6.47e-12 | NA | 1.43e-21 | NA |
7. B | Q5YTW4 | Phosphonates import ATP-binding protein PhnC | 8.15e-13 | NA | 8.66e-15 | NA |
7. B | Q8CMU4 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 5.86e-11 | NA |
7. B | Q0TJM0 | Glutathione import ATP-binding protein GsiA | 5.59e-07 | NA | 2.45e-18 | NA |
7. B | Q97N51 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 5.26e-47 | NA |
7. B | Q720M2 | Putative ABC transporter ATP-binding protein LMOf2365_1216 | 0.00e+00 | NA | 7.06e-26 | NA |
7. B | P63368 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 6.93e-20 | NA |
7. B | P45052 | Oligopeptide transport ATP-binding protein OppD | 9.23e-12 | NA | 4.72e-17 | NA |
7. B | Q7VYN2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.34e-12 | NA | 1.87e-21 | NA |
7. B | Q8CPN0 | Spermidine/putrescine import ATP-binding protein PotA | 2.21e-12 | NA | 1.97e-17 | NA |
7. B | Q6LH11 | Ribose import ATP-binding protein RbsA | 5.94e-07 | NA | 3.48e-13 | NA |
7. B | P20162 | Lipopolysaccharide export system ATP-binding protein LptB (Fragment) | NA | NA | 5.35e-04 | NA |
7. B | Q8EB59 | Hemin import ATP-binding protein HmuV | 6.77e-15 | NA | 8.40e-15 | NA |
7. B | Q9LJX0 | ABC transporter B family member 19 | 1.43e-06 | NA | 2.46e-18 | NA |
7. B | Q6G1V5 | Macrolide export ATP-binding/permease protein MacB | 1.69e-09 | NA | 7.34e-19 | NA |
7. B | Q2PBM3 | Autoinducer 2 import ATP-binding protein LsrA | 7.83e-06 | NA | 9.05e-13 | NA |
7. B | O31339 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.88e-16 | NA | 1.33e-29 | NA |
7. B | A1B9Q7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.92e-12 | NA | 6.56e-25 | NA |
7. B | P36372 | Antigen peptide transporter 2 | 1.27e-08 | NA | 2.92e-18 | NA |
7. B | Q0I348 | Xylose import ATP-binding protein XylG | 4.34e-06 | NA | 2.90e-09 | NA |
7. B | Q0TJH0 | Macrolide export ATP-binding/permease protein MacB | 1.26e-07 | NA | 2.72e-16 | NA |
7. B | Q3A9G5 | Methionine import ATP-binding protein MetN | 1.01e-11 | NA | 1.07e-24 | NA |
7. B | P0AAG2 | Dipeptide transport ATP-binding protein DppD | 1.30e-11 | NA | 2.32e-14 | NA |
7. B | O31723 | Uncharacterized ABC transporter ATP-binding protein YlmA | 9.49e-14 | NA | 5.14e-09 | NA |
7. B | Q8T9W2 | ABC transporter B family member 5 | 2.72e-10 | NA | 6.58e-23 | NA |
7. B | O05732 | Probable iron chelatin transport ATP-binding protein HP_0888 | 2.44e-15 | NA | 0.011 | NA |
7. B | P42246 | Uncharacterized ABC transporter ATP-binding protein YcbN | 5.05e-13 | NA | 3.33e-14 | NA |
7. B | Q9XDA6 | Zinc uptake system ATP-binding protein ZurA | 4.78e-12 | NA | 2.70e-25 | NA |
7. B | Q1J255 | Hemin import ATP-binding protein HmuV | 3.74e-14 | NA | 5.87e-10 | NA |
7. B | Q6LPK2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.93e-16 | NA |
7. B | Q4QJQ0 | Molybdenum import ATP-binding protein ModC | 3.96e-12 | NA | 7.79e-20 | NA |
7. B | Q83KP2 | Arabinose import ATP-binding protein AraG | 3.52e-06 | NA | 1.78e-10 | NA |
7. B | Q0T5R2 | Spermidine/putrescine import ATP-binding protein PotA | 1.64e-11 | NA | 4.40e-23 | NA |
7. B | Q119J0 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 4.08e-17 | NA |
7. B | Q9ZUT0 | ABC transporter G family member 2 | 1.21e-05 | NA | 4.11e-06 | NA |
7. B | Q4L5B3 | Spermidine/putrescine import ATP-binding protein PotA | 3.47e-12 | NA | 9.67e-19 | NA |
7. B | Q1CFP9 | Molybdenum import ATP-binding protein ModC | 9.71e-12 | NA | 4.09e-19 | NA |
7. B | Q8ST66 | ABC transporter G family member 18 | 1.67e-03 | NA | 0.005 | NA |
7. B | Q9LZJ5 | ABC transporter C family member 14 | 2.05e-05 | NA | 2.41e-16 | NA |
7. B | Q38VW6 | Spermidine/putrescine import ATP-binding protein PotA | 1.43e-14 | NA | 3.83e-22 | NA |
7. B | Q2YL70 | Nickel import ATP-binding protein NikD | 6.11e-15 | NA | 2.82e-12 | NA |
7. B | Q8ELQ6 | Methionine import ATP-binding protein MetN 3 | 1.69e-14 | NA | 2.54e-29 | NA |
7. B | O89016 | Lysosomal cobalamin transporter ABCD4 | 8.89e-08 | NA | 3.19e-05 | NA |
7. B | Q05067 | Uncharacterized ABC transporter ATP-binding protein all4389 | 2.42e-10 | NA | 3.16e-11 | NA |
7. B | Q2A1U9 | ATP-dependent lipid A-core flippase | 2.10e-11 | NA | 3.79e-23 | NA |
7. B | P9WQJ6 | Mycobactin import ATP-binding/permease protein IrtB | 1.85e-09 | NA | 3.40e-17 | NA |
7. B | O83321 | Probable riboflavin import ATP-binding protein RfuB | 2.37e-04 | NA | 4.06e-04 | NA |
7. B | Q2K551 | Hemin import ATP-binding protein HmuV | 2.45e-14 | NA | 6.12e-11 | NA |
7. B | Q8K442 | ABC-type organic anion transporter ABCA8A | 1.23e-04 | NA | 3.72e-13 | NA |
7. B | Q1MHS1 | Ribose import ATP-binding protein RbsA 1 | 8.47e-06 | NA | 5.31e-09 | NA |
7. B | Q84EY8 | Hemin import ATP-binding protein HmuV | 6.66e-16 | NA | 9.48e-15 | NA |
7. B | P10091 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.08e-13 | NA | 2.57e-23 | NA |
7. B | Q8D653 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.44e-15 | NA | 4.66e-24 | NA |
7. B | Q8T6J5 | ABC transporter A family member 2 | 6.49e-04 | NA | 1.56e-10 | NA |
7. B | Q9C8H0 | ABC transporter C family member 12 | 3.51e-06 | NA | 6.57e-14 | NA |
7. B | Q9CL63 | Ribose import ATP-binding protein RbsA 2 | 1.27e-06 | NA | 2.19e-13 | NA |
7. B | O68877 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 3.56e-09 | NA |
7. B | Q9A1E3 | Methionine import ATP-binding protein MetN | 2.54e-13 | NA | 5.67e-29 | NA |
7. B | Q98K23 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.40e-11 | NA | 7.70e-21 | NA |
7. B | P0C0Z2 | UvrABC system protein A | 1.62e-02 | NA | 0.024 | NA |
7. B | Q8XDM1 | Xylose import ATP-binding protein XylG | 4.37e-06 | NA | 4.89e-12 | NA |
7. B | Q81A96 | Phosphonates import ATP-binding protein PhnC | 7.77e-16 | NA | 6.69e-10 | NA |
7. B | Q8ENB3 | Ribose import ATP-binding protein RbsA | 4.88e-06 | NA | 7.68e-13 | NA |
7. B | Q2YK62 | Putative peptide import ATP-binding protein BAB2_0818 | 2.67e-13 | NA | 2.50e-15 | NA |
7. B | Q81TH8 | Spermidine/putrescine import ATP-binding protein PotA | 1.14e-14 | NA | 8.47e-21 | NA |
7. B | Q8R420 | Phospholipid-transporting ATPase ABCA3 | 1.58e-04 | NA | 6.91e-18 | NA |
7. B | Q0TFU2 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.00e-06 | NA | 1.60e-13 | NA |
7. B | P0A2V6 | Oligopeptide transport ATP-binding protein OppF | 2.23e-13 | NA | 1.10e-18 | NA |
7. B | Q2SY12 | Methionine import ATP-binding protein MetN | 4.47e-14 | NA | 5.29e-26 | NA |
7. B | Q97KS6 | Spermidine/putrescine import ATP-binding protein PotA | 5.65e-12 | NA | 2.59e-19 | NA |
7. B | Q18H36 | Phosphonates import ATP-binding protein PhnC 2 | 4.77e-15 | NA | 1.20e-13 | NA |
7. B | Q9KFN9 | Phosphonates import ATP-binding protein PhnC 1 | 2.22e-16 | NA | 2.50e-14 | NA |
7. B | Q7YR37 | ATP-binding cassette sub-family F member 1 | 1.64e-05 | NA | 0.002 | NA |
7. B | Q94A18 | ABC transporter G family member 29 | 5.65e-04 | NA | 0.007 | NA |
7. B | Q8IZY2 | Phospholipid-transporting ATPase ABCA7 | 1.16e-03 | NA | 3.81e-14 | NA |
7. B | P08183 | ATP-dependent translocase ABCB1 | 6.54e-07 | NA | 2.44e-20 | NA |
7. B | P75176 | UvrABC system protein A | 1.15e-02 | NA | 1.70e-05 | NA |
7. B | Q2YUY7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 1.56e-09 | NA |
7. B | O34314 | Uncharacterized ABC transporter ATP-binding protein YtlC | 2.76e-10 | NA | 1.94e-19 | NA |
7. B | Q9P5N0 | Vacuolar heme ABC transmembrane exporter abc3 | 2.17e-06 | NA | 9.15e-20 | NA |
7. B | Q7A6M2 | Methionine import ATP-binding protein MetN 2 | 1.94e-13 | NA | 2.16e-26 | NA |
7. B | O34641 | ABC transporter ATP-binding protein YtrB | 2.96e-10 | NA | 1.53e-08 | NA |
7. B | F2PLH2 | ABC multidrug transporter MDR1 | 7.34e-03 | NA | 0.008 | NA |
7. B | Q8NE71 | ATP-binding cassette sub-family F member 1 | 2.47e-05 | NA | 0.003 | NA |
7. B | Q110U3 | Spermidine/putrescine import ATP-binding protein PotA | 8.88e-16 | NA | 4.10e-23 | NA |
7. B | Q84M24 | ABC transporter A family member 1 | 2.03e-04 | NA | 1.14e-15 | NA |
7. B | Q3JSI8 | Ribose import ATP-binding protein RbsA 1 | 2.63e-03 | NA | 9.58e-12 | NA |
7. B | Q891M1 | Ribose import ATP-binding protein RbsA | 1.48e-06 | NA | 1.69e-15 | NA |
7. B | P0CZ33 | Oligopeptide transport ATP-binding protein OppF | 2.42e-13 | NA | 1.10e-18 | NA |
7. B | Q1J983 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q832Y6 | Methionine import ATP-binding protein MetN 1 | 3.04e-14 | NA | 9.22e-26 | NA |
7. B | Q2QLA3 | Cystic fibrosis transmembrane conductance regulator | 8.51e-05 | NA | 3.32e-11 | NA |
7. B | Q9SZR9 | ABC transporter G family member 9 | 1.47e-07 | NA | 1.69e-05 | NA |
7. B | Q21BU8 | Methionine import ATP-binding protein MetN | 3.51e-13 | NA | 6.15e-25 | NA |
7. B | Q7CN92 | Spermidine/putrescine import ATP-binding protein PotA | 6.83e-12 | NA | 8.79e-27 | NA |
7. B | Q03AH0 | Spermidine/putrescine import ATP-binding protein PotA | 1.72e-14 | NA | 4.75e-29 | NA |
7. B | P39115 | Ribosome protection protein VmlR | 2.93e-07 | NA | 2.72e-07 | NA |
7. B | Q1BPL3 | Ribose import ATP-binding protein RbsA 2 | 3.71e-06 | NA | 3.56e-12 | NA |
7. B | Q04JW0 | Spermidine/putrescine import ATP-binding protein PotA | 3.35e-12 | NA | 1.13e-24 | NA |
7. B | A0K5N5 | Methionine import ATP-binding protein MetN 1 | 6.10e-14 | NA | 1.35e-25 | NA |
7. B | A2RI77 | Dipeptide transport ATP-binding protein DppD | 2.87e-11 | NA | 2.08e-17 | NA |
7. B | Q9G4F5 | Sulfate/thiosulfate import ATP-binding protein cysA | 1.46e-13 | NA | 1.94e-30 | NA |
7. B | Q5M397 | Spermidine/putrescine import ATP-binding protein PotA | 4.81e-12 | NA | 7.46e-24 | NA |
7. B | Q04EY4 | Energy-coupling factor transporter ATP-binding protein EcfA3 | 0.00e+00 | NA | 1.05e-43 | NA |
7. B | Q63E84 | Spermidine/putrescine import ATP-binding protein PotA | 6.33e-15 | NA | 3.78e-21 | NA |
7. B | Q54BT5 | ABC transporter A family member 3 | 1.05e-03 | NA | 7.97e-17 | NA |
7. B | Q9STT6 | ABC transporter A family member 6 | 3.04e-06 | NA | 9.01e-07 | NA |
7. B | Q3Z3V4 | Glutathione import ATP-binding protein GsiA | 2.86e-06 | NA | 1.16e-18 | NA |
7. B | Q8YCN8 | Nickel import ATP-binding protein NikD | 3.44e-15 | NA | 2.82e-12 | NA |
7. B | Q9CK97 | Methionine import ATP-binding protein MetN | 3.04e-13 | NA | 1.32e-25 | NA |
7. B | Q5HKQ8 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 5.86e-11 | NA |
7. B | Q67JX4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.90e-46 | NA |
7. B | Q6GAB5 | Spermidine/putrescine import ATP-binding protein PotA | 3.51e-12 | NA | 4.16e-18 | NA |
7. B | Q2KVS6 | Macrolide export ATP-binding/permease protein MacB | 2.48e-08 | NA | 5.27e-14 | NA |
7. B | Q4KG27 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.03e-13 | NA | 2.25e-08 | NA |
7. B | Q23868 | Serine protease/ABC transporter B family protein tagC | 8.36e-05 | NA | 2.04e-16 | NA |
7. B | Q5A762 | Multiple drug resistance-associated protein-like transporter 1 | 8.04e-06 | NA | 2.14e-16 | NA |
7. B | Q5LX21 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.47e-11 | NA | 1.16e-21 | NA |
7. B | Q83L12 | Autoinducer 2 import ATP-binding protein LsrA | 1.91e-06 | NA | 2.51e-14 | NA |
7. B | Q75EV6 | Elongation factor 3 | 1.44e-03 | NA | 0.007 | NA |
7. B | Q08972 | [NU+] prion formation protein 1 | 2.05e-03 | NA | 0.008 | NA |
7. B | Q8XZP8 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.91e-13 | NA | 1.40e-29 | NA |
7. B | Q48J74 | Xylose import ATP-binding protein XylG | 3.11e-06 | NA | 9.94e-09 | NA |
7. B | Q8NR12 | Ribose import ATP-binding protein RbsA | 1.12e-03 | NA | 1.05e-10 | NA |
7. B | Q0TAW0 | Ribose import ATP-binding protein RbsA | 3.80e-07 | NA | 9.57e-14 | NA |
7. B | P21449 | Multidrug resistance protein 2 | 7.84e-07 | NA | 1.27e-21 | NA |
7. B | Q4ZSS5 | Molybdenum import ATP-binding protein ModC | 3.61e-12 | NA | 2.89e-16 | NA |
7. B | Q09429 | ATP-binding cassette sub-family C member 8 | 4.42e-06 | NA | 1.36e-11 | NA |
7. B | Q55463 | Bicarbonate transport ATP-binding protein CmpD | 4.51e-10 | NA | 6.88e-26 | NA |
7. B | P9WQL3 | Molybdenum import ATP-binding protein ModC | 4.90e-10 | NA | 1.16e-20 | NA |
7. B | Q2RS21 | Nickel import ATP-binding protein NikD | 1.11e-16 | NA | 1.42e-08 | NA |
7. B | P43569 | CCR4-associated factor 16 | 1.30e-08 | NA | 3.27e-09 | NA |
7. B | Q9M0M2 | ABC transporter B family member 9 | 1.50e-06 | NA | 5.06e-20 | NA |
7. B | Q9A7X1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.79e-11 | NA | 8.53e-18 | NA |
7. B | A1TAI4 | Spermidine/putrescine import ATP-binding protein PotA | 1.86e-13 | NA | 1.92e-18 | NA |
7. B | O05519 | Putative ATP-binding protein YdiF | 3.75e-06 | NA | 6.05e-07 | NA |
7. B | P0A9X1 | Zinc import ATP-binding protein ZnuC | 1.29e-14 | NA | 4.30e-15 | NA |
7. B | Q21TR5 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 3.55e-06 | NA | 5.70e-12 | NA |
7. B | Q8T674 | ABC transporter G family member 20 | 4.90e-07 | NA | 2.42e-13 | NA |
7. B | Q8NWT5 | Nickel import system ATP-binding protein NikD | 4.48e-11 | NA | 4.50e-08 | NA |
7. B | Q9STT7 | ABC transporter A family member 5 | 3.21e-06 | NA | 4.50e-09 | NA |
7. B | P0A2V5 | Oligopeptide transport ATP-binding protein OppF | 1.33e-13 | NA | 5.19e-17 | NA |
7. B | Q57QC8 | Spermidine/putrescine import ATP-binding protein PotA | 1.16e-11 | NA | 1.09e-23 | NA |
7. B | Q2K3Y7 | Arabinose import ATP-binding protein AraG | 3.83e-06 | NA | 1.75e-11 | NA |
7. B | P63396 | Uncharacterized ABC transporter ATP-binding protein Mb1312c | 5.73e-07 | NA | 3.95e-18 | NA |
7. B | P77622 | Probable D,D-dipeptide transport ATP-binding protein DdpF | 1.15e-11 | NA | 6.84e-19 | NA |
7. B | Q1BRZ8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.10e-11 | NA | 9.47e-22 | NA |
7. B | Q8G5P8 | Methionine import ATP-binding protein MetN | 7.44e-15 | NA | 7.89e-26 | NA |
7. B | Q59056 | Uncharacterized ABC transporter ATP-binding protein MJ1662 | 1.70e-05 | NA | 3.83e-12 | NA |
7. B | Q0C1N8 | Macrolide export ATP-binding/permease protein MacB | 9.82e-09 | NA | 3.32e-15 | NA |
7. B | Q2G1L8 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 2.06e-09 | NA |
7. B | Q1CDR0 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.29e-10 | NA | 2.76e-18 | NA |
7. B | P13568 | Multidrug resistance protein | 1.33e-05 | NA | 1.46e-14 | NA |
7. B | P57445 | ATP-binding protein Uup | 1.77e-05 | NA | 4.53e-08 | NA |
7. B | Q9GTN7 | Serine protease/ABC transporter B family protein tagA | 4.10e-05 | NA | 1.69e-16 | NA |
7. B | P41234 | ATP-binding cassette sub-family A member 2 | 8.32e-03 | NA | 4.33e-17 | NA |
7. B | Q2NSG3 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.30e-14 | NA | 0.006 | NA |
7. B | Q6HLQ9 | Spermidine/putrescine import ATP-binding protein PotA | 6.11e-15 | NA | 3.89e-21 | NA |
7. B | Q9KL34 | Hemin import ATP-binding protein HmuV | 0.00e+00 | NA | 5.39e-15 | NA |
7. B | Q2YXZ0 | Nickel import system ATP-binding protein NikE | 1.11e-16 | NA | 3.89e-13 | NA |
7. B | Q7GB25 | ABC transporter C family member 5 | 7.46e-06 | NA | 9.65e-16 | NA |
7. B | Q2FVF0 | Metal-staphylopine import system ATP-binding protein CntD | 1.27e-12 | NA | 6.36e-16 | NA |
7. B | P0CE68 | ABC transporter NFT1 | 2.64e-05 | NA | 3.37e-08 | NA |
7. B | P75551 | Oligopeptide transport ATP-binding protein OppF | 7.85e-04 | NA | 2.39e-07 | NA |
7. B | Q8X5Q4 | Ribose import ATP-binding protein RbsA 2 | 1.43e-06 | NA | 9.33e-11 | NA |
7. B | Q8CG09 | Multidrug resistance-associated protein 1 | 2.50e-06 | NA | 2.38e-13 | NA |
7. B | O88563 | ATP-binding cassette sub-family C member 3 | 2.63e-06 | NA | 1.05e-15 | NA |
7. B | Q0SSJ0 | Ribose import ATP-binding protein RbsA | 2.01e-06 | NA | 1.46e-19 | NA |
7. B | Q04G50 | Spermidine/putrescine import ATP-binding protein PotA | 3.89e-12 | NA | 2.52e-23 | NA |
7. B | Q4ZSF3 | Xylose import ATP-binding protein XylG | 3.49e-06 | NA | 5.30e-09 | NA |
7. B | Q32EY4 | Spermidine/putrescine import ATP-binding protein PotA | 1.79e-11 | NA | 4.00e-24 | NA |
7. B | Q1LQF6 | Methionine import ATP-binding protein MetN | 5.23e-14 | NA | 5.13e-25 | NA |
7. B | P26361 | Cystic fibrosis transmembrane conductance regulator | 7.83e-05 | NA | 6.14e-11 | NA |
7. B | Q1CAK4 | Methionine import ATP-binding protein MetN 1 | 2.26e-13 | NA | 1.70e-27 | NA |
7. B | Q3Z2Z3 | Spermidine/putrescine import ATP-binding protein PotA | 1.48e-11 | NA | 3.26e-24 | NA |
7. B | A0KMJ3 | Macrolide export ATP-binding/permease protein MacB 2 | 1.56e-08 | NA | 1.08e-12 | NA |
7. B | O70014 | Hemin import ATP-binding protein HmuV | 2.44e-15 | NA | 3.63e-18 | NA |
7. B | Q6G098 | Hemin import ATP-binding protein HmuV | 2.96e-14 | NA | 1.00e-05 | NA |
7. B | P29018 | ATP-binding/permease protein CydD | 1.02e-08 | NA | 1.77e-11 | NA |
7. B | Q9TKX3 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.44e-16 | NA | 5.07e-29 | NA |
7. B | Q1JBJ5 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.74e-21 | NA |
7. B | Q9RZU5 | Hemin import ATP-binding protein HmuV | 3.18e-14 | NA | 6.49e-11 | NA |
7. B | Q8EUR3 | Spermidine/putrescine import ATP-binding protein PotA | 3.57e-05 | NA | 3.31e-13 | NA |
7. B | P33527 | Multidrug resistance-associated protein 1 | 2.36e-06 | NA | 9.94e-14 | NA |
7. B | Q88RA1 | Taurine import ATP-binding protein TauB | 6.47e-12 | NA | 1.56e-18 | NA |
7. B | Q8WWZ7 | Cholesterol transporter ABCA5 | 1.32e-04 | NA | 4.71e-15 | NA |
7. B | Q13LD8 | Methionine import ATP-binding protein MetN 2 | 6.64e-13 | NA | 7.79e-24 | NA |
7. B | Q21UI2 | Molybdenum import ATP-binding protein ModC | 1.63e-11 | NA | 1.01e-15 | NA |
7. B | Q1RE44 | Macrolide export ATP-binding/permease protein MacB | 1.23e-07 | NA | 2.84e-16 | NA |
7. B | Q3KJS6 | Methionine import ATP-binding protein MetN 2 | 4.00e-15 | NA | 7.74e-22 | NA |
7. B | Q8T673 | ABC transporter G family member 21 | 6.41e-04 | NA | 0.041 | NA |
7. B | P47433 | Putative ABC transporter ATP-binding protein MG187 | 5.20e-05 | NA | 9.98e-11 | NA |
7. B | Q5PFQ7 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 1.43e-14 | NA | 6.37e-22 | NA |
7. B | O34992 | Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA | 1.33e-14 | NA | 1.46e-22 | NA |
7. B | Q2YKR8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.37e-12 | NA | 1.99e-29 | NA |
7. B | Q57538 | Probable ABC transporter ATP-binding/permease protein HI_0664 | 1.09e-10 | NA | 5.39e-13 | NA |
7. B | P55570 | Uncharacterized ABC transporter ATP-binding protein y4mK | 7.50e-08 | NA | 0.010 | NA |
7. B | Q5T3U5 | ATP-binding cassette sub-family C member 10 | 6.97e-06 | NA | 5.17e-19 | NA |
7. B | Q8EPK1 | Methionine import ATP-binding protein MetN 1 | 4.15e-13 | NA | 1.72e-24 | NA |
7. B | Q8D928 | Vitamin B12 import ATP-binding protein BtuD | 3.09e-13 | NA | 2.20e-06 | NA |
7. B | Q9ZCM8 | Putative export ATP-binding/permease protein RP696 | 6.33e-11 | NA | 4.93e-20 | NA |
7. B | Q8F6Z1 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.22e-15 | NA | 2.99e-29 | NA |
7. B | Q2FKB7 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 2.06e-09 | NA |
7. B | Q8YDN0 | Xylose import ATP-binding protein XylG | 8.66e-06 | NA | 3.26e-09 | NA |
7. B | Q8EUL1 | UvrABC system protein A | 1.20e-02 | NA | 0.006 | NA |
7. B | Q3KKA1 | Zinc import ATP-binding protein ZnuC | 6.55e-15 | NA | 7.95e-16 | NA |
7. B | Q3ATR5 | Macrolide export ATP-binding/permease protein MacB | 9.89e-08 | NA | 1.43e-15 | NA |
7. B | A3CRB9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.39e-72 | NA |
7. B | Q043Y8 | Methionine import ATP-binding protein MetN | 1.35e-14 | NA | 1.83e-30 | NA |
7. B | Q8D3V0 | Maltose/maltodextrin import ATP-binding protein MalK | 3.14e-11 | NA | 1.36e-25 | NA |
7. B | O57896 | Molybdate/tungstate import ATP-binding protein WtpC | 2.22e-13 | NA | 2.50e-23 | NA |
7. B | Q9SYI2 | ABC transporter B family member 3 | 8.78e-07 | NA | 1.07e-20 | NA |
7. B | Q46Y69 | Methionine import ATP-binding protein MetN | 3.76e-14 | NA | 1.25e-24 | NA |
7. B | Q7NIW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.95e-12 | NA | 1.99e-24 | NA |
7. B | Q8ZJ07 | UvrABC system protein A | 7.08e-03 | NA | 0.036 | NA |
7. B | Q0WML0 | ABC transporter B family member 27 | 1.30e-10 | NA | 2.32e-16 | NA |
7. B | Q48QM2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 2.06e-66 | NA |
7. B | Q9LSJ8 | ABC transporter B family member 16 | 3.39e-06 | NA | 4.24e-22 | NA |
7. B | Q8XZQ4 | Aliphatic sulfonates import ATP-binding protein SsuB | 2.44e-09 | NA | 3.25e-13 | NA |
7. B | Q2YJJ8 | Putative peptide import ATP-binding protein BAB2_1053 | 3.41e-14 | NA | 7.37e-22 | NA |
7. B | Q08234 | Uncharacterized ABC transporter ATP-binding protein/permease YOL075C | 9.11e-04 | NA | 2.61e-05 | NA |
7. B | P10640 | ATP-binding protein BexA | 1.35e-11 | NA | 6.54e-08 | NA |
7. B | E9PX95 | ATP-binding cassette sub-family A member 17 | 1.19e-03 | NA | 2.34e-18 | NA |
7. B | Q1JLH7 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.74e-21 | NA |
7. B | P10090 | Protein white | 6.48e-06 | NA | 1.81e-07 | NA |
7. B | P0A9U5 | Probable ATP-binding protein YbiT | 1.15e-07 | NA | 9.94e-06 | NA |
7. B | Q1RK71 | UvrABC system protein A | 5.04e-03 | NA | 0.013 | NA |
7. B | Q03195 | Translation initiation factor RLI1 | 3.84e-04 | NA | 3.82e-09 | NA |
7. B | P55453 | Uncharacterized ABC transporter ATP-binding protein y4fO | 3.86e-11 | NA | 2.04e-22 | NA |
7. B | O35600 | Retinal-specific phospholipid-transporting ATPase ABCA4 | 2.56e-03 | NA | 4.11e-17 | NA |
7. B | Q8T664 | ABC transporter H family member 2 | 2.37e-12 | NA | 1.37e-20 | NA |
7. B | Q471U2 | Taurine import ATP-binding protein TauB | 3.82e-13 | NA | 3.05e-21 | NA |
7. B | Q87UH7 | Taurine import ATP-binding protein TauB | 4.69e-13 | NA | 3.96e-19 | NA |
7. B | Q5LT05 | Spermidine/putrescine import ATP-binding protein PotA | 9.21e-15 | NA | 2.29e-17 | NA |
7. B | Q14JW6 | ATP-dependent lipid A-core flippase | 3.89e-11 | NA | 1.12e-23 | NA |
7. B | P34713 | Multidrug resistance protein pgp-3 | 1.40e-06 | NA | 1.21e-22 | NA |
7. B | Q8YH20 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.29e-11 | NA | 4.19e-19 | NA |
7. B | Q87J32 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 2.82e-14 | NA |
7. B | Q81VQ1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.17e-39 | NA |
7. B | Q7NWX3 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 9.22e-11 | NA | 1.40e-27 | NA |
7. B | Q8ZLF4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.95e-11 | NA | 3.16e-21 | NA |
7. B | P43245 | ATP-dependent translocase ABCB1 | 1.90e-06 | NA | 3.31e-21 | NA |
7. B | Q48TP4 | Spermidine/putrescine import ATP-binding protein PotA | 2.66e-12 | NA | 4.40e-27 | NA |
7. B | Q9FHF1 | ABC transporter B family member 7 | 6.38e-07 | NA | 2.06e-21 | NA |
7. B | P9WQJ1 | Uncharacterized ABC transporter ATP-binding protein Rv1273c | 2.18e-10 | NA | 1.73e-15 | NA |
7. B | Q3YVK8 | Ribose import ATP-binding protein RbsA | 4.14e-07 | NA | 6.54e-13 | NA |
7. B | A8A066 | Autoinducer 2 import ATP-binding protein LsrA | 1.20e-06 | NA | 1.57e-14 | NA |
7. B | Q8Z1U0 | Maltose/maltodextrin import ATP-binding protein MalK | 1.24e-14 | NA | 4.95e-25 | NA |
7. B | Q39KB9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.49e-11 | NA | 1.96e-21 | NA |
7. B | Q9PDN2 | Sulfate/thiosulfate import ATP-binding protein CysA | 7.89e-12 | NA | 1.36e-26 | NA |
7. B | Q11ID5 | Hemin import ATP-binding protein HmuV | 2.40e-14 | NA | 2.16e-06 | NA |
7. B | Q9ZUT8 | ABC transporter G family member 33 | 2.92e-04 | NA | 0.004 | NA |
7. B | Q88DY1 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 7.19e-14 | NA |
7. B | O68106 | Cobalt import ATP-binding protein CbiO | 0.00e+00 | NA | 5.17e-28 | NA |
7. B | Q1RE96 | Glutathione import ATP-binding protein GsiA | 7.01e-07 | NA | 2.45e-18 | NA |
7. B | P0A9U3 | Probable ATP-binding protein YbiT | 1.35e-07 | NA | 9.94e-06 | NA |
7. B | Q9SYI3 | ABC transporter B family member 5 | 9.92e-07 | NA | 1.95e-22 | NA |
7. B | O35379 | Multidrug resistance-associated protein 1 | 2.22e-06 | NA | 2.18e-13 | NA |
7. B | Q47538 | Taurine import ATP-binding protein TauB | 2.12e-13 | NA | 1.93e-31 | NA |
7. B | O59672 | Uncharacterized ABC transporter ATP-binding protein C29A3.09c | 8.20e-07 | NA | 1.35e-05 | NA |
7. B | Q98QH4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.45e-37 | NA |
7. B | P24137 | Oligopeptide transport ATP-binding protein OppF | 1.11e-11 | NA | 2.83e-21 | NA |
7. B | P0AAF5 | Arabinose import ATP-binding protein AraG | 1.77e-06 | NA | 1.32e-10 | NA |
7. B | P33951 | ATP-binding protein SyrD | 5.65e-10 | NA | 5.22e-16 | NA |
7. B | Q5F6V6 | Macrolide export ATP-binding/permease protein MacB | 1.02e-08 | NA | 3.34e-15 | NA |
7. B | Q8YDH0 | Putative peptide import ATP-binding protein BMEII0206 | 8.48e-11 | NA | 4.70e-17 | NA |
7. B | Q5WJP0 | Methionine import ATP-binding protein MetN 2 | 4.98e-13 | NA | 1.88e-23 | NA |
7. B | Q889G0 | Phosphonates import ATP-binding protein PhnC 1 | 2.55e-15 | NA | 1.04e-09 | NA |
7. B | Q4UVG2 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.65e-13 | NA | 4.40e-09 | NA |
7. B | Q51719 | Putative ABC transporter ATP-binding protein in cobA 5'region | 0.00e+00 | NA | 2.69e-28 | NA |
7. B | Q2KJA2 | ATP-binding cassette sub-family F member 2 | 5.68e-07 | NA | 0.001 | NA |
7. B | Q1J6Q6 | Spermidine/putrescine import ATP-binding protein PotA | 4.96e-12 | NA | 7.14e-27 | NA |
7. B | F2Q5G0 | ABC multidrug transporter MDR2 | 1.77e-06 | NA | 2.63e-19 | NA |
7. B | Q92EZ6 | Methionine import ATP-binding protein MetN 1 | 3.01e-14 | NA | 6.47e-24 | NA |
7. B | Q7CG00 | Ribose import ATP-binding protein RbsA | 1.04e-06 | NA | 1.45e-13 | NA |
7. B | Q8DRF9 | Methionine import ATP-binding protein MetN | 1.91e-13 | NA | 4.61e-24 | NA |
7. B | Q4KES7 | Macrolide export ATP-binding/permease protein MacB 1 | 1.20e-09 | NA | 1.76e-13 | NA |
7. B | Q6D201 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.69e-13 | NA | 1.33e-28 | NA |
7. B | Q44848 | Uncharacterized ABC transporter ATP-binding protein BB_0318 | 1.21e-05 | NA | 5.00e-08 | NA |
7. B | Q48NM1 | Phosphonates import ATP-binding protein PhnC 1 | 0.00e+00 | NA | 5.71e-08 | NA |
7. B | Q5X9B6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q8HXQ5 | Multidrug resistance-associated protein 1 | 2.30e-06 | NA | 1.85e-11 | NA |
7. B | Q2J3T0 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 1.59e-10 | NA |
7. B | Q00748 | Multidrug resistance protein homolog 65 | 6.40e-06 | NA | 1.98e-18 | NA |
7. B | Q81XB3 | Petrobactin import ATP-binding protein FatE | 2.22e-16 | NA | 2.35e-06 | NA |
7. B | Q58429 | Uncharacterized ABC transporter ATP-binding protein MJ1023 | 1.25e-14 | NA | 4.19e-15 | NA |
7. B | P37624 | Ribosome-associated ATPase | 3.06e-06 | NA | 6.68e-21 | NA |
7. B | Q30V33 | Spermidine/putrescine import ATP-binding protein PotA | 1.23e-11 | NA | 1.82e-25 | NA |
7. B | Q8ZR89 | Methionine import ATP-binding protein MetN 2 | 4.56e-13 | NA | 1.02e-25 | NA |
7. B | Q2FJI0 | Methionine import ATP-binding protein MetN 1 | 3.80e-14 | NA | 3.05e-24 | NA |
7. B | Q146E7 | Taurine import ATP-binding protein TauB 1 | 4.50e-13 | NA | 7.14e-22 | NA |
7. B | Q82TL6 | Spermidine/putrescine import ATP-binding protein PotA | 4.47e-14 | NA | 3.78e-17 | NA |
7. B | P63367 | Phosphate import ATP-binding protein PstB 1 | 6.22e-15 | NA | 6.93e-20 | NA |
7. B | Q6LHL2 | Molybdenum import ATP-binding protein ModC | 1.39e-11 | NA | 9.64e-21 | NA |
7. B | Q2W4W1 | Zinc import ATP-binding protein ZnuC | 6.15e-14 | NA | 1.12e-14 | NA |
7. B | Q9WXX0 | Ribose import ATP-binding protein RbsA 1 | 5.62e-06 | NA | 1.39e-16 | NA |
7. B | Q66CQ3 | Methionine import ATP-binding protein MetN 1 | 6.11e-13 | NA | 5.57e-19 | NA |
7. B | A1JIE0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.07e-11 | NA | 1.13e-20 | NA |
7. B | Q323W5 | Glutathione import ATP-binding protein GsiA | 8.28e-07 | NA | 6.26e-19 | NA |
7. B | P54933 | ATP-binding transport protein SmoK | 3.42e-12 | NA | 1.75e-24 | NA |
7. B | Q9P7V2 | ATP-binding cassette transporter abc4 | 6.40e-06 | NA | 2.40e-19 | NA |
7. B | Q6LK87 | Maltose/maltodextrin import ATP-binding protein MalK | 1.62e-11 | NA | 2.58e-21 | NA |
7. B | P96063 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 2.65e-14 | NA | 6.82e-22 | NA |
7. B | Q1C7J0 | Arabinose import ATP-binding protein AraG | 1.70e-05 | NA | 6.74e-17 | NA |
7. B | Q87BH8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.60e-12 | NA | 1.45e-07 | NA |
7. B | F2SHL1 | ABC multidrug transporter MDR1 | 7.43e-03 | NA | 0.008 | NA |
7. B | Q7A169 | Spermidine/putrescine import ATP-binding protein PotA | 3.78e-12 | NA | 4.16e-18 | NA |
7. B | Q31YV7 | Galactose/methyl galactoside import ATP-binding protein MglA | 3.53e-06 | NA | 1.93e-13 | NA |
7. B | A1SWH9 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 6.87e-12 | NA | 3.85e-29 | NA |
7. B | Q7MFA1 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 2.00e-09 | NA |
7. B | Q3KDW2 | Xylose import ATP-binding protein XylG | 3.08e-06 | NA | 7.35e-10 | NA |
7. B | Q4A8A1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.14e-35 | NA |
7. B | Q9JJ59 | ABC-type oligopeptide transporter ABCB9 | 4.00e-09 | NA | 5.18e-16 | NA |
7. B | Q926D8 | Zinc uptake system ATP-binding protein ZurA | 7.84e-12 | NA | 5.25e-25 | NA |
7. B | A9YWR6 | ABC transporter G family member STR2 | 6.35e-07 | NA | 2.05e-04 | NA |
7. B | Q85A69 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.50e-13 | NA | 2.99e-19 | NA |
7. B | Q1R5H8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.64e-11 | NA | 5.59e-22 | NA |
7. B | S0ELQ3 | ABC transporter GPY2 | 5.05e-06 | NA | 2.72e-09 | NA |
7. B | Q28P50 | Ribose import ATP-binding protein RbsA | 1.97e-06 | NA | 6.22e-13 | NA |
7. B | Q9JZW0 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.01e-13 | NA | 2.42e-21 | NA |
7. B | Q6LUY1 | Xylose import ATP-binding protein XylG | 3.52e-06 | NA | 3.37e-10 | NA |
7. B | Q74LQ3 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 5.05e-13 | NA |
7. B | P94440 | Linearmycin resistance ATP-binding protein LnrL | 3.77e-14 | NA | 6.98e-15 | NA |
7. B | Q6D3A9 | Glutathione import ATP-binding protein GsiA | 8.40e-07 | NA | 6.80e-19 | NA |
7. B | Q9H222 | ATP-binding cassette sub-family G member 5 | 2.65e-07 | NA | 1.06e-11 | NA |
7. B | P61221 | ATP-binding cassette sub-family E member 1 | 4.98e-04 | NA | 1.14e-07 | NA |
7. B | Q13ER6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.68e-12 | NA | 2.81e-24 | NA |
7. B | Q8RDH4 | Dipeptide transport ATP-binding protein DppD | 5.68e-10 | NA | 7.41e-10 | NA |
7. B | P06795 | ATP-dependent translocase ABCB1 | 1.89e-06 | NA | 3.78e-22 | NA |
7. B | Q62GY9 | Arabinose import ATP-binding protein AraG | 5.08e-06 | NA | 1.40e-06 | NA |
7. B | P0C560 | Phosphate import ATP-binding protein PstB | 2.22e-15 | NA | 4.56e-11 | NA |
7. B | Q82B58 | Putative ABC transporter ATP-binding protein SAV_5847 | 2.84e-04 | NA | 1.60e-23 | NA |
7. B | Q5PGK9 | Macrolide export ATP-binding/permease protein MacB | 2.71e-08 | NA | 4.88e-16 | NA |
7. B | Q6YUU5 | Putative multidrug resistance protein | 1.17e-06 | NA | 2.12e-21 | NA |
7. B | O69063 | Hypophosphite import ATP-binding protein HtxD | 0.00e+00 | NA | 1.89e-12 | NA |
7. B | Q1GBJ0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.37e-71 | NA |
7. B | Q0TJT5 | Molybdenum import ATP-binding protein ModC | 5.08e-12 | NA | 6.62e-12 | NA |
7. B | Q7N2D9 | Autoinducer 2 import ATP-binding protein LsrA | 7.55e-07 | NA | 3.66e-13 | NA |
7. B | Q8FFU7 | Galactose/methyl galactoside import ATP-binding protein MglA | 3.91e-06 | NA | 1.60e-13 | NA |
7. B | Q39B28 | Hemin import ATP-binding protein HmuV | 1.92e-14 | NA | 3.40e-04 | NA |
7. B | Q1WVG9 | Methionine import ATP-binding protein MetN | 1.04e-11 | NA | 7.02e-32 | NA |
7. B | Q2FH58 | Nickel import system ATP-binding protein NikE | 1.11e-16 | NA | 5.13e-14 | NA |
7. B | Q7PC88 | ABC transporter G family member 31 | 5.70e-04 | NA | 1.47e-04 | NA |
7. B | P42423 | ABC transporter ATP-binding protein YxdL | 6.55e-15 | NA | 1.30e-21 | NA |
7. B | Q9LK64 | ABC transporter C family member 3 | 7.10e-06 | NA | 3.77e-15 | NA |
7. B | P45082 | ATP-binding/permease protein CydD | 4.92e-09 | NA | 2.38e-12 | NA |
7. B | Q28433 | Antigen peptide transporter 1 | 1.18e-08 | NA | 4.99e-19 | NA |
7. B | Q81XL3 | Methionine import ATP-binding protein MetN 3 | 1.44e-15 | NA | 4.34e-26 | NA |
7. B | Q9Z8Q8 | Methionine import ATP-binding protein MetN | 1.64e-12 | NA | 9.12e-19 | NA |
7. B | P70970 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 5.10e-38 | NA |
7. B | A0A1V1GB10 | ABC-type transporter oblD | 4.61e-03 | NA | 0.008 | NA |
7. B | Q3JSQ0 | Nod factor export ATP-binding protein I | 2.11e-10 | NA | 1.91e-19 | NA |
7. B | Q6G5Z1 | Putative ABC transporter ATP-binding protein SAS2569 | 1.39e-07 | NA | 9.16e-27 | NA |
7. B | Q9Z3R9 | Alpha-glucoside transport ATP-binding protein AglK | 8.88e-16 | NA | 8.54e-22 | NA |
7. B | Q7VM95 | Methionine import ATP-binding protein MetN | 6.77e-13 | NA | 5.09e-23 | NA |
7. B | Q09428 | ATP-binding cassette sub-family C member 8 | 4.43e-06 | NA | 1.22e-11 | NA |
7. B | Q3Z445 | Molybdenum import ATP-binding protein ModC | 5.06e-12 | NA | 1.68e-12 | NA |
7. B | P63351 | Vitamin B12 import ATP-binding protein BtuD | 6.33e-14 | NA | 2.78e-06 | NA |
7. B | Q00555 | Cystic fibrosis transmembrane conductance regulator | 1.02e-04 | NA | 6.91e-10 | NA |
7. B | Q9C6W5 | ABC transporter G family member 14 | 7.57e-07 | NA | 2.21e-04 | NA |
7. B | Q5PH81 | Vitamin B12 import ATP-binding protein BtuD | 5.62e-14 | NA | 4.77e-06 | NA |
7. B | Q8T6H3 | ABC transporter C family member 6 | 1.96e-06 | NA | 6.10e-17 | NA |
7. B | Q8K440 | ABC-type organic anion transporter ABCA8B | 7.16e-05 | NA | 1.53e-13 | NA |
7. B | P9WQJ5 | Uncharacterized ABC transporter ATP-binding protein Rv1281c | 4.73e-07 | NA | 3.95e-18 | NA |
7. B | Q9R1S7 | ATP-binding cassette sub-family C member 6 | 2.45e-06 | NA | 2.11e-13 | NA |
7. B | Q92G31 | UvrABC system protein A | 1.64e-02 | NA | 0.006 | NA |
7. B | A5VU87 | Putative peptide import ATP-binding protein BOV_A0348 | 6.15e-11 | NA | 1.40e-12 | NA |
7. B | Q87JM4 | Macrolide export ATP-binding/permease protein MacB | 1.39e-09 | NA | 3.02e-16 | NA |
7. B | B2GUP8 | Mitochondrial potassium channel ATP-binding subunit | 4.72e-09 | NA | 1.88e-17 | NA |
7. B | Q6MU19 | Spermidine/putrescine import ATP-binding protein PotA | 9.68e-12 | NA | 1.07e-22 | NA |
7. B | Q6AAX3 | Phosphate import ATP-binding protein PstB | 2.55e-15 | NA | 2.10e-14 | NA |
7. B | Q6FZX3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.31e-07 | NA |
7. B | F2RPA4 | ABC multidrug transporter MDR2 | 1.57e-06 | NA | 1.71e-19 | NA |
7. B | Q9LK50 | ABC transporter G family member 26 | 1.41e-06 | NA | 2.83e-05 | NA |
7. B | Q7VKP7 | Molybdenum import ATP-binding protein ModC | 3.14e-12 | NA | 2.11e-23 | NA |
7. B | Q1CBH2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.42e-10 | NA | 1.51e-19 | NA |
7. B | Q1J3P2 | Ribose import ATP-binding protein RbsA | 2.44e-05 | NA | 1.14e-15 | NA |
7. B | P9WQI3 | Trehalose import ATP-binding protein SugC | 5.56e-12 | NA | 2.09e-21 | NA |
7. B | Q8EBC3 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 9.99e-13 | NA | 1.03e-26 | NA |
7. B | Q9LVM1 | ABC transporter B family member 25, mitochondrial | 1.84e-09 | NA | 8.57e-23 | NA |
7. B | Q8RD43 | Ribose import ATP-binding protein RbsA | 3.05e-06 | NA | 1.80e-20 | NA |
7. B | A1VZQ5 | Probable ABC transporter ATP-binding protein PEB1C | 0.00e+00 | NA | 5.76e-24 | NA |
7. B | Q55DA7 | ABC transporter B family member 7 | 2.10e-07 | NA | 0.003 | NA |
7. B | P48255 | Probable ATP-dependent transporter ycf16 | 1.24e-13 | NA | 4.38e-12 | NA |
7. B | Q58206 | Uncharacterized ABC transporter ATP-binding protein MJ0796 | 0.00e+00 | NA | 1.58e-19 | NA |
7. B | Q664G2 | Ribose import ATP-binding protein RbsA | 5.52e-07 | NA | 4.01e-13 | NA |
7. B | A1A967 | Glutathione import ATP-binding protein GsiA | 6.40e-07 | NA | 2.60e-17 | NA |
7. B | Q3B2U2 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 0.00e+00 | NA | 1.92e-14 | NA |
7. B | P74981 | Hemin import ATP-binding protein HmuV | 0.00e+00 | NA | 9.59e-17 | NA |
7. B | Q2QLC5 | Cystic fibrosis transmembrane conductance regulator | 7.78e-05 | NA | 6.27e-10 | NA |
7. B | Q10RX7 | ABC transporter C family member 13 | 6.90e-06 | NA | 8.15e-13 | NA |
7. B | Q98L75 | Hemin import ATP-binding protein HmuV | 1.24e-14 | NA | 1.38e-09 | NA |
7. B | Q2YK63 | Putative peptide import ATP-binding protein BAB2_0817 | 8.00e-11 | NA | 3.09e-12 | NA |
7. B | Q7N6R3 | Molybdenum import ATP-binding protein ModC | 6.58e-12 | NA | 8.63e-20 | NA |
7. B | Q1CJW8 | Macrolide export ATP-binding/permease protein MacB 1 | 2.86e-08 | NA | 3.72e-15 | NA |
7. B | Q0TLD2 | Methionine import ATP-binding protein MetN | 4.07e-13 | NA | 2.38e-24 | NA |
7. B | Q70YG7 | Hemin import ATP-binding protein HmuV | 9.99e-16 | NA | 4.55e-10 | NA |
7. B | Q99UA3 | Nickel import system ATP-binding protein NikE | 1.11e-16 | NA | 3.50e-14 | NA |
7. B | Q88EX5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.28e-13 | NA | 8.82e-07 | NA |
7. B | A1BCE9 | Macrolide export ATP-binding/permease protein MacB 3 | 5.99e-08 | NA | 8.42e-14 | NA |
7. B | Q8ENU2 | Methionine import ATP-binding protein MetN 2 | 3.11e-13 | NA | 7.72e-27 | NA |
7. B | Q0ST95 | Galactose/methyl galactoside import ATP-binding protein MglA | 6.84e-06 | NA | 7.66e-14 | NA |
7. B | A0K3S5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.96e-11 | NA | 9.47e-22 | NA |
7. B | Q02785 | ATP-dependent permease PDR12 | 5.33e-03 | NA | 5.23e-04 | NA |
7. B | O70595 | ATP-binding cassette sub-family B member 6 | 8.98e-09 | NA | 3.53e-21 | NA |
7. B | P57551 | Multidrug resistance-like ATP-binding protein MdlA | 8.43e-10 | NA | 2.82e-14 | NA |
7. B | Q6D5H7 | Methionine import ATP-binding protein MetN 1 | 4.01e-13 | NA | 8.53e-17 | NA |
7. B | B4TGI0 | Vitamin B12 import ATP-binding protein BtuD | 6.29e-14 | NA | 2.78e-06 | NA |
7. B | P0A193 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 0.00e+00 | NA | 1.82e-15 | NA |
7. B | Q65WJ1 | Arabinose import ATP-binding protein AraG | 1.47e-06 | NA | 7.35e-11 | NA |
7. B | Q39GT7 | Nod factor export ATP-binding protein I | 5.30e-14 | NA | 6.52e-21 | NA |
7. B | F2T1C4 | ABC multidrug transporter MDR2 | 3.45e-06 | NA | 1.55e-19 | NA |
7. B | Q9CP06 | Spermidine/putrescine import ATP-binding protein PotA | 6.55e-12 | NA | 3.53e-26 | NA |
7. B | Q7NRX5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.82e-11 | NA | 9.87e-26 | NA |
7. B | Q8GEH7 | Methionine import ATP-binding protein MetN | 2.78e-12 | NA | 1.57e-24 | NA |
7. B | Q6GC27 | Methionine import ATP-binding protein MetN 1 | 2.40e-14 | NA | 7.62e-24 | NA |
7. B | Q0TBU8 | Hemin import ATP-binding protein HmuV | 3.11e-15 | NA | 4.28e-18 | NA |
7. B | Q6D3Q6 | Methionine import ATP-binding protein MetN 2 | 4.06e-13 | NA | 4.23e-20 | NA |
7. B | Q8Z0H0 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.75e-12 | NA | 1.59e-26 | NA |
7. B | Q0VT01 | Macrolide export ATP-binding/permease protein MacB | 2.62e-08 | NA | 5.86e-14 | NA |
7. B | A0B3Z7 | Arabinose import ATP-binding protein AraG 2 | 3.20e-06 | NA | 2.32e-11 | NA |
7. B | Q7M816 | Methionine import ATP-binding protein MetN | 4.60e-12 | NA | 3.12e-20 | NA |
7. B | P9WQJ4 | Uncharacterized ABC transporter ATP-binding protein MT1318 | 5.78e-07 | NA | 3.95e-18 | NA |
7. B | Q8LPQ6 | ABC transporter B family member 28 | 4.36e-10 | NA | 3.11e-20 | NA |
7. B | Q92XW1 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 1.53e-11 | NA | 6.95e-25 | NA |
7. B | P69875 | Spermidine/putrescine import ATP-binding protein PotA | 1.56e-11 | NA | 4.73e-24 | NA |
7. B | Q8FCJ1 | Hemin import ATP-binding protein HmuV | 8.44e-15 | NA | 4.28e-18 | NA |
7. B | Q5HQQ9 | Methionine import ATP-binding protein MetN 2 | 8.33e-15 | NA | 3.71e-25 | NA |
7. B | Q8IUA7 | ATP-binding cassette sub-family A member 9 | 2.96e-04 | NA | 1.25e-14 | NA |
7. B | Q9JVR5 | Macrolide export ATP-binding/permease protein MacB | 1.05e-08 | NA | 2.09e-14 | NA |
7. B | Q2YAD6 | Spermidine/putrescine import ATP-binding protein PotA | 7.57e-12 | NA | 1.93e-16 | NA |
7. B | Q3JMW7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 8.38e-14 | NA | 5.23e-21 | NA |
7. B | Q0TA26 | Maltose/maltodextrin import ATP-binding protein MalK | 1.82e-14 | NA | 7.69e-24 | NA |
7. B | Q02FW7 | Hemin import ATP-binding protein HmuV | 1.11e-16 | NA | 3.56e-09 | NA |
7. B | Q9C8H1 | ABC transporter C family member 11 | 3.73e-06 | NA | 3.60e-13 | NA |
7. B | Q669P3 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 1.82e-15 | NA |
7. B | Q0S0Z3 | Fe(3+) ions import ATP-binding protein FbpC 2 | 4.56e-13 | NA | 3.49e-25 | NA |
7. B | P63387 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 0.00e+00 | NA | 8.47e-13 | NA |
7. B | Q46ZM0 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.53e-11 | NA | 2.51e-23 | NA |
7. B | Q83MC5 | Methionine import ATP-binding protein MetN | 4.99e-13 | NA | 8.00e-24 | NA |
7. B | Q8Z824 | Macrolide export ATP-binding/permease protein MacB | 2.84e-08 | NA | 5.02e-16 | NA |
7. B | A0A0G2K1Q8 | Phospholipid-transporting ATPase ABCA3 | 1.60e-04 | NA | 3.03e-19 | NA |
7. B | Q7NU46 | Taurine import ATP-binding protein TauB | 9.81e-13 | NA | 1.57e-16 | NA |
7. B | Q81V36 | Ribose import ATP-binding protein RbsA | 1.39e-06 | NA | 1.70e-10 | NA |
7. B | Q7UBD0 | Maltose/maltodextrin import ATP-binding protein MalK | 1.93e-14 | NA | 6.51e-24 | NA |
7. B | Q5WVN2 | ATP-dependent lipid A-core flippase | 8.16e-11 | NA | 1.84e-23 | NA |
7. B | Q7A7E3 | Methionine import ATP-binding protein MetN 1 | 3.43e-14 | NA | 3.71e-24 | NA |
7. B | Q8ST87 | ABC transporter C family member 10 | 3.52e-06 | NA | 1.47e-14 | NA |
7. B | Q88G95 | Molybdenum import ATP-binding protein ModC | 4.74e-12 | NA | 1.01e-16 | NA |
7. B | Q6MCV4 | Spermidine/putrescine import ATP-binding protein PotA | 2.68e-11 | NA | 9.78e-24 | NA |
7. B | Q4ZRC6 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 9.51e-07 | NA | 1.43e-12 | NA |
7. B | P94360 | Oligosaccharides import ATP-binding protein MsmX | 1.19e-12 | NA | 4.86e-25 | NA |
7. B | D3GE74 | ABC transporter G family member STR | 8.80e-05 | NA | 8.99e-06 | NA |
7. B | Q8UII7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 9.44e-12 | NA | 2.84e-24 | NA |
7. B | Q54EK2 | ABC transporter C family member 7 | 1.35e-06 | NA | 1.92e-16 | NA |
7. B | Q9JI39 | ATP-binding cassette sub-family B member 10, mitochondrial | 5.44e-09 | NA | 5.69e-23 | NA |
7. B | Q63NI4 | Methionine import ATP-binding protein MetN 2 | 4.58e-13 | NA | 2.17e-22 | NA |
7. B | Q1GJU0 | Hemin import ATP-binding protein HmuV | 2.11e-15 | NA | 1.33e-10 | NA |
7. B | P57979 | UvrABC system protein A | 6.42e-02 | NA | 0.030 | NA |
7. B | Q73F66 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.30e-39 | NA |
7. B | Q4KB64 | Molybdenum import ATP-binding protein ModC | 6.44e-12 | NA | 3.42e-19 | NA |
7. B | Q329G7 | Ribose import ATP-binding protein RbsA | 1.43e-06 | NA | 7.08e-10 | NA |
7. B | Q0SRL2 | Spermidine/putrescine import ATP-binding protein PotA | 3.70e-12 | NA | 2.92e-23 | NA |
7. B | P37388 | Xylose import ATP-binding protein XylG | 4.31e-06 | NA | 4.76e-12 | NA |
7. B | Q1R4I3 | Ribose import ATP-binding protein RbsA | 3.90e-07 | NA | 8.59e-14 | NA |
7. B | Q3ICT8 | Hemin import ATP-binding protein HmuV | 8.88e-16 | NA | 2.83e-10 | NA |
7. B | B2KWH4 | ABC transporter 1 | 3.69e-06 | NA | 2.16e-23 | NA |
7. B | Q6BEX0 | Galactofuranose transporter ATP-binding protein YtfR | 3.73e-06 | NA | 3.10e-19 | NA |
7. B | Q8T6J2 | ABC transporter A family member 5 | 2.26e-04 | NA | 2.93e-14 | NA |
7. B | Q96J65 | ATP-binding cassette sub-family C member 12 | 3.57e-06 | NA | 4.74e-14 | NA |
7. B | P45095 | Dipeptide transport ATP-binding protein DppD | 6.86e-12 | NA | 2.16e-15 | NA |
7. B | P21440 | Phosphatidylcholine translocator ABCB4 | 1.53e-06 | NA | 1.91e-21 | NA |
7. B | O14678 | Lysosomal cobalamin transporter ABCD4 | 7.71e-08 | NA | 1.19e-05 | NA |
7. B | P9WQJ7 | Mycobactin import ATP-binding/permease protein IrtB | 2.04e-09 | NA | 3.40e-17 | NA |
7. B | P0CU83 | ABC multidrug transporter MDR2 | 2.21e-06 | NA | 1.47e-19 | NA |
7. B | Q6A6X6 | Methionine import ATP-binding protein MetN | 5.69e-12 | NA | 2.32e-23 | NA |
7. B | P0AAG8 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.20e-06 | NA | 1.74e-13 | NA |
7. B | P0A9U4 | Probable ATP-binding protein YbiT | 1.16e-07 | NA | 9.94e-06 | NA |
7. B | Q1C0D5 | Xylose import ATP-binding protein XylG | 1.30e-06 | NA | 4.91e-13 | NA |
7. B | Q0SXQ1 | Maltose/maltodextrin import ATP-binding protein MalK | 1.85e-14 | NA | 1.22e-23 | NA |
7. B | G0SEV9 | Translation initiation factor RLI1 | 8.05e-04 | NA | 4.07e-09 | NA |
7. B | P42332 | Bacitracin transport ATP-binding protein BcrA | 1.98e-12 | NA | 7.25e-16 | NA |
7. B | Q3JPZ4 | Methionine import ATP-binding protein MetN 1 | 4.49e-14 | NA | 4.38e-26 | NA |
7. B | Q045Z7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.67e-46 | NA |
7. B | Q9CIN4 | Methionine import ATP-binding protein MetN | 1.57e-14 | NA | 2.03e-25 | NA |
7. B | B6RAL1 | ABC transporter patM | 1.32e-03 | NA | 1.23e-07 | NA |
7. B | P39109 | Metal resistance protein YCF1 | 2.75e-06 | NA | 1.60e-16 | NA |
7. B | Q13CI6 | Molybdenum import ATP-binding protein ModC | 1.37e-07 | NA | 1.28e-14 | NA |
7. B | Q6MG08 | ATP-binding cassette sub-family F member 1 | 2.10e-05 | NA | 0.039 | NA |
7. B | P0A9U1 | Probable multidrug ABC transporter ATP-binding protein YbhF | 7.88e-07 | NA | 4.07e-17 | NA |
7. B | P33360 | Glycine betaine uptake system ATP-binding protein YehX | 9.99e-16 | NA | 3.88e-29 | NA |
7. B | Q02856 | Probable ATP-dependent transporter ycf16 | 6.07e-14 | NA | 2.28e-05 | NA |
7. B | Q8YK28 | Phosphonates import ATP-binding protein PhnC 3 | 1.22e-15 | NA | 1.14e-19 | NA |
7. B | P32568 | Protein SNQ2 | 3.76e-03 | NA | 8.18e-04 | NA |
7. B | I1RL06 | ZEB2-regulated ABC transporter 1 | 7.04e-03 | NA | 0.012 | NA |
7. B | Q2YYM5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.35e-38 | NA |
7. B | Q72PE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.22e-15 | NA | 2.99e-29 | NA |
7. B | P36371 | Antigen peptide transporter 2 | 1.08e-08 | NA | 2.76e-18 | NA |
7. B | Q8NWT6 | Nickel import system ATP-binding protein NikE | 1.11e-16 | NA | 3.47e-14 | NA |
7. B | Q9FVV9 | Probable non-intrinsic ABC protein 5 | 3.71e-04 | NA | 1.82e-07 | NA |
7. B | Q8PNN4 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.98e-13 | NA | 2.43e-25 | NA |
7. B | Q6G9I0 | Nickel import system ATP-binding protein NikD | 1.26e-11 | NA | 6.22e-08 | NA |
7. B | Q3K6R9 | Hemin import ATP-binding protein HmuV | 2.22e-16 | NA | 1.53e-12 | NA |
7. B | Q0HNQ5 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.56e-13 | NA | 6.60e-10 | NA |
7. B | Q7VNG4 | Spermidine/putrescine import ATP-binding protein PotA | 8.09e-12 | NA | 1.20e-27 | NA |
7. B | Q03I83 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 6.20e-47 | NA |
7. B | Q7A848 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 2.06e-09 | NA |
7. B | Q3Z5F8 | Methionine import ATP-binding protein MetN | 4.03e-13 | NA | 2.43e-24 | NA |
7. B | Q6FQN3 | ABC multidrug transporter SNQ2 | 2.95e-03 | NA | 8.43e-05 | NA |
7. B | Q44538 | Molybdenum import ATP-binding protein ModC 2 | 1.46e-11 | NA | 1.21e-05 | NA |
7. B | Q767L0 | ATP-binding cassette sub-family F member 1 | 1.76e-05 | NA | 0.032 | NA |
7. B | Q5PG54 | Molybdenum import ATP-binding protein ModC | 8.25e-12 | NA | 2.51e-12 | NA |
7. B | Q9I6L0 | Sulfate/thiosulfate import ATP-binding protein CysA | 5.55e-16 | NA | 8.28e-29 | NA |
7. B | Q0HTS8 | ATP-dependent lipid A-core flippase | 5.37e-11 | NA | 1.66e-21 | NA |
7. B | E9Q236 | ATP-binding cassette sub-family C member 4 | 6.54e-06 | NA | 1.60e-14 | NA |
7. B | A0A0H2VBH0 | Probable ATP-binding protein YheS | 4.68e-06 | NA | 7.91e-07 | NA |
7. B | P08720 | Nod factor export ATP-binding protein I | 9.54e-14 | NA | 7.92e-26 | NA |
7. B | A3CVD3 | Energy-coupling factor transporter ATP-binding protein EcfA | 0.00e+00 | NA | 3.25e-44 | NA |
7. B | Q88PM5 | Phosphonates import ATP-binding protein PhnC | 4.00e-15 | NA | 1.61e-10 | NA |
7. B | Q5DZC6 | Maltose/maltodextrin import ATP-binding protein MalK | 1.34e-11 | NA | 9.85e-25 | NA |
7. B | Q9CF44 | Ribose import ATP-binding protein RbsA | 2.83e-06 | NA | 1.59e-14 | NA |
7. B | Q1BR30 | Methionine import ATP-binding protein MetN 2 | 1.45e-10 | NA | 1.82e-22 | NA |
7. B | Q9FLX5 | ABC transporter G family member 8 | 1.11e-06 | NA | 9.13e-09 | NA |
7. B | Q03CA4 | Ribose import ATP-binding protein RbsA | 8.14e-07 | NA | 9.43e-13 | NA |
7. B | P0C886 | Autoinducer 2 import ATP-binding protein LsrA | 2.31e-06 | NA | 4.26e-11 | NA |
7. B | Q92LU2 | Molybdenum import ATP-binding protein ModC | 4.59e-12 | NA | 2.07e-13 | NA |
7. B | Q55DW4 | ABC transporter G family member 1 | 4.96e-06 | NA | 6.26e-04 | NA |
7. B | Q2SVP3 | Nod factor export ATP-binding protein I | 1.91e-10 | NA | 2.74e-20 | NA |
7. B | Q7VN12 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.86e-13 | NA | 2.54e-06 | NA |
7. B | Q1LLP5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.16e-11 | NA | 2.09e-23 | NA |
7. B | Q5WKL3 | Methionine import ATP-binding protein MetN 1 | 2.11e-13 | NA | 2.29e-22 | NA |
7. B | Q58762 | Molybdate/tungstate import ATP-binding protein WtpC | 2.22e-14 | NA | 8.52e-19 | NA |
7. B | Q92L55 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.13e-11 | NA | 2.78e-08 | NA |
7. B | Q217L2 | Macrolide export ATP-binding/permease protein MacB | 2.91e-09 | NA | 6.22e-13 | NA |
7. B | Q9A502 | Methionine import ATP-binding protein MetN | 1.18e-13 | NA | 4.89e-26 | NA |
7. B | Q73KK2 | Galactose/methyl galactoside import ATP-binding protein MglA | 4.09e-06 | NA | 2.99e-15 | NA |
7. B | Q5FKL2 | Methionine import ATP-binding protein MetN | 1.04e-11 | NA | 5.13e-27 | NA |
7. B | Q1REG5 | Molybdenum import ATP-binding protein ModC | 1.04e-11 | NA | 6.62e-12 | NA |
7. B | P0A9S8 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 0.00e+00 | NA | 5.86e-15 | NA |
7. B | Q5WDP1 | Methionine import ATP-binding protein MetN 3 | 9.99e-16 | NA | 4.83e-25 | NA |
7. B | Q2G0V2 | Methionine import ATP-binding protein MetN 1 | 3.81e-14 | NA | 3.05e-24 | NA |
7. B | Q0BGD7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 4.55e-06 | NA | 8.92e-10 | NA |
7. B | Q8FCQ2 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.77e-11 | NA | 5.22e-22 | NA |
7. B | Q1JJD0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q637E2 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 7.95e-12 | NA |
7. B | Q1AS06 | Spermidine/putrescine import ATP-binding protein PotA | 7.78e-08 | NA | 3.05e-22 | NA |
7. B | Q3JYF5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.27e-41 | NA |
7. B | D8KFN1 | Methionine import ATP-binding protein MetN | 1.84e-14 | NA | 1.52e-23 | NA |
7. B | Q88AS5 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.44e-16 | NA | 1.32e-28 | NA |
7. B | Q09YK5 | Cystic fibrosis transmembrane conductance regulator | 7.48e-05 | NA | 3.14e-11 | NA |
7. B | P47326 | Oligopeptide transport ATP-binding protein OppF | 2.30e-04 | NA | 3.54e-07 | NA |
7. B | Q8REG7 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 3.59e-19 | NA |
7. B | Q97EK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.38e-42 | NA |
7. B | P36619 | Leptomycin B resistance protein pmd1 | 5.08e-06 | NA | 3.59e-21 | NA |
7. B | Q9L1C3 | Methionine import ATP-binding protein MetN | 4.07e-12 | NA | 4.10e-22 | NA |
7. B | Q9M2V7 | ABC transporter G family member 16 | 2.29e-05 | NA | 5.46e-07 | NA |
7. B | P63386 | Intermembrane phospholipid transport system ATP-binding protein MlaF | 4.88e-15 | NA | 8.47e-13 | NA |
7. B | Q6NBT1 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.48e-12 | NA | 6.51e-27 | NA |
7. B | Q2JLH7 | Phosphonates import ATP-binding protein PhnC 2 | 0.00e+00 | NA | 1.52e-16 | NA |
7. B | P63299 | Galactofuranose transporter ATP-binding protein YtfR | 8.93e-06 | NA | 3.34e-19 | NA |
7. B | Q8K441 | ATP-binding cassette sub-family A member 6 | 2.95e-04 | NA | 8.58e-11 | NA |
7. B | Q8YBN5 | Putative peptide import ATP-binding protein BMEII0864 | 2.45e-13 | NA | 2.50e-15 | NA |
7. B | Q0B775 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 1.13e-06 | NA | 2.18e-15 | NA |
7. B | Q2K353 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 1.78e-06 | NA | 1.83e-11 | NA |
7. B | Q54P13 | ABC transporter C family member 8 | 1.15e-05 | NA | 1.51e-13 | NA |
7. B | Q577J4 | Putative peptide import ATP-binding protein BruAb2_0797 | 2.83e-13 | NA | 2.50e-15 | NA |
7. B | Q92CK1 | Putative ABC transporter ATP-binding protein lin1170 | 0.00e+00 | NA | 2.38e-30 | NA |
7. B | Q1RKE4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.33e-13 | NA | 0.035 | NA |
7. B | Q98EA4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.10e-12 | NA | 3.13e-05 | NA |
7. B | Q9STT5 | ABC transporter A family member 7 | 3.92e-06 | NA | 3.71e-09 | NA |
7. B | Q7PC83 | ABC transporter G family member 41 | 6.04e-04 | NA | 0.020 | NA |
7. B | Q6GDC0 | Putative ABC transporter ATP-binding protein SAR2766 | 1.78e-07 | NA | 8.65e-27 | NA |
7. B | A5VU86 | Putative peptide import ATP-binding protein BOV_A0347 | 2.45e-13 | NA | 2.50e-15 | NA |
7. B | Q07DW5 | Cystic fibrosis transmembrane conductance regulator | 9.14e-05 | NA | 4.61e-10 | NA |
7. B | Q1C970 | Methionine import ATP-binding protein MetN 2 | 2.88e-12 | NA | 5.57e-19 | NA |
7. B | Q3IGX5 | ATP-dependent lipid A-core flippase | 1.20e-09 | NA | 2.11e-22 | NA |
7. B | Q5ZUH9 | ATP-dependent lipid A-core flippase | 1.77e-10 | NA | 7.69e-24 | NA |
7. B | P44531 | Fe(3+) ions import ATP-binding protein FbpC 1 | 8.63e-11 | NA | 1.79e-21 | NA |
7. B | Q9WYC4 | Uncharacterized ABC transporter ATP-binding protein TM_0288 | 6.86e-11 | NA | 5.70e-21 | NA |
7. B | Q07733 | Oligopeptide transport ATP-binding protein OppD | 1.11e-12 | NA | 1.05e-17 | NA |
7. B | Q2U0M6 | ABC multidrug transporter atrG | 3.17e-03 | NA | 0.025 | NA |
7. B | A9R074 | Autoinducer 2 import ATP-binding protein LsrA | 3.58e-05 | NA | 1.41e-09 | NA |
7. B | Q84TH5 | ABC transporter G family member 25 | 1.69e-07 | NA | 1.17e-11 | NA |
7. B | A0K6Q0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 3.09e-06 | NA | 8.14e-15 | NA |
7. B | Q2K8C8 | Fe(3+) ions import ATP-binding protein FbpC | 2.25e-11 | NA | 2.06e-24 | NA |
7. B | Q5FM63 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 1.96e-71 | NA |
7. B | Q03024 | Alkaline protease secretion ATP-binding protein AprD | 4.46e-10 | NA | 7.73e-13 | NA |
7. B | Q5KVK2 | Methionine import ATP-binding protein MetN | 9.99e-16 | NA | 1.48e-27 | NA |
7. B | Q042G7 | Spermidine/putrescine import ATP-binding protein PotA | 1.29e-14 | NA | 3.48e-26 | NA |
7. B | E9Q876 | Glucosylceramide transporter ABCA12 | 5.25e-03 | NA | 8.30e-12 | NA |
7. B | P0A2U9 | Oligopeptide transport ATP-binding protein AmiE | 3.91e-11 | NA | 4.61e-17 | NA |
7. B | Q5X498 | ATP-dependent lipid A-core flippase | 1.10e-10 | NA | 8.13e-24 | NA |
7. B | Q8CUY0 | Phosphonates import ATP-binding protein PhnC 2 | 3.33e-16 | NA | 1.61e-13 | NA |
7. B | Q87H79 | Ribose import ATP-binding protein RbsA | 3.70e-07 | NA | 2.44e-12 | NA |
7. B | Q63S19 | Methionine import ATP-binding protein MetN 1 | 3.51e-14 | NA | 4.38e-26 | NA |
7. B | Q827Y0 | Methionine import ATP-binding protein MetN | 5.43e-12 | NA | 8.03e-21 | NA |
7. B | A0A059JK44 | ABC multidrug transporter MDR2 | 2.36e-06 | NA | 3.13e-19 | NA |
7. B | P08007 | Oligopeptide transport ATP-binding protein OppF | 6.54e-14 | NA | 1.35e-15 | NA |
7. B | Q2RWI9 | Molybdenum import ATP-binding protein ModC | 1.60e-11 | NA | 9.44e-16 | NA |
7. B | Q54TV2 | ABC transporter G family member 5 | 1.55e-03 | NA | 1.08e-06 | NA |
7. B | Q6W2B1 | Taurine import ATP-binding protein TauB | 1.26e-12 | NA | 5.41e-17 | NA |
7. B | Q1MCZ1 | Hemin import ATP-binding protein HmuV | 1.51e-14 | NA | 4.45e-11 | NA |
7. B | Q07E42 | Cystic fibrosis transmembrane conductance regulator | 8.09e-05 | NA | 3.96e-11 | NA |
7. B | Q48QM3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.36e-44 | NA |
7. B | Q1R3Q1 | Maltose/maltodextrin import ATP-binding protein MalK | 1.17e-11 | NA | 7.18e-24 | NA |
7. B | Q8P2M5 | Probable ABC transporter ATP-binding protein spyM18_0273 | 8.60e-10 | NA | 6.82e-08 | NA |
7. B | Q74K65 | Spermidine/putrescine import ATP-binding protein PotA | 1.18e-14 | NA | 6.76e-26 | NA |
7. B | Q52733 | Cytochrome c biogenesis ATP-binding export protein CcmA | 3.81e-11 | NA | 7.14e-08 | NA |
7. B | Q5PKZ8 | Maltose/maltodextrin import ATP-binding protein MalK | 3.01e-11 | NA | 2.53e-24 | NA |
7. B | Q8UA86 | Ribose import ATP-binding protein RbsA 1 | 5.30e-06 | NA | 5.92e-10 | NA |
7. B | Q45978 | ATP-binding protein Uup | 7.01e-06 | NA | 3.22e-05 | NA |
7. B | Q663Y5 | Xylose import ATP-binding protein XylG | 1.99e-06 | NA | 4.91e-13 | NA |
7. B | Q3K199 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 6.93e-20 | NA |
7. B | Q5M1F6 | Methionine import ATP-binding protein MetN | 9.90e-14 | NA | 2.39e-22 | NA |
7. B | Q2RPB4 | Macrolide export ATP-binding/permease protein MacB | 1.13e-08 | NA | 2.58e-21 | NA |
7. B | P0A9S9 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 0.00e+00 | NA | 5.86e-15 | NA |
7. B | Q9TUQ2 | Cystic fibrosis transmembrane conductance regulator | 8.36e-05 | NA | 2.31e-11 | NA |
7. B | Q8KFE9 | Macrolide export ATP-binding/permease protein MacB | 2.97e-08 | NA | 1.23e-18 | NA |
7. B | P36497 | Pediocin PA-1 transport/processing ATP-binding protein PedD | 1.03e-09 | NA | 5.10e-28 | NA |
7. B | P0CZ36 | Phosphate import ATP-binding protein PstB 1 | 1.41e-14 | NA | 1.65e-21 | NA |
7. B | P21958 | Antigen peptide transporter 1 | 2.53e-10 | NA | 6.83e-14 | NA |
7. B | P77509 | Uncharacterized ABC transporter ATP-binding protein YphE | 5.82e-06 | NA | 2.44e-09 | NA |
7. B | Q18CI9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 4.08e-44 | NA |
7. B | Q6ADG4 | Phosphate import ATP-binding protein PstB | 4.11e-15 | NA | 1.02e-20 | NA |
7. B | P45127 | Energy-dependent translational throttle protein EttA | 6.06e-04 | NA | 2.03e-09 | NA |
7. B | Q9K0N7 | Macrolide export ATP-binding/permease protein MacB | 9.01e-09 | NA | 1.09e-15 | NA |
7. B | Q3SP57 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 4.17e-10 | NA | 9.44e-20 | NA |
7. B | Q3KFY6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.72e-13 | NA | 3.49e-09 | NA |
7. B | Q03ZL6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 0.00e+00 | NA | 3.85e-63 | NA |
7. B | Q8Z8W8 | Putative 2-aminoethylphosphonate import ATP-binding protein PhnT | 9.33e-15 | NA | 7.16e-22 | NA |
7. B | Q2FYQ7 | Nickel import system ATP-binding protein NikD | 1.16e-11 | NA | 6.22e-08 | NA |
7. B | Q5PBX2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 4.17e-09 | NA |
7. B | P94366 | ATP-binding/permease protein CydC | 1.22e-10 | NA | 8.06e-10 | NA |
7. B | Q86UQ4 | ATP-binding cassette sub-family A member 13 | NA | NA | 3.74e-12 | NA |
7. B | Q8YDR7 | Putative ATP-binding protein BMEII0108 | 1.06e-10 | NA | 1.02e-14 | NA |
7. B | P40024 | ABC transporter ATP-binding protein ARB1 | 3.64e-07 | NA | 0.002 | NA |
7. B | P55604 | Uncharacterized ABC transporter ATP-binding protein y4oS | 6.59e-09 | NA | 7.04e-25 | NA |
7. B | Q1M5X4 | Ribose import ATP-binding protein RbsA 2 | 5.57e-06 | NA | 1.51e-10 | NA |
7. B | Q8EDF0 | ATP-dependent lipid A-core flippase | 5.59e-11 | NA | 8.27e-20 | NA |
7. B | Q81ZF5 | Methionine import ATP-binding protein MetN 2 | 1.67e-15 | NA | 1.06e-27 | NA |
7. B | Q660M8 | Spermidine/putrescine import ATP-binding protein PotA | 3.91e-12 | NA | 1.45e-26 | NA |
7. B | Q59R09 | Iron-sulfur clusters transporter ATM1, mitochondrial | 6.68e-09 | NA | 1.42e-21 | NA |
7. B | A7ZLX1 | Putative autoinducer 2 import ATP-binding protein LsrA homolog | 3.51e-08 | NA | 3.12e-14 | NA |
7. B | O07016 | Uncharacterized ABC transporter ATP-binding protein YvfR | 1.59e-10 | NA | 8.00e-20 | NA |
7. B | Q398W2 | Ribose import ATP-binding protein RbsA 2 | 1.56e-05 | NA | 1.49e-14 | NA |
7. B | Q046T0 | Phosphonates import ATP-binding protein PhnC | 1.11e-16 | NA | 5.66e-13 | NA |
7. B | Q6D734 | Fe(3+) ions import ATP-binding protein FbpC 1 | 6.32e-12 | NA | 8.33e-23 | NA |
7. B | Q8E554 | Spermidine/putrescine import ATP-binding protein PotA | 2.27e-12 | NA | 7.14e-27 | NA |
7. B | Q2IBB3 | Cystic fibrosis transmembrane conductance regulator | 9.44e-05 | NA | 5.75e-10 | NA |
7. B | Q87Q38 | Vitamin B12 import ATP-binding protein BtuD | 2.17e-13 | NA | 7.54e-05 | NA |
7. B | P0AAG1 | Dipeptide transport ATP-binding protein DppD | 1.22e-11 | NA | 2.32e-14 | NA |
7. B | P22731 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 0.00e+00 | NA | 3.65e-11 | NA |
7. B | Q6GB18 | Methionine import ATP-binding protein MetN 2 | 3.56e-13 | NA | 1.65e-26 | NA |
7. B | O53645 | Multidrug efflux ATP-binding/permease protein Rv0194 | 1.20e-06 | NA | 1.00e-23 | NA |
7. B | Q74L61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 3.30e-50 | NA |
7. B | P75831 | Macrolide export ATP-binding/permease protein MacB | 8.58e-08 | NA | 2.97e-16 | NA |
7. B | Q1CC21 | Maltose/maltodextrin import ATP-binding protein MalK | 2.54e-11 | NA | 2.75e-26 | NA |
7. B | Q1H0W2 | Hemin import ATP-binding protein HmuV | 0.00e+00 | NA | 7.22e-14 | NA |
7. B | Q2YWP2 | Methionine import ATP-binding protein MetN 2 | 3.68e-13 | NA | 1.59e-26 | NA |
7. B | Q9CGD4 | Spermidine/putrescine import ATP-binding protein PotA | 2.31e-11 | NA | 1.52e-26 | NA |
7. B | Q88ZZ2 | Putative ABC transporter ATP-binding protein lp_0149 | 5.11e-08 | NA | 5.68e-33 | NA |
7. B | P9WQI7 | Uncharacterized ABC transporter ATP-binding protein Rv2326c | 3.67e-06 | NA | 4.78e-16 | NA |
7. B | Q97T09 | Methionine import ATP-binding protein MetN | 9.90e-14 | NA | 2.55e-24 | NA |
7. B | Q62B84 | Methionine import ATP-binding protein MetN 2 | 2.16e-13 | NA | 1.04e-22 | NA |
7. B | Q1Q889 | Zinc import ATP-binding protein ZnuC | 5.82e-13 | NA | 4.79e-12 | NA |
7. B | Q4ZT65 | Macrolide export ATP-binding/permease protein MacB 2 | 7.59e-09 | NA | 4.95e-17 | NA |
7. B | Q07DX5 | Cystic fibrosis transmembrane conductance regulator | 8.90e-05 | NA | 2.77e-10 | NA |
7. B | Q1CGT1 | Galactose/methyl galactoside import ATP-binding protein MglA | 2.26e-06 | NA | 9.12e-15 | NA |
7. B | Q9M1Q9 | ABC transporter B family member 21 | 1.87e-06 | NA | 4.41e-26 | NA |
7. B | P70170 | ATP-binding cassette sub-family C member 9 | 3.49e-06 | NA | 6.72e-15 | NA |
7. B | Q07756 | Nod factor export ATP-binding protein I | 1.74e-13 | NA | 1.51e-07 | NA |
7. B | Q6C6N0 | Iron-sulfur clusters transporter ATM1, mitochondrial | 2.28e-09 | NA | 6.48e-18 | NA |
7. B | O34631 | Uncharacterized ABC transporter ATP-binding protein YvrA | 1.08e-11 | NA | 1.54e-16 | NA |
7. B | Q7VZE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.11e-15 | NA | 3.70e-30 | NA |
7. B | Q8K9I3 | ATP-binding protein Uup | 1.60e-05 | NA | 7.39e-08 | NA |
7. B | P72479 | Oligopeptide transport ATP-binding protein OppF | 5.44e-15 | NA | 1.35e-19 | NA |
7. B | Q39HA1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 2.43e-06 | NA | 4.94e-15 | NA |
7. B | P40790 | Spermidine/putrescine import ATP-binding protein PotA | 1.16e-11 | NA | 1.09e-23 | NA |
7. B | A0A095C325 | ABC multidrug transporter MDR1 | 3.49e-06 | NA | 1.33e-18 | NA |
7. B | Q4L8L7 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | NA | 8.56e-17 | NA |
7. B | P37732 | Molybdenum import ATP-binding protein ModC 1 | 6.03e-12 | NA | 1.33e-17 | NA |
7. B | E7F6F7 | Iron-sulfur clusters transporter ABCB7, mitochondrial | 2.79e-09 | NA | 1.13e-22 | NA |
7. B | Q8N139 | ATP-binding cassette sub-family A member 6 | 1.44e-04 | NA | 8.05e-13 | NA |
7. B | Q49ZT6 | Putative hemin import ATP-binding protein HrtA | 0.00e+00 | NA | 2.37e-12 | NA |
7. B | Q54JR2 | ABC transporter C family member 3 | 1.87e-06 | NA | 1.86e-14 | NA |
7. B | P0CZ32 | Oligopeptide transport ATP-binding protein OppF | 1.80e-13 | NA | 1.10e-18 | NA |
7. B | Q3JNJ9 | Arabinose import ATP-binding protein AraG | 8.47e-06 | NA | 1.20e-06 | NA |
7. B | Q38WL5 | Methionine import ATP-binding protein MetN | 2.11e-15 | NA | 8.63e-22 | NA |
7. B | Q8XIZ5 | Spermidine/putrescine import ATP-binding protein PotA | 1.37e-12 | NA | 3.01e-22 | NA |
7. B | Q1GID1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 1.48e-11 | NA | 2.02e-22 | NA |
7. B | C4ZYH1 | Vitamin B12 import ATP-binding protein BtuD | 8.97e-14 | NA | 0.001 | NA |
7. B | Q07DZ6 | Cystic fibrosis transmembrane conductance regulator | 7.97e-05 | NA | 3.05e-12 | NA |
7. B | Q0HVQ0 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 5.85e-13 | NA |
7. B | Q73P71 | Phosphonates import ATP-binding protein PhnC | 0.00e+00 | NA | 3.22e-19 | NA |
7. B | Q8X4V7 | Molybdenum import ATP-binding protein ModC | 4.95e-12 | NA | 1.96e-12 | NA |
7. B | A1RG29 | Macrolide export ATP-binding/permease protein MacB | 2.84e-08 | NA | 6.78e-14 | NA |
7. B | Q864R9 | Multidrug resistance-associated protein 1 | 2.42e-06 | NA | 1.15e-13 | NA |
7. B | Q8ZKQ4 | Autoinducer 2 import ATP-binding protein LsrA | 5.54e-06 | NA | 4.00e-11 | NA |
7. B | Q03Z27 | Methionine import ATP-binding protein MetN | 1.29e-13 | NA | 1.30e-23 | NA |
7. B | Q74AT2 | Lipoprotein-releasing system ATP-binding protein LolD | 0.00e+00 | NA | 2.02e-12 | NA |
7. B | Q8RY46 | ABC transporter B family member 26, chloroplastic | 4.03e-11 | NA | 3.18e-20 | NA |
7. B | P9WQM0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.30e-10 | NA | 7.91e-25 | NA |
7. B | Q9LSJ5 | ABC transporter B family member 18 | 4.03e-06 | NA | 8.40e-25 | NA |
7. B | Q2K4V4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 2.10e-11 | NA | 1.28e-23 | NA |
7. B | Q6CZ34 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.00e-11 | NA | 2.12e-18 | NA |
7. B | Q7CJG3 | Macrolide export ATP-binding/permease protein MacB 2 | 1.82e-08 | NA | 3.72e-15 | NA |
7. B | P13567 | UvrABC system protein A | 2.08e-02 | NA | 0.014 | NA |
7. B | Q03JH1 | Spermidine/putrescine import ATP-binding protein PotA | 6.00e-12 | NA | 5.90e-24 | NA |
7. B | A2RH10 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 2.68e-44 | NA |
7. B | Q24739 | Protein brown | NA | NA | 0.012 | NA |
7. B | O83658 | Spermidine/putrescine import ATP-binding protein PotA | 1.20e-09 | NA | 1.08e-23 | NA |
7. B | Q164Y5 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.72e-12 | NA | 8.52e-26 | NA |
7. B | Q13KX9 | Taurine import ATP-binding protein TauB 2 | 2.02e-12 | NA | 2.41e-18 | NA |
7. B | P32016 | Capsule polysaccharide export ATP-binding protein CtrD | 6.15e-12 | NA | 5.11e-10 | NA |
7. B | Q8DPC2 | Spermidine/putrescine import ATP-binding protein PotA | 3.49e-12 | NA | 1.13e-24 | NA |
7. B | Q65M34 | Methionine import ATP-binding protein MetN 1 | 1.53e-13 | NA | 6.55e-21 | NA |
7. B | Q8DZJ0 | Spermidine/putrescine import ATP-binding protein PotA | 2.80e-12 | NA | 7.14e-27 | NA |
7. B | P46920 | Glycine betaine transport ATP-binding protein OpuAA | 8.75e-12 | NA | 1.18e-28 | NA |
7. B | Q13LX0 | Ribose import ATP-binding protein RbsA | 3.31e-06 | NA | 5.23e-10 | NA |
7. B | Q39IE7 | Methionine import ATP-binding protein MetN 1 | 6.07e-14 | NA | 4.42e-25 | NA |
7. B | Q8ZQE4 | Macrolide export ATP-binding/permease protein MacB | 2.40e-08 | NA | 4.63e-16 | NA |
7. B | Q8T685 | ABC transporter G family member 12 | 1.01e-05 | NA | 8.99e-08 | NA |
7. B | P9WQJ2 | Fatty acid ABC transporter ATP-binding/permease protein | 4.29e-11 | NA | 3.77e-18 | NA |
7. B | P68187 | Maltose/maltodextrin import ATP-binding protein MalK | 1.54e-11 | NA | 7.18e-24 | NA |
7. B | Q9M2V5 | ABC transporter G family member 18 | 9.70e-06 | NA | 2.88e-08 | NA |
7. B | Q035B3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 9.39e-51 | NA |
7. B | Q7TNJ2 | ATP-binding cassette sub-family A member 7 | 1.02e-03 | NA | 7.38e-14 | NA |
7. B | Q5XCA4 | Spermidine/putrescine import ATP-binding protein PotA | 2.64e-12 | NA | 3.57e-27 | NA |
7. B | Q87ZE0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 1.13e-06 | NA | 1.23e-12 | NA |
7. B | O32151 | Uncharacterized ABC transporter ATP-binding protein YurJ | 1.78e-12 | NA | 4.39e-23 | NA |
7. B | Q4QMH4 | Methionine import ATP-binding protein MetN | 2.78e-13 | NA | 6.87e-28 | NA |
7. B | Q8A883 | Spermidine/putrescine import ATP-binding protein PotA | 7.29e-13 | NA | 1.11e-26 | NA |
7. B | Q4KK16 | Taurine import ATP-binding protein TauB | 1.76e-11 | NA | 1.23e-19 | NA |
7. B | J9VF33 | ABC multidrug transporter MDR1 | 1.61e-06 | NA | 2.42e-18 | NA |
7. B | Q03P57 | Methionine import ATP-binding protein MetN | 2.00e-15 | NA | 1.40e-25 | NA |
7. B | P9WQJ3 | Fatty acid ABC transporter ATP-binding/permease protein | 2.56e-11 | NA | 3.77e-18 | NA |
7. B | Q88J90 | Ribose import ATP-binding protein RbsA | 2.34e-06 | NA | 1.29e-07 | NA |
7. B | B1LFA2 | Autoinducer 2 import ATP-binding protein LsrA | 2.15e-06 | NA | 2.80e-15 | NA |
7. B | Q48TC3 | Phosphate import ATP-binding protein PstB 1 | 0.00e+00 | NA | 1.67e-21 | NA |
7. B | Q0AGF4 | Spermidine/putrescine import ATP-binding protein PotA | 1.44e-15 | NA | 7.13e-19 | NA |
7. B | Q21CA3 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 2.93e-12 | NA | 1.99e-25 | NA |
7. B | P33311 | ATP-dependent permease MDL2, mitochondrial | 7.42e-09 | NA | 2.80e-24 | NA |
7. B | Q8XBJ8 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.61e-13 | NA | 3.56e-23 | NA |
7. B | Q88F88 | Macrolide export ATP-binding/permease protein MacB | 5.44e-08 | NA | 1.95e-10 | NA |
7. B | Q6FZF2 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 2.91e-11 | NA | 1.20e-18 | NA |
7. B | Q1MMZ3 | Phosphonates import ATP-binding protein PhnC | 4.91e-14 | NA | 1.20e-14 | NA |
7. B | P04285 | Oligopeptide transport ATP-binding protein OppD | 1.22e-11 | NA | 9.83e-15 | NA |
7. B | P53756 | ABC transporter ATP-binding protein/permease PDR18 | 1.92e-03 | NA | 0.004 | NA |
7. B | Q8KZR4 | Taurine import ATP-binding protein TauB | 6.56e-12 | NA | 5.25e-19 | NA |
7. B | Q64343 | ATP-binding cassette sub-family G member 1 | 1.87e-05 | NA | 2.55e-10 | NA |
7. B | P0CZ43 | Probable ABC transporter ATP-binding protein SPs0214 | 8.29e-10 | NA | 4.60e-07 | NA |
7. B | Q6N9W0 | Methionine import ATP-binding protein MetN 1 | 7.48e-13 | NA | 1.21e-26 | NA |
7. B | Q8T675 | ABC transporter G family member 19 | 6.40e-04 | NA | 0.017 | NA |
7. B | Q92WD6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 7.61e-12 | NA | 9.34e-28 | NA |
7. B | Q02592 | Heavy metal tolerance protein | 1.57e-08 | NA | 7.40e-23 | NA |
7. B | Q0SFY5 | Methionine import ATP-binding protein MetN 1 | 5.18e-10 | NA | 1.04e-26 | NA |
7. B | G2JZ44 | Carnitine transport ATP-binding protein OpuCA | 2.80e-10 | NA | 4.98e-18 | NA |
7. B | Q73P93 | Putative ABC transporter ATP-binding protein TDE_0906 | 2.38e-07 | NA | 6.44e-27 | NA |
7. B | Q080T2 | ATP-dependent lipid A-core flippase | 3.24e-11 | NA | 1.24e-18 | NA |
7. B | Q6PQZ2 | Cystic fibrosis transmembrane conductance regulator | 2.44e-05 | NA | 5.17e-10 | NA |
7. B | Q6MTC1 | Phosphate import ATP-binding protein PstB | 9.99e-16 | NA | 1.04e-13 | NA |
7. B | Q880Z2 | Xylose import ATP-binding protein XylG | 5.35e-06 | NA | 3.03e-09 | NA |
7. B | P04983 | Ribose import ATP-binding protein RbsA | 4.03e-07 | NA | 9.57e-14 | NA |
7. B | Q4K5Z7 | Hemin import ATP-binding protein HmuV | 0.00e+00 | NA | 1.34e-07 | NA |
7. B | A2RI02 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 0.00e+00 | NA | 1.03e-42 | NA |
7. B | Q1I4Q5 | Hemin import ATP-binding protein HmuV | 2.44e-15 | NA | 2.99e-10 | NA |
7. B | P45288 | Peptide transport system ATP-binding protein SapD | 1.26e-10 | NA | 2.13e-06 | NA |
7. B | P12428 | Protein brown | 3.12e-06 | NA | 0.003 | NA |
7. B | Q6D606 | Cytochrome c biogenesis ATP-binding export protein CcmA | 5.56e-14 | NA | 5.06e-07 | NA |
7. B | Q1JDG6 | Methionine import ATP-binding protein MetN | 2.43e-13 | NA | 6.27e-29 | NA |
7. B | Q3KE48 | Macrolide export ATP-binding/permease protein MacB 2 | 4.72e-08 | NA | 8.34e-17 | NA |
7. B | Q0B6I6 | Methionine import ATP-binding protein MetN 2 | 1.19e-09 | NA | 2.29e-23 | NA |
7. B | Q94FB9 | ABC transporter D family member 1 | 2.07e-04 | NA | 0.004 | NA |