Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54901.1
JCVISYN3A_0652
Preprotein translocase subunit.
M. mycoides homolog: Q6MSP4.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 81
Unique PROST Go: 57
Unique BLAST Go: 4
Unique Foldseek Go: 0
Total Homologs: 252
Unique PROST Homologs: 131
Unique BLAST Homologs: 6
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
F8LR08
(Accessory Sec system protein translocase subunit SecY2) with a FATCAT P-Value: 0 and RMSD of 2.65 angstrom. The sequence alignment identity is 25.8%.
Structural alignment shown in left. Query protein AVX54901.1 colored as red in alignment, homolog F8LR08 colored as blue.
Query protein AVX54901.1 is also shown in right top, homolog F8LR08 showed in right bottom. They are colored based on secondary structures.
AVX54901.1 MVIKKPANKVDKKTTFKSSTKKKNLFKSNFFTKNKDLILRILFTLLALIIIRLGVYITVPGVTLD-KR---FATDSSRIQFFQLLSTLGGGSIGRFSILA 96 F8LR08 -------------------MKK--ISQS-IITK------RVLWTLFFLFIYCLGNQLVLP--FVDLKNANIFGGAIGSLAFS---SAMMGGNLRSMSLFS 67 AVX54901.1 LGVSPYITASIIVQLLSTDVIPVLTRWSKSGERGRKKL-----DKLTKIIMIPFALMQAEATIFTLSSQGL-IVPGWDSTNVIANSAFYYVLIPLVMLGG 190 F8LR08 VGLSPWMSAMILWQMFS---------FSK--KMGLKNLPIEIQDRRRMYLALGIAIVQSLA--VSLN---LPIVSG---VN--ASLAIF--MNTILLIAG 144 AVX54901.1 SFFMLWIADQITIKGIGNGISIVIFIGIIISMPTNLKATFEYWVSNSGEEANIFFSGLLNFMIYISVFLLVILSVV-IMNEAERKIPIQQTGSGLTDSSE 289 F8LR08 TFFLVWLSDLNSLFGIG-G-SIVI---LMASMMANL----PYQIMDSIEKLGI---G-WNVLLPLILFSLVFLYVSGVVQRARYRISINKI--NIHNRFK 229 AVX54901.1 HTPYLPLKLNNAGVIPVIFASAIISTPITISQIIEAVNPD----SGFV-IFTRDYLSFNTWWGISIFGILIVLFTF-L-YSQVQINPEKVAENFQKSGTF 382 F8LR08 QYSYLDIMLNPAGGMPFMYAMSLVSIPQYVFMLIQFIHPENKWTSGAIKALT---VG-QPLW-LVVY--LVMLFVLGLAFAFVNVSGEQISERMRKSGEY 322 AVX54901.1 IPGIKPGKDTTKYLTGIINRLSVVGS---VFLA----IIALL-P-YVISKLTQLPSNLAIGGTGLIICISVAIQTVQQLKGRIIQQNFIEKKKE-KFTNN 472 F8LR08 IYGVYPGQETSAYINHLVLRLGFIGALYMLFMAGAPMLIILVNPDYL--QLSMIP------GTFLI------------FSGMIYNVN--EEMKALK---- 396 AVX54901.1 INKNKTSH--IW--- 482 F8LR08 LN---TSYTPLFENV 408
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0015031 | protein transport |
| 1. PBF | GO:0043952 | protein transport by the Sec complex |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0005887 | integral component of plasma membrane |
| 1. PBF | GO:0009535 | chloroplast thylakoid membrane |
| 1. PBF | GO:0031522 | cell envelope Sec protein transport complex |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0065002 | intracellular protein transmembrane transport |
| 1. PBF | GO:0005048 | signal sequence binding |
| 1. PBF | GO:0008320 | protein transmembrane transporter activity |
| 1. PBF | GO:0006605 | protein targeting |
| 1. PBF | GO:0036012 | cyanelle inner membrane |
| 1. PBF | GO:0006616 | SRP-dependent cotranslational protein targeting to membrane, translocation |
| 2. PF | GO:0045047 | protein targeting to ER |
| 2. PF | GO:0039019 | pronephric nephron development |
| 2. PF | GO:0005789 | endoplasmic reticulum membrane |
| 2. PF | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 3. BF | GO:0033115 | cyanelle thylakoid membrane |
| 3. BF | GO:0031676 | plasma membrane-derived thylakoid membrane |
| 4. PB | GO:0032978 | protein insertion into membrane from inner side |
| 5. P | GO:0015379 | potassium:chloride symporter activity |
| 5. P | GO:0042910 | xenobiotic transmembrane transporter activity |
| 5. P | GO:0090585 | protein-phosphocysteine-L-ascorbate-phosphotransferase system transporter activity |
| 5. P | GO:0015450 | protein-transporting ATPase activity |
| 5. P | GO:0015294 | solute:cation symporter activity |
| 5. P | GO:0044743 | protein transmembrane import into intracellular organelle |
| 5. P | GO:0031204 | posttranslational protein targeting to membrane, translocation |
| 5. P | GO:0070843 | misfolded protein transport |
| 5. P | GO:0033748 | hydrogenase (acceptor) activity |
| 5. P | GO:0015297 | antiporter activity |
| 5. P | GO:0015081 | sodium ion transmembrane transporter activity |
| 5. P | GO:0045278 | plasma membrane respiratory chain complex IV |
| 5. P | GO:0009243 | O antigen biosynthetic process |
| 5. P | GO:0071805 | potassium ion transmembrane transport |
| 5. P | GO:0051453 | regulation of intracellular pH |
| 5. P | GO:1904680 | peptide transmembrane transporter activity |
| 5. P | GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system |
| 5. P | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 5. P | GO:0042906 | xanthine transport |
| 5. P | GO:0042907 | xanthine transmembrane transporter activity |
| 5. P | GO:0034219 | carbohydrate transmembrane transport |
| 5. P | GO:0015944 | formate oxidation |
| 5. P | GO:0005524 | ATP binding |
| 5. P | GO:0036397 | formate dehydrogenase (quinone) activity |
| 5. P | GO:0046872 | metal ion binding |
| 5. P | GO:0070470 | plasma membrane respirasome |
| 5. P | GO:0006883 | cellular sodium ion homeostasis |
| 5. P | GO:0006885 | regulation of pH |
| 5. P | GO:0034341 | response to interferon-gamma |
| 5. P | GO:0045048 | protein insertion into ER membrane |
| 5. P | GO:0022857 | transmembrane transporter activity |
| 5. P | GO:0042925 | benzoate transmembrane transporter activity |
| 5. P | GO:0008556 | P-type potassium transmembrane transporter activity |
| 5. P | GO:0005267 | potassium channel activity |
| 5. P | GO:0005262 | calcium channel activity |
| 5. P | GO:0036376 | sodium ion export across plasma membrane |
| 5. P | GO:0008324 | cation transmembrane transporter activity |
| 5. P | GO:0015496 | putrescine:ornithine antiporter activity |
| 5. P | GO:0021986 | habenula development |
| 5. P | GO:0006614 | SRP-dependent cotranslational protein targeting to membrane |
| 5. P | GO:0030970 | retrograde protein transport, ER to cytosol |
| 5. P | GO:0016966 | nitric oxide reductase activity |
| 5. P | GO:0019333 | denitrification pathway |
| 5. P | GO:0005471 | ATP:ADP antiporter activity |
| 5. P | GO:0043022 | ribosome binding |
| 5. P | GO:0007029 | endoplasmic reticulum organization |
| 5. P | GO:0071261 | Ssh1 translocon complex |
| 5. P | GO:0005784 | Sec61 translocon complex |
| 5. P | GO:0019411 | aerobic respiration, using ferrous ions as electron donor |
| 5. P | GO:0015385 | sodium:proton antiporter activity |
| 5. P | GO:0030955 | potassium ion binding |
| 5. P | GO:0006613 | cotranslational protein targeting to membrane |
| 5. P | GO:0044569 | [Ni-Fe] hydrogenase complex |
| 5. P | GO:0015882 | L-ascorbic acid transmembrane transport |
| 5. P | GO:0006620 | posttranslational protein targeting to endoplasmic reticulum membrane |
| 5. P | GO:0005791 | rough endoplasmic reticulum |
| 5. P | GO:0070069 | cytochrome complex |
| 7. B | GO:0009526 | plastid envelope |
| 7. B | GO:0033097 | amyloplast membrane |
| 7. B | GO:0072598 | protein localization to chloroplast |
| 7. B | GO:0010027 | thylakoid membrane organization |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0015031 | protein transport |
| GO:0043952 | protein transport by the Sec complex |
| GO:0005886 | plasma membrane |
| GO:0065002 | intracellular protein transmembrane transport |
| GO:0016021 | integral component of membrane |
| GO:0016020 | membrane |
| GO:0006605 | protein targeting |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q97P79 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.02e-25 | 6.49e-25 | 0.8762 |
| 1. PBF | P38376 | Protein translocase subunit SecY | 0.00e+00 | 2.48e-30 | 6.13e-74 | 0.8395 |
| 1. PBF | Q9HWF5 | Protein translocase subunit SecY | 0.00e+00 | 2.23e-35 | 8.61e-69 | 0.8385 |
| 1. PBF | Q9ZJS9 | Protein translocase subunit SecY | 0.00e+00 | 1.74e-31 | 3.59e-60 | 0.87 |
| 1. PBF | A8AZK5 | Protein translocase subunit SecY | 0.00e+00 | 5.44e-41 | 1.72e-98 | 0.8597 |
| 1. PBF | Q68W98 | Protein translocase subunit SecY | 0.00e+00 | 1.09e-33 | 1.23e-68 | 0.836 |
| 1. PBF | P38375 | Protein translocase subunit SecY | 0.00e+00 | 1.12e-33 | 2.35e-95 | 0.8612 |
| 1. PBF | O52351 | Protein translocase subunit SecY | 0.00e+00 | 1.05e-28 | 1.91e-95 | 0.8403 |
| 1. PBF | Q7A468 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8598 |
| 1. PBF | O66491 | Protein translocase subunit SecY | 0.00e+00 | 3.13e-33 | 8.46e-75 | 0.7892 |
| 1. PBF | Q9X1I9 | Protein translocase subunit SecY | 0.00e+00 | 1.97e-34 | 3.19e-83 | 0.8205 |
| 1. PBF | B2ISB6 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.86e-26 | 1.91e-24 | 0.8744 |
| 1. PBF | Q4G351 | Protein translocase subunit SecY | 0.00e+00 | 1.56e-27 | 3.15e-41 | 0.8301 |
| 1. PBF | P43804 | Protein translocase subunit SecY | 0.00e+00 | 3.43e-34 | 2.67e-62 | 0.8729 |
| 1. PBF | Q89A85 | Protein translocase subunit SecY | 0.00e+00 | 3.71e-36 | 1.03e-49 | 0.8744 |
| 1. PBF | Q5HCP4 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 2.76e-22 | 1.54e-12 | 0.823 |
| 1. PBF | Q6G791 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8642 |
| 1. PBF | B2XTD8 | Protein translocase subunit SecY | 0.00e+00 | 5.25e-40 | 1.79e-32 | 0.8211 |
| 1. PBF | P0A4H0 | Protein translocase subunit SecY | 0.00e+00 | 1.46e-38 | 9.47e-75 | 0.8401 |
| 1. PBF | A3CK84 | Protein translocase subunit SecY | 0.00e+00 | 4.48e-36 | 1.12e-98 | 0.8649 |
| 1. PBF | P27148 | Protein translocase subunit SecY | 0.00e+00 | 2.11e-36 | 9.17e-98 | 0.8539 |
| 1. PBF | O28377 | Protein translocase subunit SecY | 7.27e-13 | 1.08e-23 | 1.39e-06 | 0.6653 |
| 1. PBF | Q7A363 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 8.49e-21 | 2.61e-13 | 0.8107 |
| 1. PBF | Q8K969 | Protein translocase subunit SecY | 0.00e+00 | 6.26e-36 | 3.03e-52 | 0.8419 |
| 1. PBF | Q5SHQ8 | Protein translocase subunit SecY | 0.00e+00 | 2.47e-35 | 3.35e-75 | 0.8284 |
| 1. PBF | Q8CMU8 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 3.75e-22 | 3.07e-17 | 0.8187 |
| 1. PBF | A6QKE2 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 2.76e-22 | 1.54e-12 | 0.8128 |
| 1. PBF | P47416 | Protein translocase subunit SecY | 0.00e+00 | 1.94e-37 | 1.19e-94 | 0.8549 |
| 1. PBF | F0P5S5 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 3.06e-25 | 1.80e-14 | 0.8261 |
| 1. PBF | P0AGA4 | Protein translocase subunit SecY | 0.00e+00 | 1.41e-37 | 8.75e-50 | 0.8597 |
| 1. PBF | Q9V1V8 | Protein translocase subunit SecY | 2.12e-12 | 1.01e-19 | 3.04e-05 | 0.6634 |
| 1. PBF | P49977 | Protein translocase subunit SecY | 0.00e+00 | 4.04e-34 | 1.65e-64 | 0.8553 |
| 1. PBF | Q2YZ90 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 3.10e-23 | 4.03e-13 | 0.8297 |
| 1. PBF | P10250 | Protein translocase subunit SecY | 0.00e+00 | 4.76e-104 | 0.0 | 0.9647 |
| 1. PBF | Q7A086 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8623 |
| 1. PBF | F8LR08 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 8.54e-29 | 6.27e-24 | 0.8614 |
| 1. PBF | F8LHW1 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 3.78e-29 | 4.95e-22 | 0.8482 |
| 1. PBF | Q8E480 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 2.34e-27 | 2.39e-27 | 0.8608 |
| 1. PBF | Q1RHP1 | Protein translocase subunit SecY | 0.00e+00 | 3.56e-36 | 3.46e-65 | 0.8447 |
| 1. PBF | Q8U019 | Protein translocase subunit SecY | 3.11e-15 | 2.95e-19 | 5.62e-07 | 0.6392 |
| 1. PBF | Q9PJN1 | Protein translocase subunit SecY | 0.00e+00 | 2.94e-39 | 2.14e-70 | 0.8759 |
| 1. PBF | Q37143 | Protein translocase subunit SecY | 0.00e+00 | 1.28e-30 | 7.57e-45 | 0.8888 |
| 1. PBF | P33108 | Protein translocase subunit SecY | 0.00e+00 | 2.14e-34 | 7.21e-52 | 0.853 |
| 1. PBF | Q8CNF3 | Protein translocase subunit SecY | 0.00e+00 | 1.34e-39 | 3.93e-87 | 0.8605 |
| 1. PBF | P49976 | Protein translocase subunit SecY (Fragment) | 0.00e+00 | 1.51e-04 | 4.28e-36 | 0.8151 |
| 1. PBF | P78283 | Protein translocase subunit SecY | 0.00e+00 | 3.98e-33 | 7.89e-60 | 0.8338 |
| 1. PBF | F2QF13 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.16e-29 | 3.41e-18 | 0.8553 |
| 1. PBF | P77964 | Protein translocase subunit SecY | 0.00e+00 | 8.84e-41 | 2.51e-64 | 0.8553 |
| 1. PBF | Q3K059 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.42e-27 | 2.33e-27 | 0.8483 |
| 1. PBF | O26134 | Protein translocase subunit SecY | 2.66e-15 | 4.46e-21 | 1.59e-06 | 0.6549 |
| 1. PBF | P0A5Z3 | Protein translocase subunit SecY | 0.00e+00 | 6.11e-31 | 6.10e-74 | 0.8488 |
| 1. PBF | P57571 | Protein translocase subunit SecY | 0.00e+00 | 7.93e-38 | 2.61e-49 | 0.8497 |
| 1. PBF | P9WGN2 | Protein translocase subunit SecY | 0.00e+00 | 6.11e-31 | 6.10e-74 | 0.8494 |
| 1. PBF | Q1XDJ1 | Protein translocase subunit SecY | 0.00e+00 | 3.96e-32 | 2.05e-68 | 0.8791 |
| 1. PBF | F6CD01 | Protein translocase subunit SecY 1 | 0.00e+00 | 1.71e-37 | 1.27e-94 | 0.8763 |
| 1. PBF | O25879 | Protein translocase subunit SecY | 0.00e+00 | 1.89e-31 | 8.16e-60 | 0.8788 |
| 1. PBF | O33006 | Protein translocase subunit SecY | 0.00e+00 | 1.27e-26 | 2.04e-68 | 0.7841 |
| 1. PBF | P0AGA3 | Protein translocase subunit SecY | 0.00e+00 | 1.41e-37 | 8.75e-50 | 0.8463 |
| 1. PBF | P58118 | Protein translocase subunit SecY | 0.00e+00 | 1.12e-36 | 1.14e-101 | 0.8492 |
| 1. PBF | Q5HDX8 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8603 |
| 1. PBF | P46785 | Protein translocase subunit SecY | 0.00e+00 | 2.26e-33 | 1.19e-64 | 0.8386 |
| 1. PBF | Q9Z7S5 | Protein translocase subunit SecY | 0.00e+00 | 6.22e-37 | 2.53e-65 | 0.8706 |
| 1. PBF | Q59548 | Protein translocase subunit SecY | 0.00e+00 | 4.96e-44 | 6.55e-99 | 0.8472 |
| 1. PBF | P49461 | Protein translocase subunit SecY | 0.00e+00 | 6.48e-31 | 2.08e-42 | 0.7969 |
| 1. PBF | P16336 | Protein translocase subunit SecY | 0.00e+00 | 1.19e-35 | 2.44e-93 | 0.8573 |
| 1. PBF | Q4L9N9 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.00e-18 | 6.08e-20 | 0.8543 |
| 1. PBF | Q4UMQ9 | Protein translocase subunit SecY | 0.00e+00 | 1.33e-32 | 1.13e-67 | 0.8692 |
| 1. PBF | P28539 | Protein translocase subunit SecY | 0.00e+00 | 1.05e-37 | 6.51e-74 | 0.8627 |
| 1. PBF | D8MEB8 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 4.58e-33 | 4.50e-31 | 0.8583 |
| 1. PBF | Q9AEU0 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 9.48e-27 | 3.49e-21 | 0.8482 |
| 1. PBF | Q05217 | Protein translocase subunit SecY | 0.00e+00 | 1.56e-39 | 5.72e-92 | 0.8676 |
| 1. PBF | B7T1W7 | Protein translocase subunit SecY | 0.00e+00 | 7.90e-34 | 1.33e-42 | 0.8175 |
| 1. PBF | P0AGA5 | Protein translocase subunit SecY | 0.00e+00 | 1.41e-37 | 8.75e-50 | 0.8535 |
| 1. PBF | Q05207 | Protein translocase subunit SecY | 0.00e+00 | 2.23e-35 | 5.64e-97 | 0.8581 |
| 1. PBF | P25014 | Protein translocase subunit SecY | 0.00e+00 | 4.29e-25 | 2.05e-36 | 0.7878 |
| 1. PBF | Q74L41 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.25e-25 | 3.77e-11 | 0.8009 |
| 1. PBF | Q5HM19 | Protein translocase subunit SecY | 0.00e+00 | 1.34e-39 | 3.93e-87 | 0.9041 |
| 1. PBF | B9DJQ6 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.59e-09 | 7.28e-19 | 0.8029 |
| 1. PBF | Q59912 | Protein translocase subunit SecY | 0.00e+00 | 7.74e-34 | 1.30e-68 | 0.8336 |
| 1. PBF | P38397 | Protein translocase subunit SecY (Fragment) | 0.00e+00 | 2.79e-31 | 3.72e-61 | 0.8487 |
| 1. PBF | P43416 | Protein translocase subunit SecY | 0.00e+00 | 1.34e-34 | 9.27e-67 | 0.8252 |
| 1. PBF | P46249 | Protein translocase subunit SecY | 0.00e+00 | 1.37e-27 | 2.83e-52 | 0.8235 |
| 1. PBF | O51451 | Protein translocase subunit SecY | 0.00e+00 | 6.07e-33 | 7.93e-54 | 0.8468 |
| 1. PBF | Q99S39 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8469 |
| 1. PBF | A8AWV0 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 2.21e-27 | 8.82e-23 | 0.8496 |
| 1. PBF | D3HAJ5 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 4.46e-26 | 6.24e-28 | 0.8708 |
| 1. PBF | Q92GY6 | Protein translocase subunit SecY | 0.00e+00 | 1.86e-32 | 2.13e-67 | 0.8449 |
| 1. PBF | P0A4H1 | Protein translocase subunit SecY | 0.00e+00 | 1.46e-38 | 9.47e-75 | 0.8549 |
| 1. PBF | Q6GEK3 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | 0.8484 |
| 1. PBF | O59442 | Protein translocase subunit SecY | 1.92e-12 | 7.92e-20 | 2.97e-06 | 0.649 |
| 1. PBF | F6CFW7 | Protein translocase subunit SecY 2 | 0.00e+00 | 1.18e-29 | 2.60e-67 | 0.8995 |
| 1. PBF | P28527 | Protein translocase subunit SecY | 0.00e+00 | 1.08e-35 | 2.32e-69 | 0.8722 |
| 1. PBF | Q85FU6 | Protein translocase subunit SecY | 0.00e+00 | 2.90e-11 | 8.76e-40 | 0.8382 |
| 1. PBF | Q59916 | Protein translocase subunit SecY | 0.00e+00 | 5.59e-34 | 4.94e-71 | 0.8126 |
| 1. PBF | A3CM55 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 4.91e-28 | 9.88e-29 | 0.8495 |
| 1. PBF | P28540 | Protein translocase subunit SecY | 0.00e+00 | 4.91e-28 | 1.30e-40 | 0.8596 |
| 1. PBF | A1C3L4 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 1.83e-29 | 5.84e-21 | 0.8247 |
| 1. PBF | P28542 | Protein translocase subunit SecY | 8.90e-13 | 5.13e-25 | 0.002 | 0.6731 |
| 1. PBF | Q9ZCS5 | Protein translocase subunit SecY | 0.00e+00 | 1.01e-33 | 1.09e-68 | 0.8471 |
| 1. PBF | P51297 | Protein translocase subunit SecY | 0.00e+00 | 2.58e-31 | 9.92e-64 | 0.917 |
| 2. PF | Q8AY35 | Protein transport protein Sec61 subunit alpha | 6.04e-11 | 4.93e-11 | NA | 0.6166 |
| 2. PF | P38379 | Protein transport protein Sec61 subunit alpha | 1.69e-13 | 2.33e-10 | NA | 0.6807 |
| 2. PF | Q977V3 | Protein translocase subunit SecY | 2.11e-15 | 1.84e-24 | NA | 0.6913 |
| 2. PF | Q8AY34 | Protein transport protein Sec61 subunit alpha | 6.33e-11 | 5.90e-11 | NA | 0.6004 |
| 2. PF | Q9HPB1 | Protein translocase subunit SecY | 1.09e-12 | 2.23e-24 | NA | 0.674 |
| 2. PF | P28541 | Protein translocase subunit SecY | 2.22e-15 | 1.52e-23 | NA | 0.6995 |
| 2. PF | P49978 | Protein translocase subunit SecY | 0.00e+00 | 6.88e-22 | NA | 0.6635 |
| 2. PF | Q7T277 | Protein transport protein Sec61 subunit alpha | 6.69e-11 | 7.62e-11 | NA | 0.6056 |
| 2. PF | Q8AY31 | Protein transport protein Sec61 subunit alpha | 6.30e-11 | 4.93e-11 | NA | 0.6147 |
| 3. BF | Q9XQU4 | Preprotein translocase subunit SECY, chloroplastic | 0.00e+00 | NA | 1.19e-59 | 0.8073 |
| 3. BF | P93690 | Preprotein translocase subunit SECY, chloroplastic | 0.00e+00 | NA | 7.44e-55 | 0.8029 |
| 4. PB | P9WGN3 | Protein translocase subunit SecY | 0.00e+00 | 6.11e-31 | 6.10e-74 | NA |
| 4. PB | O08387 | Protein translocase subunit SecY | 0.00e+00 | 1.44e-37 | 1.20e-91 | NA |
| 4. PB | Q2FUW2 | Accessory Sec system protein translocase subunit SecY2 | 0.00e+00 | 2.76e-22 | 1.54e-12 | NA |
| 4. PB | P0AGA2 | Protein translocase subunit SecY | 0.00e+00 | 1.41e-37 | 8.75e-50 | NA |
| 5. P | P76103 | Inner membrane protein YdcO | 1.76e-03 | 2.60e-04 | NA | NA |
| 5. P | B6JP50 | Na(+)/H(+) antiporter NhaA | 4.28e-03 | 3.71e-02 | NA | NA |
| 5. P | Q8NVI1 | Potassium-transporting ATPase potassium-binding subunit | 3.37e-03 | 4.77e-02 | NA | NA |
| 5. P | P23849 | Trk system potassium uptake protein TrkG | 2.39e-03 | 1.83e-05 | NA | NA |
| 5. P | Q5HEC3 | Potassium-transporting ATPase potassium-binding subunit | 1.80e-03 | 4.85e-02 | NA | NA |
| 5. P | O26076 | Na(+)/H(+) antiporter NhaA | 3.48e-03 | 3.50e-02 | NA | NA |
| 5. P | Q92Y37 | Na(+)/H(+) antiporter NhaA | 2.82e-03 | 2.60e-02 | NA | NA |
| 5. P | O42965 | Uncharacterized protein C19G7.17 | 3.22e-15 | 2.21e-17 | NA | NA |
| 5. P | Q8AY33 | Protein transport protein Sec61 subunit alpha | 1.07e-12 | 3.81e-11 | NA | NA |
| 5. P | A6QIS2 | Potassium-transporting ATPase potassium-binding subunit | 3.57e-03 | 4.85e-02 | NA | NA |
| 5. P | P61620 | Protein transport protein Sec61 subunit alpha isoform 1 | 1.01e-12 | 1.37e-10 | NA | NA |
| 5. P | Q48E39 | Na(+)/H(+) antiporter NhaA 2 | 1.39e-03 | 4.77e-02 | NA | NA |
| 5. P | A1WCI8 | Na(+)/H(+) antiporter NhaA | 1.77e-03 | 1.00e-03 | NA | NA |
| 5. P | P0AFZ9 | Trk system potassium uptake protein TrkH | 2.97e-03 | 1.96e-04 | NA | NA |
| 5. P | Q03583 | Putative O-antigen transporter | 1.38e-04 | 3.41e-02 | NA | NA |
| 5. P | Q54XK2 | Protein transport protein Sec61 subunit alpha | 1.39e-12 | 4.25e-10 | NA | NA |
| 5. P | Q8FAJ3 | Ascorbate-specific PTS system EIIC component | 2.66e-04 | 1.71e-02 | NA | NA |
| 5. P | P55340 | Protein EcsB | 1.29e-04 | 1.90e-02 | NA | NA |
| 5. P | F4I4Q3 | Protein DETOXIFICATION 32 | 4.79e-05 | 1.76e-02 | NA | NA |
| 5. P | Q25147 | Protein transport protein Sec61 subunit alpha | 7.41e-11 | 4.17e-11 | NA | NA |
| 5. P | P0AGN0 | Xanthine permease XanP | 3.00e-03 | 2.43e-02 | NA | NA |
| 5. P | Q68XS7 | ADP,ATP carrier protein 1 | 2.14e-04 | 2.88e-02 | NA | NA |
| 5. P | P44843 | Trk system potassium uptake protein TrkH | 3.69e-03 | 8.88e-04 | NA | NA |
| 5. P | P0AFZ8 | Trk system potassium uptake protein TrkH | 4.43e-03 | 1.96e-04 | NA | NA |
| 5. P | A4F6L1 | Na(+)/H(+) antiporter NhaA 1 | 9.92e-03 | 5.38e-03 | NA | NA |
| 5. P | Q2FF48 | Potassium-transporting ATPase potassium-binding subunit | 3.63e-03 | 4.85e-02 | NA | NA |
| 5. P | Q8D666 | Na(+)/H(+) antiporter NhaA 2 | 1.53e-03 | 3.25e-03 | NA | NA |
| 5. P | O84068 | ADP,ATP carrier protein 1 | 1.52e-05 | 3.59e-02 | NA | NA |
| 5. P | Q5PJ48 | Ascorbate-specific PTS system EIIC component | 8.90e-04 | 2.74e-02 | NA | NA |
| 5. P | A3PYK5 | Na(+)/H(+) antiporter NhaA 2 | 1.36e-03 | 3.35e-02 | NA | NA |
| 5. P | A8Z4Y0 | Potassium-transporting ATPase potassium-binding subunit | 4.16e-03 | 4.85e-02 | NA | NA |
| 5. P | P79088 | Protein transport protein sec61 subunit alpha | 2.89e-12 | 7.06e-11 | NA | NA |
| 5. P | Q8AY36 | Protein transport protein Sec61 subunit alpha | 6.59e-11 | 4.93e-11 | NA | NA |
| 5. P | Q98SN9 | Protein transport protein Sec61 subunit alpha isoform A | 8.29e-11 | 1.52e-10 | NA | NA |
| 5. P | Q87UW8 | Na(+)/H(+) antiporter NhaA 2 | 1.65e-03 | 1.80e-02 | NA | NA |
| 5. P | Q58880 | Uncharacterized cation transporter MJ1485 | 1.96e-03 | 1.26e-05 | NA | NA |
| 5. P | E1V6C5 | Trk system potassium uptake protein TrkH | 1.43e-03 | 6.34e-06 | NA | NA |
| 5. P | Q60175 | Protein translocase subunit SecY | 8.55e-15 | 2.96e-22 | NA | NA |
| 5. P | O87953 | Ktr system potassium uptake protein B | 2.30e-03 | 6.14e-06 | NA | NA |
| 5. P | Q90ZM2 | Protein transport protein Sec61 subunit alpha-like 1 | 8.77e-13 | 2.55e-11 | NA | NA |
| 5. P | P98004 | Quinol oxidase subunit 1 | 5.33e-04 | 2.10e-03 | NA | NA |
| 5. P | P61619 | Protein transport protein Sec61 subunit alpha isoform 1 | 8.16e-13 | 1.37e-10 | NA | NA |
| 5. P | Q9YDD0 | Protein translocase subunit SecY | 2.78e-15 | 1.40e-22 | NA | NA |
| 5. P | Q5EA68 | Protein transport protein Sec61 subunit alpha isoform 1 | 5.73e-11 | 2.10e-10 | NA | NA |
| 5. P | Q9R6X2 | Potassium-transporting ATPase potassium-binding subunit | 7.57e-04 | 2.16e-02 | NA | NA |
| 5. P | Q83II9 | Ascorbate-specific PTS system EIIC component | 8.53e-04 | 1.85e-02 | NA | NA |
| 5. P | Q48PL9 | Na(+)/H(+) antiporter NhaA 1 | 1.86e-02 | 2.51e-02 | NA | NA |
| 5. P | P75323 | Uncharacterized cation transporter MG322 homolog | 2.64e-03 | 4.11e-03 | NA | NA |
| 5. P | P57685 | Potassium-transporting ATPase potassium-binding subunit | 3.01e-03 | 3.21e-02 | NA | NA |
| 5. P | Q9ZJ68 | Na(+)/H(+) antiporter NhaA | 5.38e-03 | 3.77e-02 | NA | NA |
| 5. P | A7HH11 | Na(+)/H(+) antiporter NhaA | 7.29e-03 | 4.81e-02 | NA | NA |
| 5. P | P0AFZ7 | Trk system potassium uptake protein TrkH | 2.96e-03 | 1.96e-04 | NA | NA |
| 5. P | Q9KGA4 | Uncharacterized protein BH0208 | 9.26e-03 | 3.02e-05 | NA | NA |
| 5. P | Q7A4G4 | Potassium-transporting ATPase potassium-binding subunit 1 | 2.31e-03 | 4.46e-02 | NA | NA |
| 5. P | O29750 | Hdr-like menaquinol oxidoreductase integral membrane subunit | 1.59e-04 | 2.26e-03 | NA | NA |
| 5. P | O31658 | Ktr system potassium uptake protein D | 1.75e-03 | 1.41e-04 | NA | NA |
| 5. P | P39301 | Ascorbate-specific PTS system EIIC component | 6.54e-04 | 1.95e-02 | NA | NA |
| 5. P | Q9JLR1 | Protein transport protein Sec61 subunit alpha isoform 2 | 1.20e-12 | 6.61e-12 | NA | NA |
| 5. P | P39570 | Spore germination protein B2 | 3.40e-04 | 2.98e-02 | NA | NA |
| 5. P | O32081 | Ktr system potassium uptake protein B | 2.01e-03 | 3.05e-05 | NA | NA |
| 5. P | Q9HR72 | Putative dimethyl sulfoxide reductase membrane subunit C | 4.17e-04 | 5.76e-04 | NA | NA |
| 5. P | Q9H9S3 | Protein transport protein Sec61 subunit alpha isoform 2 | 7.07e-11 | 6.61e-12 | NA | NA |
| 5. P | Q4ZZI6 | Na(+)/H(+) antiporter NhaA 1 | 7.73e-04 | 1.73e-02 | NA | NA |
| 5. P | P47564 | Uncharacterized cation transporter MG322 | 5.46e-03 | 3.22e-03 | NA | NA |
| 5. P | Q5NVM7 | Protein transport protein Sec61 subunit alpha isoform 2 | 1.29e-10 | 3.06e-11 | NA | NA |
| 5. P | O33683 | Uncharacterized protein RA0937 | 5.19e-04 | 7.88e-03 | NA | NA |
| 5. P | Q752H7 | Protein transport protein SEC61 subunit alpha | 1.68e-09 | 6.71e-11 | NA | NA |
| 5. P | Q8XDJ5 | Ascorbate-specific PTS system EIIC component | 5.50e-04 | 3.50e-02 | NA | NA |
| 5. P | D6R8X8 | Hydantoin permease | 2.66e-03 | 2.81e-03 | NA | NA |
| 5. P | A5W1K7 | Na(+)/H(+) antiporter NhaA 2 | 3.95e-03 | 3.59e-02 | NA | NA |
| 5. P | Q99SH9 | Potassium-transporting ATPase potassium-binding subunit 1 | 2.22e-03 | 4.46e-02 | NA | NA |
| 5. P | P98008 | Nitric oxide reductase subunit B | 2.20e-04 | 3.00e-02 | NA | NA |
| 5. P | O66504 | Uncharacterized protein aq_097 | 4.01e-05 | 7.40e-03 | NA | NA |
| 5. P | P38353 | Sec sixty-one protein homolog | 7.44e-15 | 1.50e-13 | NA | NA |
| 5. P | Q87TN7 | Trk system potassium uptake protein TrkH | 5.65e-04 | 1.21e-05 | NA | NA |
| 5. P | Q3SNN8 | Na(+)/H(+) antiporter NhaA | 3.46e-03 | 4.73e-02 | NA | NA |
| 5. P | P0AGN2 | Xanthine permease XanP | 8.74e-04 | 2.43e-02 | NA | NA |
| 5. P | P43440 | Potassium/sodium uptake protein NtpJ | 1.43e-03 | 2.10e-06 | NA | NA |
| 5. P | P07775 | Benzoate membrane transport protein | 9.61e-04 | 7.34e-03 | NA | NA |
| 5. P | A8F302 | Na(+)/H(+) antiporter NhaA | 5.71e-03 | 3.84e-02 | NA | NA |
| 5. P | A1UF43 | Na(+)/H(+) antiporter NhaA 2 | 8.53e-04 | 3.62e-02 | NA | NA |
| 5. P | O32859 | Multidrug efflux pump Tap | 9.80e-05 | 4.85e-02 | NA | NA |
| 5. P | D8MQN9 | Multidrug resistance protein MdtG | 4.77e-04 | 4.53e-02 | NA | NA |
| 5. P | C5BG86 | Potassium-transporting ATPase potassium-binding subunit | 7.88e-04 | 1.39e-02 | NA | NA |
| 5. P | P38377 | Protein transport protein Sec61 subunit alpha isoform 1 | 3.62e-11 | 1.02e-10 | NA | NA |
| 5. P | P37746 | Putative O-antigen transporter | 1.09e-04 | 1.58e-02 | NA | NA |
| 5. P | Q9L6L2 | Trk system potassium uptake protein TrkH | 2.94e-03 | 6.64e-05 | NA | NA |
| 5. P | F4JKB9 | Protein DETOXIFICATION 38 | 1.86e-04 | 3.13e-02 | NA | NA |
| 5. P | Q6CPY9 | Protein transport protein SEC61 subunit alpha | 2.08e-09 | 2.83e-11 | NA | NA |
| 5. P | P78979 | Protein transport protein SEC61 subunit alpha | 1.29e-10 | 5.64e-06 | NA | NA |
| 5. P | Q870W0 | Protein transport protein SEC61 subunit alpha | 1.35e-10 | 4.02e-07 | NA | NA |
| 5. P | Q9LS19 | Protein DETOXIFICATION 30 | 1.39e-04 | 2.14e-02 | NA | NA |
| 5. P | Q57GJ9 | Ascorbate-specific PTS system EIIC component | 2.44e-04 | 1.56e-02 | NA | NA |
| 5. P | Q8YPE8 | Potassium-transporting ATPase potassium-binding subunit | 2.53e-03 | 9.64e-03 | NA | NA |
| 5. P | Q5R5L5 | Protein transport protein Sec61 subunit alpha isoform 1 | 1.07e-12 | 1.37e-10 | NA | NA |
| 5. P | Q8AY32 | Protein transport protein Sec61 subunit alpha | 1.24e-12 | 1.75e-11 | NA | NA |
| 5. P | Q9CKD8 | Na(+)/H(+) antiporter NhaA | 3.70e-03 | 2.49e-02 | NA | NA |
| 5. P | Q6BN08 | Protein transport protein SEC61 subunit alpha | 1.10e-10 | 1.92e-08 | NA | NA |
| 5. P | P0AGN1 | Xanthine permease XanP | 2.02e-03 | 2.43e-02 | NA | NA |
| 5. P | Q6FRY3 | Protein transport protein SEC61 subunit alpha | 1.03e-09 | 6.29e-11 | NA | NA |
| 5. P | Q28L40 | Na(+)/H(+) antiporter NhaA | 1.86e-03 | 4.00e-02 | NA | NA |
| 5. P | Q2KHX4 | Protein transport protein Sec61 subunit alpha isoform 2 | 1.37e-10 | 6.61e-12 | NA | NA |
| 5. P | Q57484 | Uncharacterized membrane protein HI_0867 | 1.69e-04 | 3.77e-02 | NA | NA |
| 5. P | P75810 | Inner membrane protein YbjJ | 7.23e-04 | 3.93e-02 | NA | NA |
| 5. P | Q2W4H6 | Na(+)/H(+) antiporter NhaA | 2.35e-03 | 4.85e-02 | NA | NA |
| 5. P | Q98SN8 | Protein transport protein Sec61 subunit alpha isoform B | 9.83e-13 | 1.02e-10 | NA | NA |
| 5. P | Q7UTY3 | Na(+)/H(+) antiporter NhaA | 1.46e-02 | 8.99e-03 | NA | NA |
| 5. P | P96792 | Isoprimeverose transporter | 1.66e-04 | 2.74e-02 | NA | NA |
| 5. P | Q7T278 | Protein transport protein Sec61 subunit alpha | 6.74e-11 | 7.62e-11 | NA | NA |
| 5. P | P44768 | Putrescine transporter PotE | 6.94e-05 | 4.17e-02 | NA | NA |
| 5. P | E1V6K4 | Trk system potassium uptake protein TrkI | 1.60e-03 | 1.47e-05 | NA | NA |
| 5. P | Q96TW8 | Protein transport protein SEC61 subunit alpha | 1.91e-09 | 4.40e-08 | NA | NA |
| 5. P | O67513 | Uncharacterized protein aq_1569 | 1.82e-04 | 1.70e-05 | NA | NA |
| 5. P | Q9UX84 | Protein translocase subunit SecY | 0.00e+00 | 5.95e-19 | NA | NA |
| 5. P | Q8ZK90 | Ascorbate-specific PTS system EIIC component | 1.05e-03 | 1.70e-02 | NA | NA |
| 5. P | P0C184 | Ascorbate-specific PTS system EIIC component | 2.72e-04 | 3.47e-02 | NA | NA |
| 5. P | P32915 | Protein transport protein SEC61 | 2.15e-11 | 1.99e-11 | NA | NA |
| 5. P | P37180 | Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit | 3.77e-04 | 3.14e-03 | NA | NA |
| 5. P | A0AM17 | Potassium-transporting ATPase potassium-binding subunit | 9.44e-04 | 4.50e-02 | NA | NA |
| 5. P | Q2FWH9 | Potassium-transporting ATPase potassium-binding subunit | 2.25e-03 | 4.85e-02 | NA | NA |
| 5. P | Q2NCP2 | Na(+)/H(+) antiporter NhaA 2 | 4.84e-03 | 1.25e-02 | NA | NA |
| 5. P | P0AGM9 | Xanthine permease XanP | 2.02e-03 | 2.43e-02 | NA | NA |
| 5. P | D9IA43 | Cbb3-type cytochrome c oxidase subunit CcoN1 | 7.28e-04 | 2.62e-02 | NA | NA |
| 5. P | Q9P8E3 | Protein transport protein SEC61 subunit alpha | 7.92e-12 | 1.90e-07 | NA | NA |
| 5. P | Q8Z172 | Ascorbate-specific PTS system EIIC component | 2.44e-04 | 2.51e-02 | NA | NA |
| 5. P | Q328K4 | Ascorbate-specific PTS system EIIC component | 9.35e-04 | 2.10e-02 | NA | NA |
| 5. P | Q90YL4 | Protein transport protein Sec61 subunit alpha-like 2 | 7.90e-13 | 4.80e-11 | NA | NA |
| 5. P | Q0K437 | Na(+)/H(+) antiporter NhaA | 1.60e-03 | 7.81e-03 | NA | NA |
| 5. P | Q6G7N2 | Potassium-transporting ATPase potassium-binding subunit | 2.60e-03 | 4.77e-02 | NA | NA |
| 5. P | Q38956 | Protein DETOXIFICATION 29 | 2.78e-04 | 4.00e-02 | NA | NA |
| 5. P | P61621 | Protein transport protein Sec61 subunit alpha isoform 1 | 1.30e-12 | 1.37e-10 | NA | NA |
| 7. B | F4IQV7 | Preprotein translocase subunit SCY2, chloroplastic | 1.11e-16 | NA | 4.00e-29 | NA |
| 7. B | Q38885 | Preprotein translocase subunit SCY1, chloroplastic | 0.00e+00 | NA | 1.75e-54 | NA |
| 7. B | P72179 | Protein translocase subunit SecY (Fragment) | 7.66e-07 | NA | 1.29e-20 | NA |
| 7. B | Q6ZG25 | Preprotein translocase subunit SECY, chloroplastic | 0.00e+00 | NA | 1.42e-53 | NA |
| 7. B | P28620 | Protein translocase subunit SecY (Fragment) | 6.94e-05 | NA | 1.20e-25 | NA |
| 7. B | O63066 | Preprotein translocase subunit SECY, chloroplastic | 0.00e+00 | NA | 2.72e-55 | NA |