Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54899.1
JCVISYN3A_0650
Type I methionyl aminopeptidase.
M. mycoides homolog: Q6MSP6.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 56
Unique PROST Go: 2
Unique BLAST Go: 9
Unique Foldseek Go: 28
Total Homologs: 479
Unique PROST Homologs: 0
Unique BLAST Homologs: 38
Unique Foldseek Homologs: 263
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P9WK20
(Methionine aminopeptidase 1) with a FATCAT P-Value: 0 and RMSD of 1.17 angstrom. The sequence alignment identity is 35.3%.
Structural alignment shown in left. Query protein AVX54899.1 colored as red in alignment, homolog P9WK20 colored as blue.
Query protein AVX54899.1 is also shown in right top, homolog P9WK20 showed in right bottom. They are colored based on secondary structures.
AVX54899.1 -----------MITIKNQEQIQKMKIAGQVLAKGLNLLKSMIKPGVNCLDLDKAFEEFIKQNGCESNFKNYQGFPKTICISINDQLIHGIPKN-RILQNG 88 P9WK20 MRPLARLRGRRVVPQRSAGELDAMAAAGAVVAAALRAIRAAAAPGTSSLSLDEIAESVIRESGATPSFLGYHGYPASICASINDRVVHGIPSTAEVLAPG 100 AVX54899.1 DIVSIDAGCMYQKWHADSAFTMVCGIANDKKNDILIRVTEKALDLAIAELKPGIRV---------GTIGSIIQNYVESHNFSVPRDYTGHGIGLALHEDP 179 P9WK20 DLVSIDCGAVLDGWHGDAAITFGVGALSD-ADEALSEATRESLQAGIAAMVVGNRLTDVAHAIETGTRAAELR-Y--GRSFGIVAGYGGHGIGRQMHMDP 196 AVX54899.1 YIPNYGIPNTGVRLQENMVICIEPMVQMGTYKTKLADDNWTVYSADHSMTAHFEHTILITKDGCEVLTKEER 251 P9WK20 FLPNEGAPGRGPLLAAGSVLAIEPMLTLGTTKTVVLDDKWTVTTADGSRAAHWEHTVAVTDDGPRILTLG-- 266
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0070006 | metalloaminopeptidase activity |
| 1. PBF | GO:0070084 | protein initiator methionine removal |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0035551 | protein initiator methionine removal involved in protein maturation |
| 1. PBF | GO:0008235 | metalloexopeptidase activity |
| 3. BF | GO:0004177 | aminopeptidase activity |
| 3. BF | GO:0044843 | cell cycle G1/S phase transition |
| 3. BF | GO:0008233 | peptidase activity |
| 3. BF | GO:0030145 | manganese ion binding |
| 3. BF | GO:0005737 | cytoplasm |
| 3. BF | GO:0008237 | metallopeptidase activity |
| 3. BF | GO:0016787 | hydrolase activity |
| 3. BF | GO:0016980 | creatinase activity |
| 3. BF | GO:0102009 | proline dipeptidase activity |
| 4. PB | GO:0031365 | N-terminal protein amino acid modification |
| 4. PB | GO:0006555 | methionine metabolic process |
| 4. PB | GO:0018206 | peptidyl-methionine modification |
| 5. P | GO:0050897 | cobalt ion binding |
| 5. P | GO:0016151 | nickel cation binding |
| 6. F | GO:0000055 | ribosomal large subunit export from nucleus |
| 6. F | GO:0006261 | DNA-dependent DNA replication |
| 6. F | GO:0005886 | plasma membrane |
| 6. F | GO:0035101 | FACT complex |
| 6. F | GO:0004063 | aryldialkylphosphatase activity |
| 6. F | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 6. F | GO:0006338 | chromatin remodeling |
| 6. F | GO:0030687 | preribosome, large subunit precursor |
| 6. F | GO:0034724 | DNA replication-independent chromatin organization |
| 6. F | GO:0045899 | positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| 6. F | GO:0031298 | replication fork protection complex |
| 6. F | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 6. F | GO:0051984 | positive regulation of chromosome segregation |
| 6. F | GO:0005634 | nucleus |
| 6. F | GO:0016795 | phosphoric triester hydrolase activity |
| 6. F | GO:0006334 | nucleosome assembly |
| 6. F | GO:0016805 | dipeptidase activity |
| 6. F | GO:0031491 | nucleosome binding |
| 6. F | GO:0016021 | integral component of membrane |
| 6. F | GO:0047869 | dimethylpropiothetin dethiomethylase activity |
| 6. F | GO:0047862 | diisopropyl-fluorophosphatase activity |
| 6. F | GO:0042393 | histone binding |
| 6. F | GO:0042400 | ectoine catabolic process |
| 6. F | GO:0016812 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides |
| 6. F | GO:0060465 | pharynx development |
| 6. F | GO:0006281 | DNA repair |
| 6. F | GO:0007063 | regulation of sister chromatid cohesion |
| 6. F | GO:0010815 | bradykinin catabolic process |
| 7. B | GO:0009734 | auxin-activated signaling pathway |
| 7. B | GO:0008238 | exopeptidase activity |
| 7. B | GO:0045335 | phagocytic vesicle |
| 7. B | GO:0005739 | mitochondrion |
| 7. B | GO:0051302 | regulation of cell division |
| 7. B | GO:0016485 | protein processing |
| 7. B | GO:0003094 | glomerular filtration |
| 7. B | GO:0001558 | regulation of cell growth |
| 7. B | GO:0006508 | proteolysis |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004177 | aminopeptidase activity |
| GO:0008233 | peptidase activity |
| GO:0036211 | protein modification process |
| GO:0070006 | metalloaminopeptidase activity |
| GO:0046914 | transition metal ion binding |
| GO:0070084 | protein initiator methionine removal |
| GO:0046872 | metal ion binding |
| GO:0016787 | hydrolase activity |
| GO:0006508 | proteolysis |
| GO:0008235 | metalloexopeptidase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q59509 | Methionine aminopeptidase | 0.00e+00 | 1.62e-93 | 6.27e-178 | 0.9964 |
| 1. PBF | Q9Z6Q0 | Methionine aminopeptidase | 0.00e+00 | 9.11e-14 | 3.60e-39 | 0.9649 |
| 1. PBF | P50614 | Methionine aminopeptidase | 0.00e+00 | 2.62e-64 | 4.74e-76 | 0.9879 |
| 1. PBF | P99121 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9526 |
| 1. PBF | B0CRL4 | Methionine aminopeptidase 2 | 1.11e-16 | 8.50e-06 | 1.26e-06 | 0.8196 |
| 1. PBF | Q89AP3 | Methionine aminopeptidase | 0.00e+00 | 3.22e-34 | 8.13e-60 | 0.9637 |
| 1. PBF | P0A1X7 | Methionine aminopeptidase | 0.00e+00 | 8.01e-37 | 2.36e-65 | 0.9642 |
| 1. PBF | P0AE21 | Methionine aminopeptidase | 0.00e+00 | 2.05e-35 | 8.24e-62 | 0.9657 |
| 1. PBF | Q5HN46 | Methionine aminopeptidase | 0.00e+00 | 8.21e-36 | 1.50e-44 | 0.9521 |
| 1. PBF | P0A5J3 | Methionine aminopeptidase | 0.00e+00 | 3.91e-21 | 8.16e-54 | 0.9741 |
| 1. PBF | O34484 | Methionine aminopeptidase 2 | 0.00e+00 | 8.49e-43 | 1.39e-40 | 0.9504 |
| 1. PBF | O52353 | Methionine aminopeptidase | 0.00e+00 | 1.43e-59 | 3.86e-38 | 0.9302 |
| 1. PBF | P0AE20 | Methionine aminopeptidase | 0.00e+00 | 2.05e-35 | 8.24e-62 | 0.9656 |
| 1. PBF | P0AE19 | Methionine aminopeptidase | 0.00e+00 | 2.05e-35 | 8.24e-62 | 0.9655 |
| 1. PBF | Q11132 | Methionine aminopeptidase | 0.00e+00 | 2.51e-55 | 1.52e-42 | 0.9561 |
| 1. PBF | P19994 | Methionine aminopeptidase 1 | 0.00e+00 | 1.57e-62 | 3.82e-77 | 0.9895 |
| 1. PBF | Q9Z9J4 | Methionine aminopeptidase | 0.00e+00 | 2.01e-59 | 1.78e-74 | 0.9841 |
| 1. PBF | P69000 | Methionine aminopeptidase | 0.00e+00 | 7.61e-66 | 3.86e-72 | 0.9807 |
| 1. PBF | Q9ZJT0 | Methionine aminopeptidase | 0.00e+00 | 3.50e-53 | 6.28e-56 | 0.9649 |
| 1. PBF | P0A080 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9527 |
| 1. PBF | P0A1X6 | Methionine aminopeptidase | 0.00e+00 | 8.01e-37 | 2.36e-65 | 0.9643 |
| 1. PBF | Q9PL68 | Methionine aminopeptidase | 0.00e+00 | 4.99e-14 | 1.58e-42 | 0.9607 |
| 1. PBF | P56102 | Methionine aminopeptidase | 0.00e+00 | 7.23e-52 | 7.52e-57 | 0.968 |
| 1. PBF | P53580 | Methionine aminopeptidase B | 0.00e+00 | 2.83e-32 | 6.65e-58 | 0.9738 |
| 1. PBF | O51132 | Methionine aminopeptidase | 0.00e+00 | 8.88e-60 | 7.26e-60 | 0.965 |
| 1. PBF | Q5HEN6 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9527 |
| 1. PBF | Q8K9T1 | Methionine aminopeptidase | 0.00e+00 | 3.62e-40 | 1.66e-66 | 0.9637 |
| 1. PBF | P0A079 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9527 |
| 1. PBF | Q5JGD1 | Methionine aminopeptidase | 0.00e+00 | 3.50e-02 | 2.28e-10 | 0.8524 |
| 1. PBF | P53579 | Methionine aminopeptidase A | 0.00e+00 | 1.48e-43 | 3.37e-66 | 0.9756 |
| 1. PBF | Q8CRU9 | Methionine aminopeptidase | 0.00e+00 | 5.08e-36 | 1.08e-44 | 0.9522 |
| 1. PBF | O83814 | Methionine aminopeptidase | 0.00e+00 | 9.43e-59 | 4.28e-56 | 0.9572 |
| 1. PBF | P57324 | Methionine aminopeptidase | 0.00e+00 | 3.67e-38 | 4.02e-59 | 0.9633 |
| 1. PBF | P53581 | Methionine aminopeptidase C | 0.00e+00 | 9.21e-13 | 9.21e-59 | 0.9651 |
| 1. PBF | Q6GFG9 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9524 |
| 1. PBF | P9WK20 | Methionine aminopeptidase 1 | 0.00e+00 | 4.53e-45 | 9.49e-56 | 0.9557 |
| 1. PBF | Q9ZCD3 | Methionine aminopeptidase | 0.00e+00 | 1.61e-33 | 4.81e-63 | 0.9742 |
| 1. PBF | O28438 | Methionine aminopeptidase | 0.00e+00 | 1.15e-04 | 3.08e-16 | 0.8715 |
| 1. PBF | O66489 | Methionine aminopeptidase | 0.00e+00 | 1.31e-49 | 1.16e-56 | 0.9532 |
| 1. PBF | P0A078 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9527 |
| 1. PBF | P47418 | Methionine aminopeptidase | 0.00e+00 | 4.98e-62 | 4.40e-42 | 0.9268 |
| 1. PBF | O84859 | Methionine aminopeptidase | 0.00e+00 | 6.89e-14 | 5.30e-44 | 0.9616 |
| 1. PBF | P9WK18 | Methionine aminopeptidase 2 | 0.00e+00 | 3.91e-21 | 8.16e-54 | 0.9741 |
| 1. PBF | Q6G846 | Methionine aminopeptidase | 0.00e+00 | 1.42e-45 | 8.39e-51 | 0.9522 |
| 1. PBF | P44421 | Methionine aminopeptidase | 0.00e+00 | 1.48e-29 | 3.88e-53 | 0.9615 |
| 2. PF | Q6XMH7 | Methionine aminopeptidase 2 | 1.74e-14 | 4.37e-04 | NA | 0.753 |
| 2. PF | Q6XMH6 | Methionine aminopeptidase 2 | 1.55e-14 | 4.53e-05 | NA | 0.7452 |
| 2. PF | Q8SR45 | Methionine aminopeptidase 2 | 7.55e-15 | 4.40e-05 | NA | 0.7555 |
| 3. BF | Q2FG30 | Uncharacterized peptidase SAUSA300_1654 | 1.11e-16 | NA | 5.41e-14 | 0.7898 |
| 3. BF | Q4L749 | Uncharacterized peptidase SH1217 | 0.00e+00 | NA | 2.11e-08 | 0.7882 |
| 3. BF | P95963 | Methionine aminopeptidase | 0.00e+00 | NA | 1.60e-14 | 0.8604 |
| 3. BF | D4DE65 | Methionine aminopeptidase 2 | 5.33e-15 | NA | 1.76e-06 | 0.8385 |
| 3. BF | Q99TF5 | Uncharacterized peptidase SAV1708 | 1.11e-16 | NA | 4.50e-14 | 0.7896 |
| 3. BF | Q2U6H2 | Methionine aminopeptidase 2 | 1.08e-14 | NA | 2.81e-06 | 0.829 |
| 3. BF | Q4WAY7 | Methionine aminopeptidase 2-1 | 2.33e-15 | NA | 0.002 | 0.8345 |
| 3. BF | D1ZEN1 | Methionine aminopeptidase 2 | 5.44e-15 | NA | 3.58e-07 | 0.7963 |
| 3. BF | Q9UYT4 | Methionine aminopeptidase | 0.00e+00 | NA | 1.30e-13 | 0.8551 |
| 3. BF | D4B2G3 | Methionine aminopeptidase 2 | 6.44e-15 | NA | 1.32e-06 | 0.8007 |
| 3. BF | C0SIM8 | Methionine aminopeptidase 2 | 1.21e-14 | NA | 3.61e-04 | 0.8285 |
| 3. BF | Q2GYA8 | Methionine aminopeptidase 2-2 | 1.89e-15 | NA | 2.31e-06 | 0.8119 |
| 3. BF | B2VW14 | Methionine aminopeptidase 2-1 | 1.17e-14 | NA | 5.29e-06 | 0.823 |
| 3. BF | B8M990 | Methionine aminopeptidase 2-2 | 1.11e-15 | NA | 5.32e-08 | 0.8481 |
| 3. BF | B8NLL0 | Methionine aminopeptidase 2-2 | 8.77e-15 | NA | 2.81e-06 | 0.8486 |
| 3. BF | B6QD96 | Methionine aminopeptidase 2-2 | 2.66e-15 | NA | 6.62e-07 | 0.844 |
| 3. BF | C5JYZ5 | Methionine aminopeptidase 2-2 | 1.67e-15 | NA | 1.12e-06 | 0.8096 |
| 3. BF | C5P8Q4 | Methionine aminopeptidase 2 | 9.10e-15 | NA | 5.58e-05 | 0.7935 |
| 3. BF | P38487 | Creatinase | 9.89e-13 | NA | 0.009 | 0.7161 |
| 3. BF | C5M8M4 | Methionine aminopeptidase 2 | 2.78e-15 | NA | 5.73e-05 | 0.8349 |
| 3. BF | E5R3Z8 | Methionine aminopeptidase 2-2 | 7.33e-15 | NA | 1.66e-06 | 0.8004 |
| 3. BF | P81535 | Xaa-Pro dipeptidase | 0.00e+00 | NA | 5.08e-22 | 0.8131 |
| 3. BF | O58362 | Methionine aminopeptidase | 0.00e+00 | NA | 2.83e-14 | 0.8536 |
| 3. BF | Q4WNT9 | Methionine aminopeptidase 2-3 | 2.00e-14 | NA | 9.85e-08 | 0.8162 |
| 3. BF | B0Y5N4 | Methionine aminopeptidase 2-2 | 2.14e-14 | NA | 9.85e-08 | 0.811 |
| 3. BF | E3L3Q8 | Methionine aminopeptidase 2 | 2.43e-13 | NA | 1.57e-04 | 0.8419 |
| 3. BF | Q0C838 | Methionine aminopeptidase 2-1 | 1.47e-13 | NA | 0.023 | 0.7763 |
| 3. BF | C1HAB2 | Methionine aminopeptidase 2 | 1.37e-14 | NA | 3.38e-04 | 0.7975 |
| 3. BF | A8QBZ2 | Methionine aminopeptidase 2 | 4.10e-14 | NA | 2.19e-13 | 0.8409 |
| 3. BF | M1CZC0 | ERBB-3 BINDING PROTEIN 1 | 0.00e+00 | NA | 3.98e-10 | 0.8368 |
| 3. BF | B2W1N6 | Methionine aminopeptidase 2-2 | 1.88e-14 | NA | 8.73e-04 | 0.7915 |
| 3. BF | Q2YTD2 | Uncharacterized peptidase SAB1567 | 1.11e-16 | NA | 9.38e-15 | 0.7897 |
| 3. BF | P56218 | Methionine aminopeptidase | 0.00e+00 | NA | 9.55e-15 | 0.8517 |
| 3. BF | A2QHX0 | Methionine aminopeptidase 2-2 | 3.55e-15 | NA | 4.29e-08 | 0.8113 |
| 3. BF | B3LNM2 | Methionine aminopeptidase 2 | 8.57e-12 | NA | 0.021 | 0.8453 |
| 3. BF | E3RD74 | Methionine aminopeptidase 2-2 | 1.44e-15 | NA | 2.36e-05 | 0.823 |
| 3. BF | B6YTG0 | Methionine aminopeptidase | 0.00e+00 | NA | 1.11e-13 | 0.8561 |
| 3. BF | Q0CL94 | Methionine aminopeptidase 2-2 | 9.33e-15 | NA | 1.11e-07 | 0.8218 |
| 3. BF | C5JW60 | Methionine aminopeptidase 2-1 | 1.10e-14 | NA | 0.002 | 0.8228 |
| 3. BF | C7YS77 | Methionine aminopeptidase 2-1 | 4.00e-15 | NA | 6.99e-07 | 0.8347 |
| 3. BF | Q8CNW9 | Uncharacterized peptidase SE_1383 | 1.11e-16 | NA | 1.25e-15 | 0.7908 |
| 3. BF | C4Y1F8 | Methionine aminopeptidase 2 | 3.55e-15 | NA | 1.34e-06 | 0.829 |
| 3. BF | P75313 | Putative Xaa-Pro aminopeptidase | 0.00e+00 | NA | 2.07e-08 | 0.7948 |
| 3. BF | C4YSA9 | Methionine aminopeptidase 2 | 3.55e-15 | NA | 1.94e-06 | 0.8379 |
| 3. BF | P47566 | Putative Xaa-Pro aminopeptidase | 0.00e+00 | NA | 1.86e-06 | 0.7905 |
| 3. BF | B9WJA2 | Methionine aminopeptidase 2 | 3.89e-15 | NA | 1.75e-05 | 0.8231 |
| 3. BF | C5DE35 | Methionine aminopeptidase 2 | 8.88e-16 | NA | 4.26e-05 | 0.8446 |
| 3. BF | Q5HF67 | Uncharacterized peptidase SACOL1756 | 1.11e-16 | NA | 5.41e-14 | 0.7899 |
| 3. BF | C4R2P3 | Methionine aminopeptidase 2 | 6.22e-15 | NA | 1.41e-06 | 0.8331 |
| 3. BF | A1DA84 | Methionine aminopeptidase 2-3 | 2.00e-15 | NA | 0.002 | 0.7749 |
| 3. BF | C0NIQ4 | Methionine aminopeptidase 2-1 | 1.32e-14 | NA | 5.10e-04 | 0.8044 |
| 3. BF | C1GLM4 | Methionine aminopeptidase 2 | 1.45e-14 | NA | 4.65e-04 | 0.8245 |
| 3. BF | E5R4J3 | Methionine aminopeptidase 2-2 | 1.01e-14 | NA | 7.69e-04 | 0.7795 |
| 3. BF | C7GSF3 | Methionine aminopeptidase 2 | 1.78e-15 | NA | 0.021 | 0.8454 |
| 3. BF | Q5BGG1 | Methionine aminopeptidase 2-2 | 6.00e-15 | NA | 1.32e-06 | 0.801 |
| 3. BF | Q6CA79 | Methionine aminopeptidase 2 | 1.44e-14 | NA | 2.37e-05 | 0.8141 |
| 3. BF | E4ZYY3 | Methionine aminopeptidase 2-1 | 1.22e-15 | NA | 2.12e-08 | 0.8268 |
| 3. BF | A5E5I9 | Methionine aminopeptidase 2 | 1.60e-14 | NA | 2.80e-05 | 0.8344 |
| 3. BF | B8NA06 | Methionine aminopeptidase 2-1 | 6.66e-15 | NA | 9.39e-08 | 0.8107 |
| 3. BF | O58885 | Xaa-Pro dipeptidase | 0.00e+00 | NA | 6.20e-24 | 0.7961 |
| 3. BF | Q2GSJ7 | Methionine aminopeptidase 2-1 | 1.89e-15 | NA | 2.66e-08 | 0.8134 |
| 3. BF | C5GLJ6 | Methionine aminopeptidase 2-2 | 1.44e-15 | NA | 1.02e-06 | 0.8058 |
| 3. BF | O25681 | Aminopeptidase HP_1037 | 2.62e-13 | NA | 3.46e-06 | 0.6995 |
| 3. BF | A1CH02 | Methionine aminopeptidase 2-2 | 3.11e-15 | NA | 6.48e-08 | 0.7759 |
| 3. BF | A1CXT5 | Methionine aminopeptidase 2-1 | 6.11e-15 | NA | 5.06e-08 | 0.8142 |
| 3. BF | Q5R9W8 | Xaa-Pro aminopeptidase 3 | 3.70e-11 | NA | 3.13e-07 | 0.7177 |
| 3. BF | C8Z3V4 | Methionine aminopeptidase 2 | 1.89e-15 | NA | 0.021 | 0.8271 |
| 3. BF | C9SB49 | Methionine aminopeptidase 2 | 1.89e-15 | NA | 3.98e-06 | 0.8029 |
| 3. BF | A5DR89 | Methionine aminopeptidase 2 | 8.88e-15 | NA | 4.28e-07 | 0.8352 |
| 3. BF | Q5ZIM5 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 7.62e-46 | 0.9728 |
| 3. BF | P65811 | Probable dipeptidase PepE | 5.00e-15 | NA | 2.45e-07 | 0.7614 |
| 3. BF | Q2HA12 | Probable Xaa-Pro aminopeptidase CHGG_02942 | 4.27e-08 | NA | 0.009 | 0.7507 |
| 3. BF | B6Q1N3 | Methionine aminopeptidase 2-1 | 7.11e-15 | NA | 4.82e-07 | 0.838 |
| 3. BF | D8PR70 | Methionine aminopeptidase 2 | 1.89e-15 | NA | 1.53e-07 | 0.8192 |
| 3. BF | Q5B4X6 | Methionine aminopeptidase 2-1 | 2.36e-14 | NA | 5.62e-06 | 0.8214 |
| 3. BF | A6RGC8 | Methionine aminopeptidase 2 | 1.44e-15 | NA | 1.97e-07 | 0.8085 |
| 3. BF | Q4WII3 | Methionine aminopeptidase 2-2 | 2.73e-14 | NA | 1.27e-10 | 0.8417 |
| 3. BF | E3RCY7 | Methionine aminopeptidase 2-1 | 1.19e-14 | NA | 5.36e-04 | 0.7949 |
| 3. BF | Q49YD7 | Uncharacterized peptidase SSP1059 | 1.11e-16 | NA | 1.69e-12 | 0.7717 |
| 3. BF | A6RTU0 | Methionine aminopeptidase 2 | 4.88e-15 | NA | 0.009 | 0.835 |
| 3. BF | P46545 | Xaa-Pro dipeptidase | 0.00e+00 | NA | 1.02e-07 | 0.7605 |
| 3. BF | A6ZKL2 | Methionine aminopeptidase 2 | 1.89e-15 | NA | 0.021 | 0.8271 |
| 3. BF | Q7ZWV9 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 4.68e-46 | 0.9728 |
| 3. BF | B8LUH2 | Methionine aminopeptidase 2-1 | 9.10e-15 | NA | 3.53e-07 | 0.8304 |
| 3. BF | A7EZ86 | Methionine aminopeptidase 2 | 4.11e-15 | NA | 0.002 | 0.8214 |
| 3. BF | Q7S7L7 | Methionine aminopeptidase 2 | 3.00e-15 | NA | 5.36e-07 | 0.7992 |
| 3. BF | E3QW41 | Methionine aminopeptidase 2-2 | 2.33e-15 | NA | 2.78e-06 | 0.8054 |
| 3. BF | B2B738 | Methionine aminopeptidase 2 | 1.44e-15 | NA | 0.003 | 0.8085 |
| 3. BF | O84913 | Xaa-Pro dipeptidase | 0.00e+00 | NA | 3.73e-06 | 0.7616 |
| 3. BF | P22624 | Methionine aminopeptidase (Fragment) | 0.00e+00 | NA | 1.02e-10 | 0.8649 |
| 3. BF | A1CCP2 | Methionine aminopeptidase 2-1 | 2.44e-14 | NA | 7.46e-09 | 0.842 |
| 3. BF | Q6G8L9 | Uncharacterized peptidase SAS1635 | 1.11e-16 | NA | 4.50e-14 | 0.7881 |
| 3. BF | B6HTQ4 | Methionine aminopeptidase 2-2 | 6.66e-16 | NA | 1.57e-06 | 0.816 |
| 3. BF | E3QDQ4 | Methionine aminopeptidase 2-1 | 1.07e-14 | NA | 5.77e-09 | 0.7616 |
| 3. BF | Q9S6S1 | Xaa-Pro dipeptidase | 0.00e+00 | NA | 9.86e-08 | 0.7604 |
| 3. BF | Q6CP80 | Methionine aminopeptidase 2 | 5.55e-16 | NA | 4.57e-05 | 0.8205 |
| 3. BF | P44881 | Xaa-Pro aminopeptidase | 5.56e-12 | NA | 6.27e-06 | 0.7427 |
| 3. BF | Q5I0A0 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 1.50e-46 | 0.9724 |
| 3. BF | Q5HNJ7 | Uncharacterized peptidase SERP1271 | 1.11e-16 | NA | 1.25e-15 | 0.7913 |
| 3. BF | C0NX86 | Methionine aminopeptidase 2-2 | 1.89e-15 | NA | 4.99e-07 | 0.838 |
| 3. BF | C4JSX6 | Methionine aminopeptidase 2 | 8.10e-15 | NA | 1.57e-05 | 0.7962 |
| 3. BF | C6HI66 | Methionine aminopeptidase 2 | 3.33e-16 | NA | 1.22e-07 | 0.8106 |
| 3. BF | E5R278 | Methionine aminopeptidase 2-1 | 7.44e-15 | NA | 2.68e-06 | 0.8344 |
| 3. BF | Q6BVB8 | Methionine aminopeptidase 2 | 2.00e-15 | NA | 1.28e-06 | 0.8311 |
| 3. BF | B0XTJ7 | Methionine aminopeptidase 2-1 | 2.81e-14 | NA | 1.27e-10 | 0.8422 |
| 3. BF | B0YAX5 | Methionine aminopeptidase 2-3 | 2.44e-15 | NA | 0.002 | 0.7731 |
| 3. BF | A2QAF9 | Methionine aminopeptidase 2-1 | 3.18e-08 | NA | 1.92e-06 | 0.8309 |
| 3. BF | A1CYM1 | Methionine aminopeptidase 2-2 | 1.09e-14 | NA | 1.14e-10 | 0.842 |
| 3. BF | P9WHS6 | Probable dipeptidase PepE | 5.11e-15 | NA | 2.45e-07 | 0.7612 |
| 3. BF | Q0UTI9 | Methionine aminopeptidase 2 | 6.88e-15 | NA | 4.66e-05 | 0.7635 |
| 3. BF | A4RDI6 | Methionine aminopeptidase 2 | 2.11e-15 | NA | 1.29e-04 | 0.791 |
| 3. BF | B6H5L5 | Methionine aminopeptidase 2-1 | 9.99e-15 | NA | 1.27e-04 | 0.8235 |
| 3. BF | O27355 | Methionine aminopeptidase | 0.00e+00 | NA | 2.11e-13 | 0.8755 |
| 3. BF | Q8NW55 | Uncharacterized peptidase MW1651 | 1.11e-16 | NA | 6.01e-14 | 0.7899 |
| 3. BF | C7Z7V7 | Methionine aminopeptidase 2-2 | 1.13e-12 | NA | 2.73e-04 | 0.747 |
| 3. BF | Q7A552 | Uncharacterized peptidase SA1530 | 1.11e-16 | NA | 4.50e-14 | 0.7896 |
| 3. BF | B5VDQ0 | Methionine aminopeptidase 2 | 2.00e-15 | NA | 0.021 | 0.8272 |
| 3. BF | C5FF46 | Methionine aminopeptidase 2-2 | 6.55e-15 | NA | 1.94e-06 | 0.8007 |
| 3. BF | P54518 | Uncharacterized peptidase YqhT | 0.00e+00 | NA | 7.04e-18 | 0.7799 |
| 3. BF | C5GCN0 | Methionine aminopeptidase 2-1 | 1.08e-14 | NA | 0.002 | 0.7919 |
| 3. BF | O31689 | Putative dipeptidase YkvY | 0.00e+00 | NA | 2.68e-11 | 0.7779 |
| 3. BF | Q6GFZ9 | Uncharacterized peptidase SAR1786 | 1.11e-16 | NA | 2.94e-13 | 0.7895 |
| 3. BF | Q5RBF3 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 6.54e-48 | 0.9732 |
| 3. BF | A6QLA4 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 1.20e-46 | 0.9732 |
| 4. PB | P9WK21 | Methionine aminopeptidase 1 | 0.00e+00 | 4.53e-45 | 9.49e-56 | NA |
| 4. PB | Q9CPW9 | Methionine aminopeptidase 1D, mitochondrial | 0.00e+00 | 3.11e-03 | 1.05e-40 | NA |
| 4. PB | P0AE18 | Methionine aminopeptidase | 0.00e+00 | 2.05e-35 | 8.24e-62 | NA |
| 4. PB | Q4VBS4 | Methionine aminopeptidase 1D, mitochondrial | 0.00e+00 | 5.28e-03 | 7.02e-48 | NA |
| 4. PB | Q6UB28 | Methionine aminopeptidase 1D, mitochondrial | 0.00e+00 | 9.81e-03 | 2.28e-43 | NA |
| 4. PB | P9WK19 | Methionine aminopeptidase 2 | 0.00e+00 | 3.91e-21 | 8.16e-54 | NA |
| 6. F | Q0U6G5 | Probable Xaa-Pro aminopeptidase PEPP | 1.00e-10 | NA | NA | 0.7375 |
| 6. F | A1TXT7 | Xaa-Pro dipeptidase | 4.86e-10 | NA | NA | 0.7171 |
| 6. F | B4SZ86 | Xaa-Pro dipeptidase | 3.94e-10 | NA | NA | 0.6738 |
| 6. F | B8M0Z4 | Probable Xaa-Pro aminopeptidase pepP | 6.91e-11 | NA | NA | 0.73 |
| 6. F | A1RDW7 | Xaa-Pro dipeptidase | 3.43e-10 | NA | NA | 0.7184 |
| 6. F | C5FUV0 | Probable Xaa-Pro aminopeptidase MCYG_06503 | 1.69e-05 | NA | NA | 0.6393 |
| 6. F | A6TGM5 | Xaa-Pro dipeptidase | 4.22e-10 | NA | NA | 0.6799 |
| 6. F | A1S1I9 | Xaa-Pro dipeptidase | 2.89e-10 | NA | NA | 0.696 |
| 6. F | Q31UE2 | Xaa-Pro dipeptidase | 2.95e-10 | NA | NA | 0.6812 |
| 6. F | A2QAW7 | Probable Xaa-Pro aminopeptidase An01g13040 | 1.19e-10 | NA | NA | 0.728 |
| 6. F | Q2UQH9 | Probable Xaa-Pro aminopeptidase AO090005001240 | 2.06e-10 | NA | NA | 0.6921 |
| 6. F | A1DG66 | Probable Xaa-Pro aminopeptidase pepP | 1.17e-10 | NA | NA | 0.7489 |
| 6. F | Q4HYB8 | FACT complex subunit SPT16 | 1.19e-05 | NA | NA | 0.7056 |
| 6. F | Q1C2C5 | Xaa-Pro dipeptidase | 4.61e-10 | NA | NA | 0.644 |
| 6. F | Q2P6N8 | Xaa-Pro dipeptidase | 5.04e-10 | NA | NA | 0.711 |
| 6. F | B2VUU7 | Probable Xaa-Pro aminopeptidase P | 1.18e-08 | NA | NA | 0.6674 |
| 6. F | Q4WJ02 | FACT complex subunit spt16 | 9.34e-06 | NA | NA | 0.6785 |
| 6. F | C1H9Q9 | Probable Xaa-Pro aminopeptidase PEPP | 7.59e-11 | NA | NA | 0.7216 |
| 6. F | Q756A7 | FACT complex subunit SPT16 | 1.16e-05 | NA | NA | 0.7084 |
| 6. F | A6QYF6 | Probable Xaa-Pro aminopeptidase HCAG_02413 | 2.35e-10 | NA | NA | 0.7391 |
| 6. F | E9CY14 | Probable Xaa-Pro aminopeptidase CPSG_02684 | 1.65e-10 | NA | NA | 0.7254 |
| 6. F | E1V7W1 | Ectoine hydrolase | 1.11e-16 | NA | NA | 0.6994 |
| 6. F | B0DZL3 | Probable Xaa-Pro aminopeptidase P | 3.56e-08 | NA | NA | 0.6652 |
| 6. F | B1JP62 | Xaa-Pro dipeptidase | 5.01e-10 | NA | NA | 0.6785 |
| 6. F | C0Q3F4 | Xaa-Pro dipeptidase | 2.92e-10 | NA | NA | 0.6889 |
| 6. F | Q2H8T2 | Probable Xaa-Pro aminopeptidase P | 5.17e-08 | NA | NA | 0.6726 |
| 6. F | B2FT23 | Xaa-Pro dipeptidase | 4.78e-10 | NA | NA | 0.6832 |
| 6. F | A8FP64 | Xaa-Pro dipeptidase | 3.31e-10 | NA | NA | 0.6978 |
| 6. F | Q6FWT4 | FACT complex subunit SPT16 | 9.71e-06 | NA | NA | 0.7067 |
| 6. F | B8E3R4 | Xaa-Pro dipeptidase | 3.59e-10 | NA | NA | 0.7092 |
| 6. F | Q7MZ93 | Xaa-Pro dipeptidase | 3.12e-10 | NA | NA | 0.6934 |
| 6. F | E9E2J4 | Probable Xaa-Pro aminopeptidase MAC_04092 | 7.84e-10 | NA | NA | 0.736 |
| 6. F | A1DF27 | Probable Xaa-Pro aminopeptidase P | 5.74e-08 | NA | NA | 0.6855 |
| 6. F | A6R035 | Probable Xaa-Pro aminopeptidase P | 2.33e-08 | NA | NA | 0.675 |
| 6. F | Q00976 | FACT complex subunit SPT16 | 1.59e-05 | NA | NA | 0.6535 |
| 6. F | B8M9W2 | Probable Xaa-Pro aminopeptidase P | 6.75e-08 | NA | NA | 0.6676 |
| 6. F | Q0CFZ0 | Probable Xaa-Pro aminopeptidase pepP | 1.77e-10 | NA | NA | 0.7492 |
| 6. F | B5RFL5 | Xaa-Pro dipeptidase | 3.99e-10 | NA | NA | 0.6765 |
| 6. F | Q32A22 | Xaa-Pro dipeptidase | 2.84e-10 | NA | NA | 0.6888 |
| 6. F | B7L9A5 | Xaa-Pro dipeptidase | 4.12e-10 | NA | NA | 0.6915 |
| 6. F | Q6DAP4 | Xaa-Pro dipeptidase | 4.89e-10 | NA | NA | 0.7035 |
| 6. F | A8G8D3 | Xaa-Pro dipeptidase | 3.85e-10 | NA | NA | 0.6616 |
| 6. F | B0Y3V7 | Probable Xaa-Pro aminopeptidase P | 5.76e-08 | NA | NA | 0.6865 |
| 6. F | B7UNH5 | Xaa-Pro dipeptidase | 2.89e-10 | NA | NA | 0.6519 |
| 6. F | B1LM33 | Xaa-Pro dipeptidase | 2.86e-10 | NA | NA | 0.6738 |
| 6. F | A2QKF6 | Probable Xaa-Pro aminopeptidase pepP | 1.37e-10 | NA | NA | 0.7482 |
| 6. F | A7ZU52 | Xaa-Pro dipeptidase | 3.62e-10 | NA | NA | 0.6872 |
| 6. F | E3QYP0 | Probable Xaa-Pro aminopeptidase PEPP | 4.24e-11 | NA | NA | 0.7513 |
| 6. F | B8NC10 | Probable Xaa-Pro aminopeptidase pepP | 1.24e-10 | NA | NA | 0.7484 |
| 6. F | A6SL16 | Probable Xaa-Pro aminopeptidase BC1G_13431 | 5.12e-10 | NA | NA | 0.7214 |
| 6. F | B2WKR4 | Probable Xaa-Pro aminopeptidase PTRG_10574 | 1.71e-08 | NA | NA | 0.7438 |
| 6. F | P55667 | Uncharacterized hydrolase/peptidase y4tM | 1.11e-16 | NA | NA | 0.7035 |
| 6. F | C5G874 | Probable Xaa-Pro aminopeptidase PEPP | 9.40e-11 | NA | NA | 0.7497 |
| 6. F | B7MHD2 | Xaa-Pro dipeptidase | 2.84e-10 | NA | NA | 0.6521 |
| 6. F | C5PAH2 | Probable Xaa-Pro aminopeptidase CPC735_009100 | 1.12e-10 | NA | NA | 0.7195 |
| 6. F | B0XN37 | Probable Xaa-Pro aminopeptidase AFUB_014460 | 1.02e-10 | NA | NA | 0.7175 |
| 6. F | B0XW47 | Probable Xaa-Pro aminopeptidase pepP | 1.26e-10 | NA | NA | 0.7515 |
| 6. F | Q1JPJ2 | Xaa-Pro aminopeptidase 1 | 7.86e-09 | NA | NA | 0.6672 |
| 6. F | C6HSY3 | Probable Xaa-Pro aminopeptidase P | 5.17e-08 | NA | NA | 0.6386 |
| 6. F | E3Q897 | Probable Xaa-Pro aminopeptidase GLRG_02280 | 1.84e-09 | NA | NA | 0.7308 |
| 6. F | B5YY94 | Xaa-Pro dipeptidase | 2.83e-10 | NA | NA | 0.6889 |
| 6. F | E9EUE6 | Probable Xaa-Pro aminopeptidase P | 2.45e-08 | NA | NA | 0.6824 |
| 6. F | Q5H3T0 | Xaa-Pro dipeptidase | 6.08e-10 | NA | NA | 0.6643 |
| 6. F | C1GEY4 | Probable Xaa-Pro aminopeptidase P | 2.01e-08 | NA | NA | 0.6599 |
| 6. F | Q8FBI1 | Xaa-Pro dipeptidase | 2.84e-10 | NA | NA | 0.6889 |
| 6. F | P0A3Z4 | Xaa-Pro aminopeptidase 2 | 1.34e-10 | NA | NA | 0.7154 |
| 6. F | Q2UBF1 | FACT complex subunit spt16 | 8.12e-06 | NA | NA | 0.6978 |
| 6. F | P0A3Z3 | Xaa-Pro aminopeptidase 2 | 1.72e-10 | NA | NA | 0.6929 |
| 6. F | C5K0R2 | Probable Xaa-Pro aminopeptidase BDBG_08406 | 2.24e-10 | NA | NA | 0.7478 |
| 6. F | B5EZW1 | Xaa-Pro dipeptidase | 2.94e-10 | NA | NA | 0.6767 |
| 6. F | C5BCB6 | Xaa-Pro dipeptidase | 3.40e-10 | NA | NA | 0.6916 |
| 6. F | Q8PH57 | Xaa-Pro dipeptidase | 5.96e-10 | NA | NA | 0.6582 |
| 6. F | Q7RYL6 | Probable Xaa-Pro aminopeptidase P | 7.40e-08 | NA | NA | 0.6471 |
| 6. F | Q8X8I1 | Xaa-Pro dipeptidase | 2.80e-10 | NA | NA | 0.6741 |
| 6. F | B6H2M0 | Probable Xaa-Pro aminopeptidase pepP | 1.47e-10 | NA | NA | 0.7432 |
| 6. F | A7FDF3 | Xaa-Pro dipeptidase | 5.15e-10 | NA | NA | 0.6468 |
| 6. F | A4RQ11 | Probable Xaa-Pro aminopeptidase MGG_05684 | 1.04e-09 | NA | NA | 0.7517 |
| 6. F | Q5QVP2 | Xaa-Pro dipeptidase 2 | 4.66e-10 | NA | NA | 0.6397 |
| 6. F | Q8P5S9 | Xaa-Pro dipeptidase | 5.78e-10 | NA | NA | 0.6868 |
| 6. F | Q6BXE5 | FACT complex subunit SPT16 | 1.12e-05 | NA | NA | 0.6444 |
| 6. F | Q6C931 | FACT complex subunit SPT16 | 6.33e-06 | NA | NA | 0.7122 |
| 6. F | D5GHP2 | Probable Xaa-Pro aminopeptidase GSTUM_00008071001 | 5.96e-11 | NA | NA | 0.7135 |
| 6. F | Q3YVC0 | Xaa-Pro dipeptidase | 2.84e-10 | NA | NA | 0.6887 |
| 6. F | A3Q8U5 | Xaa-Pro dipeptidase | 2.71e-10 | NA | NA | 0.6885 |
| 6. F | Q0I0T2 | Xaa-Pro dipeptidase | 2.77e-10 | NA | NA | 0.7206 |
| 6. F | E9DV56 | Probable Xaa-Pro aminopeptidase pepP | 1.83e-10 | NA | NA | 0.6979 |
| 6. F | Q57HM5 | Xaa-Pro dipeptidase | 2.86e-10 | NA | NA | 0.6919 |
| 6. F | C5FEJ1 | Methionine aminopeptidase 2-1 | 2.78e-15 | NA | NA | 0.8408 |
| 6. F | Q166H0 | Dimethylsulfonioproprionate lyase DddP | 3.50e-11 | NA | NA | 0.6995 |
| 6. F | C6DI64 | Xaa-Pro dipeptidase | 4.47e-10 | NA | NA | 0.6721 |
| 6. F | Q08A38 | Xaa-Pro dipeptidase | 3.03e-10 | NA | NA | 0.7154 |
| 6. F | C9SR45 | Probable Xaa-Pro aminopeptidase P | 1.66e-08 | NA | NA | 0.7047 |
| 6. F | Q5QXH5 | Xaa-Pro dipeptidase 1 | 6.57e-10 | NA | NA | 0.6963 |
| 6. F | A9R755 | Xaa-Pro dipeptidase | 4.56e-10 | NA | NA | 0.6497 |
| 6. F | Q96WX8 | Probable Xaa-Pro aminopeptidase pepP | 9.73e-11 | NA | NA | 0.7473 |
| 6. F | C4JF09 | Probable Xaa-Pro aminopeptidase PEPP | 1.58e-10 | NA | NA | 0.7155 |
| 6. F | Q9W603 | FACT complex subunit SPT16 | 7.94e-06 | NA | NA | 0.7296 |
| 6. F | D1ZQL9 | Probable Xaa-Pro aminopeptidase SMAC_04549 | 5.99e-11 | NA | NA | 0.7591 |
| 6. F | E3RNJ5 | Probable Xaa-Pro aminopeptidase PTT_10145 | 1.01e-06 | NA | NA | 0.7466 |
| 6. F | P0CQ22 | FACT complex subunit SPT16 | 8.39e-06 | NA | NA | 0.7132 |
| 6. F | C0SHQ0 | Probable Xaa-Pro aminopeptidase PEPP | 7.23e-11 | NA | NA | 0.7463 |
| 6. F | C1H3X3 | Probable Xaa-Pro aminopeptidase PAAG_05466 | 2.30e-10 | NA | NA | 0.701 |
| 6. F | B0TLC0 | Xaa-Pro dipeptidase | 2.93e-10 | NA | NA | 0.6774 |
| 6. F | A2QGR5 | Probable Xaa-Pro aminopeptidase P | 2.12e-08 | NA | NA | 0.6644 |
| 6. F | E4V1Q7 | Probable Xaa-Pro aminopeptidase MGYG_06974 | 1.97e-10 | NA | NA | 0.7381 |
| 6. F | B0RP90 | Xaa-Pro dipeptidase | 5.64e-10 | NA | NA | 0.6953 |
| 6. F | B1IW60 | Xaa-Pro dipeptidase | 3.77e-10 | NA | NA | 0.687 |
| 6. F | Q44238 | Xaa-Pro dipeptidase | 2.03e-09 | NA | NA | 0.6954 |
| 6. F | Q2U7S5 | Probable Xaa-Pro aminopeptidase P | 4.45e-08 | NA | NA | 0.6656 |
| 6. F | B4TNZ2 | Xaa-Pro dipeptidase | 2.90e-10 | NA | NA | 0.6973 |
| 6. F | E9CTR7 | Probable Xaa-Pro aminopeptidase P | 2.10e-08 | NA | NA | 0.667 |
| 6. F | P55666 | Uncharacterized hydrolase/peptidase y4tL | 0.00e+00 | NA | NA | 0.7322 |
| 6. F | C7Z837 | Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 | 7.50e-11 | NA | NA | 0.7502 |
| 6. F | Q3ZC89 | Methionine aminopeptidase 2 | 2.60e-14 | NA | NA | 0.8107 |
| 6. F | Q0CZM6 | Probable Xaa-Pro aminopeptidase ATEG_00858 | 1.55e-10 | NA | NA | 0.7517 |
| 6. F | P0A3Z1 | Xaa-Pro aminopeptidase 1 | 3.86e-10 | NA | NA | 0.6903 |
| 6. F | C7Z9Z7 | Probable Xaa-Pro aminopeptidase P | 2.16e-08 | NA | NA | 0.6886 |
| 6. F | Q0SZ37 | Xaa-Pro dipeptidase | 2.93e-10 | NA | NA | 0.6836 |
| 6. F | B6HAN0 | Probable Xaa-Pro aminopeptidase Pc16g13390 | 2.12e-10 | NA | NA | 0.6876 |
| 6. F | B6QG01 | Probable Xaa-Pro aminopeptidase P | 6.46e-08 | NA | NA | 0.6606 |
| 6. F | E9DDK8 | Probable Xaa-Pro aminopeptidase PEPP | 8.42e-11 | NA | NA | 0.772 |
| 6. F | B5FNX9 | Xaa-Pro dipeptidase | 2.97e-10 | NA | NA | 0.6916 |
| 6. F | Q4X267 | Probable Xaa-Pro aminopeptidase pepP | 1.25e-10 | NA | NA | 0.7519 |
| 6. F | A1JIG5 | Xaa-Pro dipeptidase | 1.01e-09 | NA | NA | 0.6387 |
| 6. F | B2AFW1 | Probable Xaa-Pro aminopeptidase PEPP | 5.38e-11 | NA | NA | 0.747 |
| 6. F | B3GZT0 | Xaa-Pro dipeptidase | 3.14e-10 | NA | NA | 0.6557 |
| 6. F | A3SK19 | Dimethylsulfonioproprionate lyase DddP | 4.16e-11 | NA | NA | 0.6694 |
| 6. F | Q6CCY2 | Probable metalloprotease ARX1 | 3.63e-09 | NA | NA | 0.727 |
| 6. F | A9MIX1 | Xaa-Pro dipeptidase | 2.99e-10 | NA | NA | 0.6919 |
| 6. F | C0NF18 | Probable Xaa-Pro aminopeptidase HCBG_01484 | 2.07e-10 | NA | NA | 0.7338 |
| 6. F | Q0WAP4 | Xaa-Pro dipeptidase | 4.56e-10 | NA | NA | 0.6471 |
| 6. F | A4WFX3 | Xaa-Pro dipeptidase | 3.63e-10 | NA | NA | 0.6798 |
| 6. F | B2VFE3 | Xaa-Pro dipeptidase | 4.59e-10 | NA | NA | 0.698 |
| 6. F | B7NV19 | Xaa-Pro dipeptidase | 2.93e-10 | NA | NA | 0.6834 |
| 6. F | C5PHM7 | Probable Xaa-Pro aminopeptidase PEPP | 8.20e-11 | NA | NA | 0.7434 |
| 6. F | Q5PKQ1 | Xaa-Pro dipeptidase | 2.91e-10 | NA | NA | 0.6865 |
| 6. F | D1ZBF6 | Probable Xaa-Pro aminopeptidase PEPP | 5.94e-09 | NA | NA | 0.7206 |
| 6. F | B6I4I7 | Xaa-Pro dipeptidase | 2.85e-10 | NA | NA | 0.6888 |
| 6. F | B2AW39 | Probable Xaa-Pro aminopeptidase PODANS_7_5850 | 4.69e-09 | NA | NA | 0.7266 |
| 6. F | C5K105 | Probable Xaa-Pro aminopeptidase P | 2.11e-08 | NA | NA | 0.6793 |
| 6. F | E5ABQ8 | Probable Xaa-Pro aminopeptidase P | 1.66e-08 | NA | NA | 0.6673 |
| 6. F | A6RK67 | Probable Xaa-Pro aminopeptidase P | 1.50e-08 | NA | NA | 0.6665 |
| 6. F | B5BIZ1 | Xaa-Pro dipeptidase | 2.94e-10 | NA | NA | 0.6766 |
| 6. F | E3S6N7 | Probable Xaa-Pro aminopeptidase pepP | 1.23e-10 | NA | NA | 0.7529 |
| 6. F | B6Q8T5 | Probable Xaa-Pro aminopeptidase pepP | 7.79e-11 | NA | NA | 0.7324 |
| 6. F | C1H978 | Probable Xaa-Pro aminopeptidase P | 2.16e-08 | NA | NA | 0.6551 |
| 6. F | Q4WUD3 | Probable Xaa-Pro aminopeptidase P | 6.01e-08 | NA | NA | 0.6865 |
| 6. F | P38488 | Creatinase | 1.03e-12 | NA | NA | 0.7133 |
| 6. F | A3CYJ5 | Xaa-Pro dipeptidase | 3.46e-10 | NA | NA | 0.7045 |
| 6. F | Q74ZU6 | Probable metalloprotease ARX1 | 8.70e-06 | NA | NA | 0.6016 |
| 6. F | E9F9J8 | Probable Xaa-Pro aminopeptidase MAA_08947 | 1.03e-09 | NA | NA | 0.739 |
| 6. F | Q9L6L4 | Xaa-Pro dipeptidase | 2.92e-10 | NA | NA | 0.682 |
| 6. F | A0KR51 | Xaa-Pro dipeptidase | 3.46e-10 | NA | NA | 0.7168 |
| 6. F | A6WHA1 | Xaa-Pro dipeptidase | 3.65e-10 | NA | NA | 0.7206 |
| 6. F | B5XYG9 | Xaa-Pro dipeptidase | 3.02e-10 | NA | NA | 0.6912 |
| 6. F | Q2S6U2 | Xaa-Pro dipeptidase | 3.99e-10 | NA | NA | 0.6999 |
| 6. F | E4ZHV7 | Probable Xaa-Pro aminopeptidase PEPP | 1.47e-09 | NA | NA | 0.7181 |
| 6. F | Q4WRV9 | Probable Xaa-Pro aminopeptidase AFUA_1G14920 | 8.91e-11 | NA | NA | 0.7463 |
| 6. F | Q6BI90 | Probable metalloprotease ARX1 | 3.85e-06 | NA | NA | 0.5915 |
| 6. F | Q3BPR2 | Xaa-Pro dipeptidase | 6.09e-10 | NA | NA | 0.6624 |
| 6. F | B4SI11 | Xaa-Pro dipeptidase | 5.30e-10 | NA | NA | 0.691 |
| 6. F | B7N2F3 | Xaa-Pro dipeptidase | 2.93e-10 | NA | NA | 0.6519 |
| 6. F | P0CQ23 | FACT complex subunit SPT16 | 8.46e-06 | NA | NA | 0.6988 |
| 6. F | Q8X0X6 | FACT complex subunit ctc-2 | 1.03e-05 | NA | NA | 0.7022 |
| 6. F | A4STF0 | Xaa-Pro dipeptidase | 3.49e-10 | NA | NA | 0.703 |
| 6. F | A4RAE9 | Probable Xaa-Pro aminopeptidase PEPP | 6.34e-11 | NA | NA | 0.7525 |
| 6. F | Q7CPD4 | Xaa-Pro dipeptidase | 2.88e-10 | NA | NA | 0.6919 |
| 6. F | A3MYG3 | Xaa-Pro dipeptidase | 4.01e-10 | NA | NA | 0.669 |
| 6. F | B4TBS6 | Xaa-Pro dipeptidase | 2.90e-10 | NA | NA | 0.6766 |
| 6. F | B2AWV6 | Probable Xaa-Pro aminopeptidase P | 6.94e-08 | NA | NA | 0.6867 |
| 6. F | Q6CKB6 | Probable metalloprotease ARX1 | 2.32e-08 | NA | NA | 0.6034 |
| 6. F | C5FHR9 | Probable Xaa-Pro aminopeptidase P | 3.02e-08 | NA | NA | 0.7262 |
| 6. F | A1D1S6 | Probable Xaa-Pro aminopeptidase NFIA_010500 | 1.53e-10 | NA | NA | 0.7417 |
| 6. F | B8CHA2 | Xaa-Pro dipeptidase | 3.11e-10 | NA | NA | 0.6793 |
| 6. F | B6QAW7 | Probable Xaa-Pro aminopeptidase PMAA_074180 | 3.21e-12 | NA | NA | 0.7232 |
| 6. F | Q4UY33 | Xaa-Pro dipeptidase | 6.35e-10 | NA | NA | 0.6936 |
| 6. F | A7MQN9 | Xaa-Pro dipeptidase | 3.05e-10 | NA | NA | 0.6905 |
| 6. F | D4B0B2 | Probable Xaa-Pro aminopeptidase ARB_01886 | 1.41e-10 | NA | NA | 0.6967 |
| 6. F | B8MZI5 | Probable Xaa-Pro aminopeptidase AFLA_084750 | 2.19e-10 | NA | NA | 0.7257 |
| 6. F | P0A3Z2 | Xaa-Pro aminopeptidase 1 | 3.94e-10 | NA | NA | 0.6939 |
| 6. F | B1KCZ4 | Xaa-Pro dipeptidase | 3.44e-10 | NA | NA | 0.6777 |
| 6. F | B5QW86 | Xaa-Pro dipeptidase | 2.92e-10 | NA | NA | 0.6737 |
| 6. F | A7ENP9 | Probable Xaa-Pro aminopeptidase SS1G_06948 | 6.04e-10 | NA | NA | 0.7157 |
| 6. F | Q48AT5 | Xaa-Pro dipeptidase | 5.55e-10 | NA | NA | 0.7015 |
| 6. F | B4EWE3 | Xaa-Pro dipeptidase | 2.63e-10 | NA | NA | 0.7022 |
| 6. F | Q95333 | Xaa-Pro aminopeptidase 2 | 1.39e-08 | NA | NA | 0.6491 |
| 6. F | B7NFE8 | Xaa-Pro dipeptidase | 3.57e-10 | NA | NA | 0.6482 |
| 6. F | C7YVN8 | Probable Xaa-Pro aminopeptidase PEPP | 6.29e-11 | NA | NA | 0.7405 |
| 6. F | A0KEL3 | Xaa-Pro dipeptidase | 3.86e-10 | NA | NA | 0.7039 |
| 6. F | C9SDK8 | Probable Xaa-Pro aminopeptidase VDBG_02538 | 4.30e-11 | NA | NA | 0.743 |
| 6. F | C5A021 | Xaa-Pro dipeptidase | 3.58e-10 | NA | NA | 0.6849 |
| 6. F | B2K0Z7 | Xaa-Pro dipeptidase | 5.06e-10 | NA | NA | 0.6879 |
| 6. F | Q0CDB3 | Probable Xaa-Pro aminopeptidase P | 4.22e-08 | NA | NA | 0.6853 |
| 6. F | B2WMQ2 | Probable Xaa-Pro aminopeptidase pepP | 1.06e-10 | NA | NA | 0.7476 |
| 6. F | B7LTY8 | Xaa-Pro dipeptidase | 2.94e-10 | NA | NA | 0.6517 |
| 6. F | Q1CN98 | Xaa-Pro dipeptidase | 4.51e-10 | NA | NA | 0.6455 |
| 6. F | D5GAC6 | Probable Xaa-Pro aminopeptidase P | 1.93e-08 | NA | NA | 0.6504 |
| 6. F | A4TR26 | Xaa-Pro dipeptidase | 4.58e-10 | NA | NA | 0.6962 |
| 6. F | D4D891 | Probable Xaa-Pro aminopeptidase P | 1.94e-08 | NA | NA | 0.6829 |
| 6. F | A8P5H7 | Probable Xaa-Pro aminopeptidase P | 2.56e-08 | NA | NA | 0.6596 |
| 6. F | C6HNY5 | Probable Xaa-Pro aminopeptidase HCDG_07916 | 4.59e-10 | NA | NA | 0.7226 |
| 6. F | A7UWH7 | Probable Xaa-Pro aminopeptidase NCU11288 | 8.33e-11 | NA | NA | 0.7593 |
| 6. F | Q3IJ21 | Xaa-Pro dipeptidase | 4.12e-10 | NA | NA | 0.6799 |
| 6. F | A6SDE9 | Probable Xaa-Pro aminopeptidase pepP | 3.85e-11 | NA | NA | 0.7518 |
| 6. F | P19213 | Creatinase | 1.05e-12 | NA | NA | 0.7122 |
| 6. F | C1GHS9 | Probable Xaa-Pro aminopeptidase PADG_06815 | 3.46e-10 | NA | NA | 0.7309 |
| 6. F | A8A6V2 | Xaa-Pro dipeptidase | 3.60e-10 | NA | NA | 0.6913 |
| 6. F | Q5RFB3 | Xaa-Pro dipeptidase | 1.46e-11 | NA | NA | 0.7548 |
| 6. F | A1CSI0 | Probable Xaa-Pro aminopeptidase pepP | 1.29e-10 | NA | NA | 0.7196 |
| 6. F | A4RF35 | Probable Xaa-Pro aminopeptidase P | 7.78e-09 | NA | NA | 0.6958 |
| 6. F | C0NDZ7 | Probable Xaa-Pro aminopeptidase P | 2.46e-08 | NA | NA | 0.6604 |
| 6. F | Q8EKR8 | Xaa-Pro dipeptidase | 3.47e-10 | NA | NA | 0.7194 |
| 6. F | A9KU92 | Xaa-Pro dipeptidase | 3.49e-10 | NA | NA | 0.7168 |
| 6. F | C4JY72 | Probable Xaa-Pro aminopeptidase UREG_07123 | 1.18e-11 | NA | NA | 0.6921 |
| 6. F | C5JQ04 | Probable Xaa-Pro aminopeptidase PEPP | 1.07e-10 | NA | NA | 0.7496 |
| 6. F | B8M2W9 | Probable Xaa-Pro aminopeptidase TSTA_094700 | 1.47e-10 | NA | NA | 0.6845 |
| 6. F | B2TVJ6 | Xaa-Pro dipeptidase | 2.99e-10 | NA | NA | 0.6799 |
| 6. F | Q12TB3 | Xaa-Pro dipeptidase | 3.79e-10 | NA | NA | 0.7161 |
| 6. F | Q61E63 | FACT complex subunit spt-16 | 3.77e-06 | NA | NA | 0.6857 |
| 6. F | Q4P2U5 | FACT complex subunit SPT16 | 7.35e-06 | NA | NA | 0.6829 |
| 6. F | C5GXZ9 | Probable Xaa-Pro aminopeptidase P | 2.07e-08 | NA | NA | 0.6663 |
| 6. F | C9SEV5 | Probable Xaa-Pro aminopeptidase PEPP | 1.95e-09 | NA | NA | 0.7276 |
| 6. F | Q5BF48 | Probable Xaa-Pro aminopeptidase AN0832 | 2.33e-11 | NA | NA | 0.7645 |
| 6. F | E3S7K9 | Probable Xaa-Pro aminopeptidase P | 3.95e-08 | NA | NA | 0.6832 |
| 6. F | Q5AVF0 | Probable Xaa-Pro aminopeptidase P | 4.56e-08 | NA | NA | 0.6812 |
| 6. F | A9MYB1 | Xaa-Pro dipeptidase | 2.90e-10 | NA | NA | 0.6738 |
| 6. F | B8NEI6 | Probable Xaa-Pro aminopeptidase P | 5.87e-08 | NA | NA | 0.6648 |
| 6. F | Q0HPB6 | Xaa-Pro dipeptidase | 3.46e-10 | NA | NA | 0.72 |
| 6. F | D1ZKF3 | Probable Xaa-Pro aminopeptidase P | 2.05e-08 | NA | NA | 0.6716 |
| 6. F | Q0UFY4 | Probable Xaa-Pro aminopeptidase P | 5.50e-08 | NA | NA | 0.6664 |
| 6. F | B6HQC9 | Probable Xaa-Pro aminopeptidase P | 1.66e-08 | NA | NA | 0.6646 |
| 6. F | Q5B2X8 | FACT complex subunit spt16 | 7.76e-06 | NA | NA | 0.6656 |
| 6. F | A1AI34 | Xaa-Pro dipeptidase | 2.86e-10 | NA | NA | 0.6519 |
| 6. F | C0SCV1 | Probable Xaa-Pro aminopeptidase P | 2.23e-08 | NA | NA | 0.6567 |
| 6. F | E4USI8 | Probable Xaa-Pro aminopeptidase P | 2.54e-08 | NA | NA | 0.6784 |
| 6. F | Q15ZF7 | Xaa-Pro dipeptidase | 4.10e-10 | NA | NA | 0.6717 |
| 6. F | Q0V147 | Probable Xaa-Pro aminopeptidase SNOG_02267 | 7.00e-08 | NA | NA | 0.7338 |
| 6. F | E3QCU0 | Probable Xaa-Pro aminopeptidase P | 2.06e-08 | NA | NA | 0.6799 |
| 6. F | Q6FL44 | Probable metalloprotease ARX1 | 7.15e-06 | NA | NA | 0.5888 |
| 6. F | A1CAQ1 | Probable Xaa-Pro aminopeptidase P | 4.93e-08 | NA | NA | 0.6996 |
| 6. F | A7E4T8 | Probable Xaa-Pro aminopeptidase P | 1.46e-08 | NA | NA | 0.6673 |
| 6. F | B7M650 | Xaa-Pro dipeptidase | 2.88e-10 | NA | NA | 0.6887 |
| 6. F | A8GYG1 | Xaa-Pro dipeptidase | 3.03e-10 | NA | NA | 0.683 |
| 6. F | A7EUB3 | Probable Xaa-Pro aminopeptidase pepP | 4.11e-10 | NA | NA | 0.7579 |
| 6. F | C0SDW6 | Probable Xaa-Pro aminopeptidase PABG_05921 | 3.97e-10 | NA | NA | 0.7071 |
| 6. F | C0NIF0 | Probable Xaa-Pro aminopeptidase PEPP | 9.35e-11 | NA | NA | 0.7575 |
| 6. F | Q1R465 | Xaa-Pro dipeptidase | 2.89e-10 | NA | NA | 0.6519 |
| 6. F | C6H7R7 | Probable Xaa-Pro aminopeptidase PEPP | 1.07e-10 | NA | NA | 0.7539 |
| 6. F | E9E9B2 | Probable Xaa-Pro aminopeptidase P | 2.35e-08 | NA | NA | 0.6829 |
| 6. F | A4Y1B7 | Xaa-Pro dipeptidase | 3.45e-10 | NA | NA | 0.7046 |
| 6. F | Q83PG0 | Xaa-Pro dipeptidase | 2.98e-10 | NA | NA | 0.6523 |
| 6. F | D4ARJ9 | Probable Xaa-Pro aminopeptidase P | 9.62e-08 | NA | NA | 0.6779 |
| 6. F | P77814 | Xaa-Pro dipeptidase | 3.59e-10 | NA | NA | 0.6662 |
| 6. F | B1XAK9 | Xaa-Pro dipeptidase | 4.08e-10 | NA | NA | 0.6872 |
| 6. F | Q66FR7 | Xaa-Pro dipeptidase | 4.74e-10 | NA | NA | 0.6793 |
| 6. F | C1GD57 | Probable Xaa-Pro aminopeptidase PEPP | 8.94e-11 | NA | NA | 0.7404 |
| 6. F | B8F8H3 | Xaa-Pro dipeptidase | 3.50e-10 | NA | NA | 0.6424 |
| 6. F | Q0TAK9 | Xaa-Pro dipeptidase | 2.87e-10 | NA | NA | 0.6521 |
| 6. F | P27875 | Agropine synthesis cyclase | 9.21e-15 | NA | NA | 0.7594 |
| 6. F | Q2NWT2 | Xaa-Pro dipeptidase | 4.41e-10 | NA | NA | 0.6694 |
| 6. F | C5P7J2 | Probable Xaa-Pro aminopeptidase P | 4.11e-08 | NA | NA | 0.6665 |
| 6. F | E9EK74 | Probable Xaa-Pro aminopeptidase pepP | 5.23e-11 | NA | NA | 0.7128 |
| 6. F | A8ACZ6 | Xaa-Pro dipeptidase | 3.02e-10 | NA | NA | 0.6904 |
| 7. B | H1UBK1 | Methionine aminopeptidase 2 | 2.42e-14 | NA | 1.84e-08 | NA |
| 7. B | Q9NQH7 | Xaa-Pro aminopeptidase 3 | 3.02e-11 | NA | 6.66e-08 | NA |
| 7. B | P38174 | Methionine aminopeptidase 2 | 2.00e-15 | NA | 0.021 | NA |
| 7. B | P38062 | Methionine aminopeptidase 2 | 3.09e-14 | NA | 8.58e-06 | NA |
| 7. B | P15034 | Xaa-Pro aminopeptidase | 1.01e-11 | NA | 0.003 | NA |
| 7. B | Q9FV51 | Methionine aminopeptidase 1C, chloroplastic/mitochondrial | 0.00e+00 | NA | 8.63e-46 | NA |
| 7. B | P76524 | Aminopeptidase YpdF | 2.22e-16 | NA | 6.11e-17 | NA |
| 7. B | P9WHS7 | Probable dipeptidase PepE | 5.00e-15 | NA | 2.45e-07 | NA |
| 7. B | Q2FXL9 | Uncharacterized peptidase SAOUHSC_01816 | 1.11e-16 | NA | 5.41e-14 | NA |
| 7. B | Q58725 | Methionine aminopeptidase | NA | NA | 8.34e-13 | NA |
| 7. B | O60085 | Methionine aminopeptidase 2 | 2.66e-15 | NA | 3.46e-09 | NA |
| 7. B | B7ZMP1 | Xaa-Pro aminopeptidase 3 | 2.42e-11 | NA | 1.49e-06 | NA |
| 7. B | P53582 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 7.35e-48 | NA |
| 7. B | Q56Y85 | Methionine aminopeptidase 2B | 5.33e-15 | NA | 1.33e-04 | NA |
| 7. B | Q8BP48 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 5.73e-46 | NA |
| 7. B | Q8IJP2 | Methionine aminopeptidase 1b | 0.00e+00 | NA | 9.56e-51 | NA |
| 7. B | Q55C21 | Methionine aminopeptidase 2 | 1.33e-15 | NA | 1.35e-04 | NA |
| 7. B | P43590 | Uncharacterized peptidase YFR006W | 5.96e-10 | NA | 1.11e-04 | NA |
| 7. B | O08663 | Methionine aminopeptidase 2 | 2.53e-14 | NA | 2.14e-05 | NA |
| 7. B | Q9FV50 | Methionine aminopeptidase 1D, chloroplastic/mitochondrial | 0.00e+00 | NA | 5.51e-58 | NA |
| 7. B | Q9FV49 | Methionine aminopeptidase 2A | 4.88e-15 | NA | 3.65e-08 | NA |
| 7. B | Q1ZXG4 | Proliferation-associated protein A | 0.00e+00 | NA | 3.01e-05 | NA |
| 7. B | Q59LF9 | Methionine aminopeptidase 2 | 3.33e-15 | NA | 2.05e-06 | NA |
| 7. B | O59730 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 2.92e-42 | NA |
| 7. B | Q01662 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 1.98e-45 | NA |
| 7. B | P33111 | Uncharacterized protein in adk 3'region (Fragment) | 3.74e-10 | NA | 4.23e-12 | NA |
| 7. B | Q96327 | ERBB-3 BINDING PROTEIN 1 | 5.11e-15 | NA | 5.72e-09 | NA |
| 7. B | B5DEQ3 | Xaa-Pro aminopeptidase 3 | 5.50e-11 | NA | 9.10e-06 | NA |
| 7. B | P28617 | Methionine aminopeptidase (Fragment) | 6.89e-05 | NA | 0.007 | NA |
| 7. B | Q54VU7 | Methionine aminopeptidase 1D, mitochondrial | 0.00e+00 | NA | 1.75e-49 | NA |
| 7. B | Q58216 | Uncharacterized peptidase MJ0806 | 3.04e-14 | NA | 2.41e-10 | NA |
| 7. B | Q9SLN5 | Methionine aminopeptidase 1A | 0.00e+00 | NA | 1.26e-47 | NA |
| 7. B | Q4QRK0 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 2.89e-49 | NA |
| 7. B | Q9FV52 | Methionine aminopeptidase 1B, chloroplastic | 0.00e+00 | NA | 3.23e-51 | NA |
| 7. B | Q54WU3 | Methionine aminopeptidase 1 | 0.00e+00 | NA | 2.04e-45 | NA |
| 7. B | Q8RY11 | Aminopeptidase P2 | 7.72e-08 | NA | 0.015 | NA |
| 7. B | Q54T46 | Xaa-Pro aminopeptidase 3 | 1.14e-10 | NA | 3.75e-06 | NA |
| 7. B | P41392 | Methionine aminopeptidase (Fragment) | 5.89e-02 | NA | 0.001 | NA |