Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54923.1
JCVISYN3A_0685

Sodium transporter.
M. mycoides homolog: Q6MSL2.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 124
Unique PROST Go: 107
Unique BLAST Go: 5
Unique Foldseek Go: 0

Total Homologs: 702
Unique PROST Homologs: 501
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 1

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: ktrB; potassium uptake protein
Zhang et al. [4]: GO:0071805|potassium ion transmembrane transport
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O31658 (Ktr system potassium uptake protein D) with a FATCAT P-Value: 0 and RMSD of 1.68 angstrom. The sequence alignment identity is 30.3%.
Structural alignment shown in left. Query protein AVX54923.1 colored as red in alignment, homolog O31658 colored as blue. Query protein AVX54923.1 is also shown in right top, homolog O31658 showed in right bottom. They are colored based on secondary structures.

  AVX54923.1 MFFKKKNNKKHKLKFTSRLFKKTSNFNEEKYKFFRLVKDIWPLSKTSEKIFLIYVAIILLGGLLLSIPNFSLTKSGSKYNWDFLTGIFIASSGFSDTGLT 100
      O31658 ----------------------------MRLKFGKLIQALSP----AQLIALYYFLAVTVAVILLSLP--AAHKPGA--DWTFIDALFTAVSSVSVTGLT 64

  AVX54923.1 VLDVSHSYTFWGQLILLLLIEFGGIGVLTFKIVLFLIINKKISISD-TIVAQSERGSATTSLTIDLIKDG-F--IWLTSVQVISAFIL--FFLFFFNQPS 194
      O31658 VVDTADTFSTIGIFILAFVLQFGGIGIMTLGTFIWLIMGKRIGLKERKLIMVDQNQSQFSGI-VNLMKQVLFLILW---IEFFGGLILGTYFLTYYD--S 158

  AVX54923.1 NNPNLEVVSPY-HDFWKSLWFAVFHSTSAVNNAGFDIISPNSLQPYNVDNHRVYAIQVIFMLEWIIGGLGYPTFHDIKRKL--KARKTKEKINFSLFTKI 291
      O31658 YQ---EA---YLHGF-----FA---SISATTNGGFD-ITGNSMIPFRHD----YFVQFITMLLIIFGAIGFPVLVEVKDFLFSKHR----RYPFTLFTKI 235

  AVX54923.1 NFWVY--LVLFIFGPLAVFATEYSNYNNSLIFHYYDENFTVLNAKS-NTVVFMDILFNTTASRNAGFSTIDISTFNSGSKAILSILMFIGSAPSSTAGGI 388
      O31658 TTITFGSLVL--FGAIGIFALE-AN-------H----AFA---GKSWHDILFLS-LFQSTATRSGGLATIDISQLSDSTLFFICALMFIGASPSSVGGGI 317

  AVX54923.1 RTTTFGVLLLSTFTIIKNQKFTSAFRKTI-PSETVNRSYAAFFISTFLIFIALFIIYVDSNSVFHTLKNHNSASINTI-LL--ITSAFGTVGLSPLA-HF 483
      O31658 RTTTFALNLLALFHFARGNKAVKVFKRELHPAD-LMKSLVVTMMAILLVFGATLILTI-------TEK-H---SL--LELLFEVCSAFGTTGLS-LGITA 402

  AVX54923.1 QMYQLGVVTKISLILIMFIGQLGVSNTLLIFL--KPARDKAYKYLEEDITIG 533
      O31658 DLSSVG---KCVIMIVMFIGRIGIL-TFL-YLIGRKEIEANYHYPKERVIIG 449

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0015379 potassium:chloride symporter activity
1. PBF GO:0006814 sodium ion transport
1. PBF GO:0071805 potassium ion transmembrane transport
1. PBF GO:0005886 plasma membrane
1. PBF GO:0008324 cation transmembrane transporter activity
1. PBF GO:0006813 potassium ion transport
2. PF GO:0005887 integral component of plasma membrane
2. PF GO:0005267 potassium channel activity
2. PF GO:0008556 P-type potassium transmembrane transporter activity
2. PF GO:0030955 potassium ion binding
3. BF GO:0030007 cellular potassium ion homeostasis
4. PB GO:0016021 integral component of membrane
5. P GO:0042910 xenobiotic transmembrane transporter activity
5. P GO:0006119 oxidative phosphorylation
5. P GO:0015108 chloride transmembrane transporter activity
5. P GO:0032047 mitosome
5. P GO:0005313 L-glutamate transmembrane transporter activity
5. P GO:0015814 p-aminobenzoyl-glutamate transport
5. P GO:0035524 proline transmembrane transport
5. P GO:0098796 membrane protein complex
5. P GO:0098721 uracil import across plasma membrane
5. P GO:0002060 purine nucleobase binding
5. P GO:0044667 (R)-carnitine:4-(trimethylammonio)butanoate antiporter activity
5. P GO:0015879 carnitine transport
5. P GO:0042942 D-serine transport
5. P GO:0009243 O antigen biosynthetic process
5. P GO:1902604 p-aminobenzoyl-glutamate transmembrane transport
5. P GO:0043952 protein transport by the Sec complex
5. P GO:0015218 pyrimidine nucleotide transmembrane transporter activity
5. P GO:0015944 formate oxidation
5. P GO:0004129 cytochrome-c oxidase activity
5. P GO:0045111 intermediate filament cytoskeleton
5. P GO:0036397 formate dehydrogenase (quinone) activity
5. P GO:0015813 L-glutamate transmembrane transport
5. P GO:0046872 metal ion binding
5. P GO:0015851 nucleobase transport
5. P GO:0070470 plasma membrane respirasome
5. P GO:1900751 4-(trimethylammonio)butanoate transport
5. P GO:0034707 chloride channel complex
5. P GO:0009060 aerobic respiration
5. P GO:0022857 transmembrane transporter activity
5. P GO:0015292 uniporter activity
5. P GO:0015210 uracil transmembrane transporter activity
5. P GO:0015293 symporter activity
5. P GO:0001504 neurotransmitter uptake
5. P GO:0065002 intracellular protein transmembrane transport
5. P GO:0036376 sodium ion export across plasma membrane
5. P GO:0098712 L-glutamate import across plasma membrane
5. P GO:0015990 electron transport coupled proton transport
5. P GO:0015764 N-acetylglucosamine transport
5. P GO:0046812 host cell surface binding
5. P GO:0005576 extracellular region
5. P GO:0019333 denitrification pathway
5. P GO:0015857 uracil transport
5. P GO:0031402 sodium ion binding
5. P GO:0031004 potassium ion-transporting ATPase complex
5. P GO:0090587 protein-phosphocysteine-glucosamine phosphotransferase system transporter activity
5. P GO:0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
5. P GO:1901367 response to L-cysteine
5. P GO:0044569 [Ni-Fe] hydrogenase complex
5. P GO:0015882 L-ascorbic acid transmembrane transport
5. P GO:0015856 cytosine transport
5. P GO:0034423 autophagosome lumen
5. P GO:0015209 cytosine transmembrane transporter activity
5. P GO:0090585 protein-phosphocysteine-L-ascorbate-phosphotransferase system transporter activity
5. P GO:0019858 cytosine metabolic process
5. P GO:0010447 response to acidic pH
5. P GO:0031522 cell envelope Sec protein transport complex
5. P GO:0015824 proline transport
5. P GO:0005314 high-affinity glutamate transmembrane transporter activity
5. P GO:0015577 galactitol transmembrane transporter activity
5. P GO:0015558 secondary active p-aminobenzoyl-glutamate transmembrane transporter activity
5. P GO:0071705 nitrogen compound transport
5. P GO:0015086 cadmium ion transmembrane transporter activity
5. P GO:0015297 antiporter activity
5. P GO:0015081 sodium ion transmembrane transporter activity
5. P GO:0071281 cellular response to iron ion
5. P GO:0005298 proline:sodium symporter activity
5. P GO:0005350 pyrimidine nucleobase transmembrane transporter activity
5. P GO:1901264 carbohydrate derivative transport
5. P GO:0015505 uracil:cation symporter activity
5. P GO:0045278 plasma membrane respiratory chain complex IV
5. P GO:0015691 cadmium ion transport
5. P GO:0008509 anion transmembrane transporter activity
5. P GO:0042907 xanthine transmembrane transporter activity
5. P GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
5. P GO:0042906 xanthine transport
5. P GO:0005524 ATP binding
5. P GO:0009093 cysteine catabolic process
5. P GO:0080167 response to karrikin
5. P GO:0015291 secondary active transmembrane transporter activity
5. P GO:0015774 polysaccharide transport
5. P GO:1902815 N,N'-diacetylchitobiose import
5. P GO:0006885 regulation of pH
5. P GO:0042925 benzoate transmembrane transporter activity
5. P GO:0009437 carnitine metabolic process
5. P GO:0005048 signal sequence binding
5. P GO:0046873 metal ion transmembrane transporter activity
5. P GO:0006865 amino acid transport
5. P GO:0015233 pantothenate transmembrane transporter activity
5. P GO:0015193 L-proline transmembrane transporter activity
5. P GO:1904082 pyrimidine nucleobase transmembrane transport
5. P GO:0016966 nitric oxide reductase activity
5. P GO:0019402 galactitol metabolic process
5. P GO:0005471 ATP:ADP antiporter activity
5. P GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
5. P GO:0034765 regulation of ion transmembrane transport
5. P GO:0062158 chloride:proton antiporter activity
5. P GO:0015887 pantothenate transmembrane transport
5. P GO:0005247 voltage-gated chloride channel activity
5. P GO:0019411 aerobic respiration, using ferrous ions as electron donor
5. P GO:0015205 nucleobase transmembrane transporter activity
5. P GO:0008320 protein transmembrane transporter activity
5. P GO:0090563 protein-phosphocysteine-sugar phosphotransferase activity
5. P GO:0005384 manganese ion transmembrane transporter activity
5. P GO:0098688 parallel fiber to Purkinje cell synapse
5. P GO:0006605 protein targeting
5. P GO:0006821 chloride transport
5. P GO:0015931 nucleobase-containing compound transport
7. B GO:0032153 cell division site
7. B GO:0140107 high-affinity potassium ion transmembrane transporter activity
7. B GO:1990573 potassium ion import across plasma membrane
7. B GO:0051286 cell tip
7. B GO:0015079 potassium ion transmembrane transporter activity

Uniprot GO Annotations

GO Description
GO:0055085 transmembrane transport
GO:0016021 integral component of membrane
GO:0006813 potassium ion transport
GO:0008324 cation transmembrane transporter activity
GO:0016020 membrane
GO:0098655 cation transmembrane transport
GO:0006811 ion transport
GO:0006812 cation transport

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF O31658 Ktr system potassium uptake protein D 0.00e+00 2.71e-19 1.83e-50 0.9227
1. PBF P43440 Potassium/sodium uptake protein NtpJ 0.00e+00 2.34e-19 3.78e-39 0.9085
1. PBF P75323 Uncharacterized cation transporter MG322 homolog 0.00e+00 1.18e-26 4.96e-56 0.8357
1. PBF O32081 Ktr system potassium uptake protein B 0.00e+00 7.00e-24 2.49e-44 0.9059
1. PBF P47564 Uncharacterized cation transporter MG322 0.00e+00 1.55e-29 7.32e-62 0.814
1. PBF O87953 Ktr system potassium uptake protein B 0.00e+00 3.09e-25 3.27e-30 0.8801
2. PF Q39SW6 Potassium-transporting ATPase potassium-binding subunit 7.50e-06 1.68e-05 NA 0.6059
2. PF A9VFM0 Potassium-transporting ATPase potassium-binding subunit 5.78e-08 8.07e-07 NA 0.5856
2. PF Q9XE11 Potassium-transporting ATPase potassium-binding subunit 7.16e-08 8.48e-05 NA 0.6071
2. PF Q5HEC3 Potassium-transporting ATPase potassium-binding subunit 2.05e-07 2.50e-07 NA 0.6021
2. PF B9JKQ7 Potassium-transporting ATPase potassium-binding subunit 6.97e-08 1.80e-04 NA 0.5699
2. PF B2V2P2 Potassium-transporting ATPase potassium-binding subunit 1.26e-05 1.30e-05 NA 0.5663
2. PF B7JY03 Potassium-transporting ATPase potassium-binding subunit 3.42e-05 1.83e-05 NA 0.6058
2. PF A5U173 Potassium-transporting ATPase potassium-binding subunit 2.04e-06 6.96e-06 NA 0.5666
2. PF A6QIS2 Potassium-transporting ATPase potassium-binding subunit 2.52e-07 2.50e-07 NA 0.6007
2. PF Q605R1 Potassium-transporting ATPase potassium-binding subunit 2.87e-05 2.96e-05 NA 0.5256
2. PF A6X5H8 Potassium-transporting ATPase potassium-binding subunit 4.81e-08 1.17e-04 NA 0.6086
2. PF P0AFZ9 Trk system potassium uptake protein TrkH 1.48e-10 3.36e-12 NA 0.6693
2. PF B1M7D7 Potassium-transporting ATPase potassium-binding subunit 4.97e-07 1.21e-05 NA 0.5623
2. PF C3LFA0 Potassium-transporting ATPase potassium-binding subunit 7.52e-08 3.95e-07 NA 0.5792
2. PF A9F773 Potassium-transporting ATPase potassium-binding subunit 2.21e-05 2.00e-07 NA 0.5913
2. PF Q8FJV3 Potassium-transporting ATPase potassium-binding subunit 1.15e-07 4.92e-04 NA 0.57
2. PF A1UKX6 Potassium-transporting ATPase potassium-binding subunit 3.05e-05 4.04e-07 NA 0.6323
2. PF Q6HN79 Potassium-transporting ATPase potassium-binding subunit 7.70e-08 2.28e-07 NA 0.5783
2. PF P44843 Trk system potassium uptake protein TrkH 9.52e-10 1.02e-09 NA 0.6529
2. PF Q72TM7 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 1.03e-06 NA 0.5962
2. PF Q7VVZ9 Potassium-transporting ATPase potassium-binding subunit 1.90e-05 3.23e-04 NA 0.5929
2. PF P0AFZ8 Trk system potassium uptake protein TrkH 1.42e-10 3.36e-12 NA 0.6678
2. PF Q81HQ1 Potassium-transporting ATPase potassium-binding subunit 7.50e-08 7.94e-06 NA 0.5821
2. PF B8I9I5 Potassium-transporting ATPase potassium-binding subunit 1.04e-05 1.85e-05 NA 0.5496
2. PF C1A1E9 Potassium-transporting ATPase potassium-binding subunit 1.06e-06 7.12e-07 NA 0.5964
2. PF P57684 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 5.76e-05 NA 0.5708
2. PF Q93XI5 Cation transporter HKT2 2.38e-08 7.91e-04 NA 0.5909
2. PF Q9X900 Potassium-transporting ATPase potassium-binding subunit 6.42e-07 5.46e-07 NA 0.5793
2. PF Q5KUV3 Potassium-transporting ATPase potassium-binding subunit 1.12e-08 9.77e-06 NA 0.5759
2. PF Q2FF48 Potassium-transporting ATPase potassium-binding subunit 3.21e-07 2.50e-07 NA 0.5928
2. PF B5EZE4 Potassium-transporting ATPase potassium-binding subunit 8.91e-08 9.62e-04 NA 0.5678
2. PF Q4LAI3 Potassium-transporting ATPase potassium-binding subunit 3.97e-07 2.84e-05 NA 0.5921
2. PF Q741T7 Potassium-transporting ATPase potassium-binding subunit 4.35e-07 1.09e-05 NA 0.5828
2. PF A0RA12 Potassium-transporting ATPase potassium-binding subunit 5.36e-08 2.88e-07 NA 0.5802
2. PF Q63VS3 Potassium-transporting ATPase potassium-binding subunit 1.30e-05 2.60e-03 NA 0.5702
2. PF B7HWG0 Potassium-transporting ATPase potassium-binding subunit 5.43e-08 2.53e-07 NA 0.5797
2. PF A0QBY3 Potassium-transporting ATPase potassium-binding subunit 4.32e-07 2.34e-05 NA 0.5945
2. PF P0A057 Potassium-transporting ATPase potassium-binding subunit 2 3.83e-08 5.03e-05 NA 0.5937
2. PF A1TED2 Potassium-transporting ATPase potassium-binding subunit 5.49e-07 2.72e-07 NA 0.6137
2. PF B8J1E9 Potassium-transporting ATPase potassium-binding subunit 2.92e-05 5.82e-04 NA 0.5713
2. PF A6L5D2 Potassium-transporting ATPase potassium-binding subunit 3.70e-07 7.12e-06 NA 0.5163
2. PF Q83S83 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 5.94e-04 NA 0.5679
2. PF B7HDF8 Potassium-transporting ATPase potassium-binding subunit 7.35e-08 5.53e-06 NA 0.5789
2. PF A1VTC2 Potassium-transporting ATPase potassium-binding subunit 6.35e-07 2.59e-06 NA 0.5747
2. PF B7L1M9 Potassium-transporting ATPase potassium-binding subunit 8.19e-06 3.96e-06 NA 0.5513
2. PF P0A056 Potassium-transporting ATPase potassium-binding subunit 2 1.44e-07 5.03e-05 NA 0.5958
2. PF E1V6C5 Trk system potassium uptake protein TrkH 1.27e-10 2.17e-12 NA 0.6702
2. PF Q2YUH6 Potassium-transporting ATPase potassium-binding subunit 2.17e-07 1.32e-07 NA 0.6084
2. PF B1W3K2 Potassium-transporting ATPase potassium-binding subunit 6.40e-07 5.09e-08 NA 0.5926
2. PF Q7NXM7 Potassium-transporting ATPase potassium-binding subunit 1.13e-05 9.21e-05 NA 0.5848
2. PF C1AM21 Potassium-transporting ATPase potassium-binding subunit 3.35e-05 6.96e-06 NA 0.5664
2. PF Q8XU12 Potassium-transporting ATPase potassium-binding subunit 3.13e-05 4.34e-05 NA 0.5747
2. PF C5CPD4 Potassium-transporting ATPase potassium-binding subunit 8.76e-08 3.23e-04 NA 0.5856
2. PF Q883V6 Potassium-transporting ATPase potassium-binding subunit 8.05e-07 2.51e-06 NA 0.5788
2. PF A1TJ24 Potassium-transporting ATPase potassium-binding subunit 7.46e-07 2.62e-03 NA 0.5768
2. PF Q9R6X2 Potassium-transporting ATPase potassium-binding subunit 2.55e-07 2.65e-06 NA 0.5726
2. PF B5EH80 Potassium-transporting ATPase potassium-binding subunit 2.62e-05 6.88e-05 NA 0.5862
2. PF C4ZWH4 Potassium-transporting ATPase potassium-binding subunit 1.18e-07 2.39e-04 NA 0.5694
2. PF Q9RZN7 Potassium-transporting ATPase potassium-binding subunit 6.44e-07 4.81e-07 NA 0.5577
2. PF A9MUD9 Potassium-transporting ATPase potassium-binding subunit 9.23e-08 9.62e-04 NA 0.5636
2. PF Q6D7I3 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 1.39e-04 NA 0.5754
2. PF A6LIU6 Potassium-transporting ATPase potassium-binding subunit 1.45e-07 5.59e-07 NA 0.5506
2. PF A6H086 Potassium-transporting ATPase potassium-binding subunit 1.04e-07 8.96e-06 NA 0.542
2. PF B2TMJ1 Potassium-transporting ATPase potassium-binding subunit 1.31e-05 6.31e-06 NA 0.5566
2. PF A6SZ16 Potassium-transporting ATPase potassium-binding subunit 3.85e-05 9.60e-05 NA 0.588
2. PF B0R9L9 Potassium-transporting ATPase potassium-binding subunit 1.06e-06 5.76e-05 NA 0.5694
2. PF C6DCB6 Potassium-transporting ATPase potassium-binding subunit 2.09e-07 3.40e-04 NA 0.5755
2. PF P57685 Potassium-transporting ATPase potassium-binding subunit 2.80e-06 1.08e-08 NA 0.5134
2. PF Q1C585 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 4.43e-06 NA 0.59
2. PF B3DWK0 Potassium-transporting ATPase potassium-binding subunit 1.54e-07 1.08e-02 NA 0.5191
2. PF Q2KWC8 Potassium-transporting ATPase potassium-binding subunit 1.55e-05 3.55e-03 NA 0.5773
2. PF A9C190 Potassium-transporting ATPase potassium-binding subunit 5.67e-08 3.68e-07 NA 0.5924
2. PF Q7A4G4 Potassium-transporting ATPase potassium-binding subunit 1 4.82e-08 3.02e-07 NA 0.5933
2. PF Q927F9 Potassium-transporting ATPase potassium-binding subunit 5.62e-07 6.95e-08 NA 0.5264
2. PF C1D7X0 Potassium-transporting ATPase potassium-binding subunit 8.13e-07 2.40e-08 NA 0.5957
2. PF Q8U9D8 Potassium-transporting ATPase potassium-binding subunit 3.20e-07 6.83e-03 NA 0.5743
2. PF A9VZA2 Potassium-transporting ATPase potassium-binding subunit 3.63e-07 2.53e-05 NA 0.5626
2. PF C3K4Y3 Potassium-transporting ATPase potassium-binding subunit 1.48e-07 1.32e-06 NA 0.5738
2. PF B8DAW0 Potassium-transporting ATPase potassium-binding subunit 4.14e-05 1.03e-07 NA 0.525
2. PF Q64YU9 Potassium-transporting ATPase potassium-binding subunit 3.51e-07 2.47e-05 NA 0.5265
2. PF Q47H38 Potassium-transporting ATPase potassium-binding subunit 3.58e-05 5.12e-03 NA 0.5441
2. PF B0SYJ7 Potassium-transporting ATPase potassium-binding subunit 1.05e-07 1.55e-02 NA 0.5687
2. PF Q0TRT4 Potassium-transporting ATPase potassium-binding subunit 2.15e-05 2.78e-05 NA 0.5268
2. PF B2IIP5 Potassium-transporting ATPase potassium-binding subunit 7.07e-07 8.21e-03 NA 0.5254
2. PF C1FA47 Potassium-transporting ATPase potassium-binding subunit 1.98e-05 2.41e-04 NA 0.561
2. PF A0R395 Potassium-transporting ATPase potassium-binding subunit 4.13e-07 3.20e-07 NA 0.5749
2. PF B9J529 Potassium-transporting ATPase potassium-binding subunit 6.84e-08 3.31e-07 NA 0.5796
2. PF A3Q5E2 Potassium-transporting ATPase potassium-binding subunit 2.96e-05 7.45e-07 NA 0.6227
2. PF B0JJ94 Potassium-transporting ATPase potassium-binding subunit 6.78e-07 2.71e-06 NA 0.5822
2. PF A0Q8L0 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 3.75e-06 NA 0.575
2. PF Q3K8Y4 Potassium-transporting ATPase potassium-binding subunit 1.82e-07 2.22e-05 NA 0.5244
2. PF A2SIS3 Potassium-transporting ATPase potassium-binding subunit 2.57e-07 7.03e-07 NA 0.5834
2. PF B0TWK0 Potassium-transporting ATPase potassium-binding subunit 1.36e-07 8.76e-06 NA 0.5894
2. PF Q74AB0 Potassium-transporting ATPase potassium-binding subunit 7.86e-06 3.09e-05 NA 0.6054
2. PF Q0BVS2 Potassium-transporting ATPase potassium-binding subunit 6.91e-08 1.28e-03 NA 0.5471
2. PF Q97BF7 Potassium-transporting ATPase potassium-binding subunit 4.24e-07 4.29e-08 NA 0.5765
2. PF Q87TN7 Trk system potassium uptake protein TrkH 1.01e-10 6.82e-13 NA 0.6563
2. PF B4SZB2 Potassium-transporting ATPase potassium-binding subunit 1.33e-07 8.81e-04 NA 0.5776
2. PF Q63FR1 Potassium-transporting ATPase potassium-binding subunit 7.58e-08 1.07e-06 NA 0.5906
2. PF A8AJB7 Potassium-transporting ATPase potassium-binding subunit 8.72e-08 1.67e-03 NA 0.5735
2. PF A5CUP8 Potassium-transporting ATPase potassium-binding subunit 8.72e-07 3.82e-05 NA 0.5694
2. PF Q82PI3 Potassium-transporting ATPase potassium-binding subunit 6.53e-07 4.28e-06 NA 0.5749
2. PF A4G5J9 Potassium-transporting ATPase potassium-binding subunit 3.23e-05 1.05e-04 NA 0.5893
2. PF B7II08 Potassium-transporting ATPase potassium-binding subunit 7.48e-08 7.94e-06 NA 0.5813
2. PF Q2IPD5 Potassium-transporting ATPase potassium-binding subunit 2.40e-05 2.50e-05 NA 0.6035
2. PF Q5YZH9 Potassium-transporting ATPase potassium-binding subunit 1.03e-06 5.23e-06 NA 0.5886
2. PF Q725T6 Potassium-transporting ATPase potassium-binding subunit 9.61e-08 3.35e-03 NA 0.5869
2. PF C4XKM8 Potassium-transporting ATPase potassium-binding subunit 1.04e-06 6.37e-04 NA 0.5316
2. PF A7ZXV9 Potassium-transporting ATPase potassium-binding subunit 1.18e-07 1.57e-04 NA 0.5663
2. PF A4IVV7 Potassium-transporting ATPase potassium-binding subunit 1.68e-07 1.52e-05 NA 0.5955
2. PF Q89FC2 Potassium-transporting ATPase potassium-binding subunit 2.75e-07 9.48e-07 NA 0.5569
2. PF Q62IJ6 Potassium-transporting ATPase potassium-binding subunit 1.46e-05 6.96e-03 NA 0.5134
2. PF Q2A1A6 Potassium-transporting ATPase potassium-binding subunit 1.65e-07 4.48e-06 NA 0.5715
2. PF A1V9G1 Potassium-transporting ATPase potassium-binding subunit 9.40e-08 1.43e-03 NA 0.5899
2. PF A9AXU9 Potassium-transporting ATPase potassium-binding subunit 9.30e-06 5.02e-03 NA 0.5648
2. PF Q9L6L2 Trk system potassium uptake protein TrkH 1.44e-10 1.76e-12 NA 0.6412
2. PF A2WNZ9 Cation transporter HKT8 2.38e-07 4.13e-03 NA 0.5815
2. PF O32327 Potassium-transporting ATPase potassium-binding subunit 1.74e-07 2.42e-07 NA 0.5779
2. PF Q71W89 Potassium-transporting ATPase potassium-binding subunit 1.50e-06 2.91e-07 NA 0.5467
2. PF B1JR97 Potassium-transporting ATPase potassium-binding subunit 1.28e-07 3.10e-06 NA 0.5976
2. PF A7ZJ81 Potassium-transporting ATPase potassium-binding subunit 7.83e-08 3.95e-04 NA 0.5744
2. PF A9R3X4 Potassium-transporting ATPase potassium-binding subunit 1.28e-07 4.43e-06 NA 0.5933
2. PF Q73DA4 Potassium-transporting ATPase potassium-binding subunit 7.35e-08 3.24e-07 NA 0.5857
2. PF P73866 Potassium-transporting ATPase potassium-binding subunit 6.00e-07 4.97e-05 NA 0.5369
2. PF A7NER4 Potassium-transporting ATPase potassium-binding subunit 1.02e-07 4.48e-06 NA 0.5948
2. PF B4TQ23 Potassium-transporting ATPase potassium-binding subunit 8.82e-08 1.37e-03 NA 0.5701
2. PF Q7NN41 Potassium-transporting ATPase potassium-binding subunit 2.71e-07 9.07e-04 NA 0.5601
2. PF Q8YPE8 Potassium-transporting ATPase potassium-binding subunit 1.86e-07 1.22e-07 NA 0.5771
2. PF B1Z9Y2 Potassium-transporting ATPase potassium-binding subunit 1.02e-07 3.47e-04 NA 0.5945
2. PF Q5HK63 Potassium-transporting ATPase potassium-binding subunit 2.65e-07 5.03e-05 NA 0.5835
2. PF Q81UW7 Potassium-transporting ATPase potassium-binding subunit 5.30e-08 3.95e-07 NA 0.5849
2. PF Q6GEZ6 Potassium-transporting ATPase potassium-binding subunit 1 3.22e-07 4.48e-07 NA 0.5931
2. PF B1X6M9 Potassium-transporting ATPase potassium-binding subunit 1.19e-07 2.39e-04 NA 0.57
2. PF A9MK88 Potassium-transporting ATPase potassium-binding subunit 1.14e-07 1.29e-04 NA 0.5717
2. PF B1IY31 Potassium-transporting ATPase potassium-binding subunit 1.19e-07 1.57e-04 NA 0.5653
2. PF B5YQP0 Potassium-transporting ATPase potassium-binding subunit 1.15e-07 1.58e-03 NA 0.569
2. PF B7MPK1 Potassium-transporting ATPase potassium-binding subunit 8.80e-08 1.29e-04 NA 0.5718
2. PF A1KHG8 Potassium-transporting ATPase potassium-binding subunit 3.39e-05 6.96e-06 NA 0.5645
2. PF Q92XI9 Potassium-transporting ATPase potassium-binding subunit 1.40e-07 7.38e-04 NA 0.6005
2. PF B2UH25 Potassium-transporting ATPase potassium-binding subunit 2.94e-05 2.13e-03 NA 0.5752
2. PF Q2W612 Potassium-transporting ATPase potassium-binding subunit 3.69e-08 1.77e-05 NA 0.5419
2. PF B5BCA3 Potassium-transporting ATPase potassium-binding subunit 9.10e-08 9.62e-04 NA 0.5697
2. PF B8GVF8 Potassium-transporting ATPase potassium-binding subunit 5.12e-08 3.61e-04 NA 0.5729
2. PF E1V6K4 Trk system potassium uptake protein TrkI 4.73e-11 2.27e-15 NA 0.6347
2. PF Q7WCL8 Potassium-transporting ATPase potassium-binding subunit 1.25e-05 3.11e-04 NA 0.5855
2. PF B2VJK4 Potassium-transporting ATPase potassium-binding subunit 3.17e-07 2.42e-07 NA 0.579
2. PF B7M5L4 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 3.95e-04 NA 0.5738
2. PF B2SEB4 Potassium-transporting ATPase potassium-binding subunit 2.13e-07 1.09e-05 NA 0.6018
2. PF C1AUJ4 Potassium-transporting ATPase potassium-binding subunit 1.06e-06 5.47e-06 NA 0.5882
2. PF Q8F1M1 Potassium-transporting ATPase potassium-binding subunit 1.03e-07 1.18e-05 NA 0.5993
2. PF A5GAG2 Potassium-transporting ATPase potassium-binding subunit 2.20e-05 8.64e-04 NA 0.6024
2. PF Q2RV89 Potassium-transporting ATPase potassium-binding subunit 6.17e-08 1.03e-03 NA 0.5535
2. PF Q6GKN4 Potassium-transporting ATPase potassium-binding subunit 2 3.24e-08 5.03e-05 NA 0.6098
2. PF Q8ZD96 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 4.43e-06 NA 0.575
2. PF Q0TJY8 Potassium-transporting ATPase potassium-binding subunit 1.11e-07 4.11e-04 NA 0.5735
2. PF Q02CX7 Potassium-transporting ATPase potassium-binding subunit 6.11e-08 6.95e-07 NA 0.6051
2. PF B6IQY9 Potassium-transporting ATPase potassium-binding subunit 1.85e-07 1.19e-04 NA 0.5707
2. PF P65210 Potassium-transporting ATPase potassium-binding subunit 1.09e-06 6.96e-06 NA 0.5658
2. PF Q5PCJ8 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 9.62e-04 NA 0.5706
2. PF A0AM17 Potassium-transporting ATPase potassium-binding subunit 4.15e-05 6.09e-08 NA 0.5267
2. PF B1MDL1 Potassium-transporting ATPase potassium-binding subunit 6.35e-07 2.75e-04 NA 0.5726
2. PF Q8Y3Z6 Potassium-transporting ATPase potassium-binding subunit 4.02e-05 1.84e-07 NA 0.5269
2. PF Q1I7N9 Potassium-transporting ATPase potassium-binding subunit 1.45e-07 5.47e-05 NA 0.5273
2. PF Q5LHU7 Potassium-transporting ATPase potassium-binding subunit 1.17e-07 2.47e-05 NA 0.5571
2. PF C1EYJ9 Potassium-transporting ATPase potassium-binding subunit 7.09e-08 4.54e-07 NA 0.5826
2. PF Q88FD7 Potassium-transporting ATPase potassium-binding subunit 1.31e-07 2.96e-05 NA 0.5213
2. PF A4TL05 Potassium-transporting ATPase potassium-binding subunit 1.27e-07 4.43e-06 NA 0.5908
2. PF Q9A7X8 Potassium-transporting ATPase potassium-binding subunit 5.05e-08 3.61e-04 NA 0.5751
2. PF P9WKF2 Potassium-transporting ATPase potassium-binding subunit 2.07e-06 6.96e-06 NA 0.5661
2. PF Q7W536 Potassium-transporting ATPase potassium-binding subunit 3.21e-05 3.47e-04 NA 0.576
2. PF Q8R8I5 Potassium-transporting ATPase potassium-binding subunit 4.32e-07 6.55e-08 NA 0.582
2. PF P57683 Potassium-transporting ATPase potassium-binding subunit 7.06e-08 6.45e-06 NA 0.5018
2. PF A2YGP9 Cation transporter HKT1 1.84e-08 2.60e-03 NA 0.5902
2. PF C3P0L9 Potassium-transporting ATPase potassium-binding subunit 5.59e-08 3.95e-07 NA 0.5827
2. PF C1KZN6 Potassium-transporting ATPase potassium-binding subunit 4.27e-07 3.64e-07 NA 0.5282
2. PF Q98GX5 Potassium-transporting ATPase potassium-binding subunit 7.19e-08 2.34e-03 NA 0.5753
2. PF B9K2I3 Potassium-transporting ATPase potassium-binding subunit 5.09e-07 2.74e-06 NA 0.5829
2. PF B6HYQ6 Potassium-transporting ATPase potassium-binding subunit 1.17e-07 3.95e-04 NA 0.5736
2. PF A4SZG9 Potassium-transporting ATPase potassium-binding subunit 2.23e-05 1.97e-03 NA 0.5737
2. PF Q6N5H0 Potassium-transporting ATPase potassium-binding subunit 6.29e-08 1.38e-06 NA 0.5857
2. PF A5FIF9 Potassium-transporting ATPase potassium-binding subunit 4.10e-05 5.08e-05 NA 0.5347
2. PF Q6G7N2 Potassium-transporting ATPase potassium-binding subunit 5.64e-08 1.98e-07 NA 0.599
2. PF Q0BK20 Potassium-transporting ATPase potassium-binding subunit 9.20e-08 4.48e-06 NA 0.5781
2. PF Q0RF16 Potassium-transporting ATPase potassium-binding subunit 1.50e-06 3.00e-06 NA 0.5597
2. PF Q8A519 Potassium-transporting ATPase potassium-binding subunit 3.22e-07 1.10e-05 NA 0.5247
2. PF C4LDL6 Potassium-transporting ATPase potassium-binding subunit 2.41e-05 1.27e-05 NA 0.5848
2. PF B4U8E3 Potassium-transporting ATPase potassium-binding subunit 3.91e-05 8.84e-03 NA 0.5539
2. PF Q7N6W5 Potassium-transporting ATPase potassium-binding subunit 4.57e-07 2.05e-07 NA 0.5734
2. PF Q1B453 Potassium-transporting ATPase potassium-binding subunit 3.00e-05 4.04e-07 NA 0.5912
2. PF Q0SHD0 Potassium-transporting ATPase potassium-binding subunit 6.59e-07 1.37e-03 NA 0.5882
2. PF B7JRB7 Potassium-transporting ATPase potassium-binding subunit 6.49e-08 3.16e-07 NA 0.5709
2. PF A7I5F0 Potassium-transporting ATPase potassium-binding subunit 2.31e-07 3.57e-04 NA 0.5907
2. PF B0RCI3 Potassium-transporting ATPase potassium-binding subunit 8.95e-07 1.23e-04 NA 0.579
5. P P9WLW0 Uncharacterized protein MT1558/MT1560 3.07e-03 9.96e-03 NA NA
5. P Q8NN75 Betaine/ectoine transporter LcoP 8.31e-03 4.33e-06 NA NA
5. P P23849 Trk system potassium uptake protein TrkG 2.33e-11 3.34e-13 NA NA
5. P C0PZC8 Divalent metal cation transporter MntH 3.84e-04 5.17e-03 NA NA
5. P A7MQU8 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 7.80e-05 NA NA
5. P Q0TF69 Divalent metal cation transporter MntH 3.77e-03 1.73e-02 NA NA
5. P O35921 Excitatory amino acid transporter 4 4.77e-03 3.35e-02 NA NA
5. P Q1RIG3 ADP,ATP carrier protein 4 1.09e-03 1.00e-02 NA NA
5. P P0AAA7 Lipid III flippase 2.95e-04 1.84e-02 NA NA
5. P Q0B8F7 Divalent metal cation transporter MntH 2.97e-03 9.78e-03 NA NA
5. P A7MIL1 Na(+)/H(+) antiporter NhaA 9.98e-03 2.37e-02 NA NA
5. P B5BL83 H(+)/Cl(-) exchange transporter ClcA 4.56e-03 1.63e-02 NA NA
5. P Q7A468 Protein translocase subunit SecY 3.70e-03 1.82e-03 NA NA
5. P Q9X1I9 Protein translocase subunit SecY 2.56e-03 2.71e-02 NA NA
5. P P67730 Putative ion-transport protein YfeO 3.94e-03 1.57e-02 NA NA
5. P P0A771 Divalent metal cation transporter MntH 3.83e-03 1.73e-02 NA NA
5. P P67445 Xanthine permease XanQ 8.02e-03 1.44e-05 NA NA
5. P P0AGN0 Xanthine permease XanP 5.75e-03 2.53e-05 NA NA
5. P A7FFR1 Potassium-transporting ATPase potassium-binding subunit 1.28e-07 2.05e-06 NA NA
5. P P45117 Probable uracil permease 1.46e-02 7.83e-04 NA NA
5. P Q3YZE0 Divalent metal cation transporter MntH 3.78e-03 1.73e-02 NA NA
5. P B5RCN6 Divalent metal cation transporter MntH 3.68e-04 1.05e-02 NA NA
5. P B5F8R6 H(+)/Cl(-) exchange transporter ClcA 5.47e-03 1.60e-02 NA NA
5. P A5FT52 Na(+)/H(+) antiporter NhaA 2 8.39e-03 1.32e-04 NA NA
5. P Q9PA34 Probable multidrug resistance protein NorM 2.89e-04 4.17e-02 NA NA
5. P A4F6L1 Na(+)/H(+) antiporter NhaA 1 2.32e-02 1.57e-02 NA NA
5. P Q8UEM1 Divalent metal cation transporter MntH 8.21e-03 3.29e-03 NA NA
5. P B2U300 H(+)/Cl(-) exchange transporter ClcA 6.07e-03 3.04e-02 NA NA
5. P P59333 L-carnitine/gamma-butyrobetaine antiporter 3.39e-03 3.83e-03 NA NA
5. P B7M0D7 L-carnitine/gamma-butyrobetaine antiporter 3.05e-03 4.58e-03 NA NA
5. P Q8ZRP8 H(+)/Cl(-) exchange transporter ClcA 5.59e-03 1.37e-02 NA NA
5. P Q8ZQW1 Potassium-transporting ATPase potassium-binding subunit 8.91e-08 3.04e-04 NA NA
5. P A6W6R5 Potassium-transporting ATPase potassium-binding subunit 8.60e-07 1.06e-07 NA NA
5. P B7NPS9 Divalent metal cation transporter MntH 3.94e-03 1.73e-02 NA NA
5. P A1WR47 Divalent metal cation transporter MntH 1.96e-03 2.29e-03 NA NA
5. P Q1RG33 H(+)/Cl(-) exchange transporter ClcA 1.03e-02 3.38e-02 NA NA
5. P Q9ZDE9 Uncharacterized protein RP382 8.08e-04 5.02e-04 NA NA
5. P Q45400 PTS system cellobiose-specific EIIC component 2.18e-03 2.54e-04 NA NA
5. P Q58880 Uncharacterized cation transporter MJ1485 1.87e-11 1.07e-12 NA NA
5. P B6I6U0 Putative ion-transport protein YfeO 1.38e-03 1.61e-02 NA NA
5. P P98056 Cytochrome c oxidase subunit 1 homolog 1.43e-03 2.64e-04 NA NA
5. P O08387 Protein translocase subunit SecY 3.99e-03 1.82e-03 NA NA
5. P A5CM04 Na(+)/H(+) antiporter NhaA 1 1.93e-02 1.23e-02 NA NA
5. P P59335 L-carnitine/gamma-butyrobetaine antiporter 3.11e-03 3.97e-03 NA NA
5. P B5FJ02 H(+)/Cl(-) exchange transporter ClcA 4.75e-03 1.60e-02 NA NA
5. P Q4UN85 ADP,ATP carrier protein 1 1.18e-03 2.95e-04 NA NA
5. P B5BB80 Divalent metal cation transporter MntH 3.68e-04 6.46e-03 NA NA
5. P P37781 Putative O-antigen transporter 4.46e-04 1.67e-02 NA NA
5. P B5R671 Potassium-transporting ATPase potassium-binding subunit 1.30e-07 9.62e-04 NA NA
5. P P33390 Protein DVU_0534 1.67e-03 9.78e-03 NA NA
5. P Q7A086 Protein translocase subunit SecY 4.60e-03 1.82e-03 NA NA
5. P Q69LA1 Probable proline transporter 2 1.07e-02 2.43e-03 NA NA
5. P Q8G2I1 Probable multidrug resistance protein NorM 2.11e-03 1.93e-02 NA NA
5. P A8A2P3 Putative ion-transport protein YfeO 1.10e-03 1.63e-02 NA NA
5. P Q1QZ83 Divalent metal cation transporter MntH 2.13e-03 3.01e-02 NA NA
5. P B7N5Z0 Putative ion-transport protein YfeO 1.08e-03 7.22e-03 NA NA
5. P P65545 Divalent metal cation transporter MntH 7.72e-03 9.09e-03 NA NA
5. P A9N0Q1 H(+)/Cl(-) exchange transporter ClcA 2.50e-03 1.43e-02 NA NA
5. P Q9RPF3 Divalent metal cation transporter MntH 1 7.18e-03 1.60e-02 NA NA
5. P Q30XM9 Na(+)/H(+) antiporter NhaA 6.41e-03 2.31e-02 NA NA
5. P B7MFW3 Potassium-transporting ATPase potassium-binding subunit 1.19e-07 6.49e-04 NA NA
5. P B3W6P3 Divalent metal cation transporter MntH 5.62e-03 3.59e-02 NA NA
5. P Q37143 Protein translocase subunit SecY 8.25e-03 9.51e-03 NA NA
5. P Q9HR72 Putative dimethyl sulfoxide reductase membrane subunit C 1.25e-03 2.04e-02 NA NA
5. P B1LEU5 Voltage-gated ClC-type chloride channel ClcB 2.40e-03 3.69e-02 NA NA
5. P Q8FFD3 Putative ion-transport protein YfeO 1.10e-03 2.41e-02 NA NA
5. P A7ZHP7 H(+)/Cl(-) exchange transporter ClcA 7.77e-03 2.85e-02 NA NA
5. P P58244 H(+)/Cl(-) exchange transporter ClcA 5.23e-03 2.91e-02 NA NA
5. P P39584 Putative permease IIC component YwbA 9.91e-04 3.99e-02 NA NA
5. P P16256 Sodium/pantothenate symporter 5.04e-03 1.42e-03 NA NA
5. P Q1R8X4 Divalent metal cation transporter MntH 3.85e-03 1.73e-02 NA NA
5. P D6R8X8 Hydantoin permease 1.22e-02 1.25e-03 NA NA
5. P Q12P61 Na(+)/H(+) antiporter NhaA 1 2.01e-02 2.25e-02 NA NA
5. P B7MNP7 L-carnitine/gamma-butyrobetaine antiporter 3.45e-03 4.09e-03 NA NA
5. P O66504 Uncharacterized protein aq_097 2.54e-03 1.93e-04 NA NA
5. P P0A769 Divalent metal cation transporter MntH 3.80e-03 1.73e-02 NA NA
5. P P41006 Uracil permease 1.43e-02 3.30e-04 NA NA
5. P Q4UN46 ADP,ATP carrier protein 5 1.78e-03 4.15e-04 NA NA
5. P Q87J97 Glycine betaine transporter 2 4.66e-03 1.06e-03 NA NA
5. P B7NMQ1 Potassium-transporting ATPase potassium-binding subunit 1.14e-07 1.43e-03 NA NA
5. P P0AA83 Cytosine permease 1.02e-02 2.72e-04 NA NA
5. P Q9CPL9 Probable uracil permease 1.47e-02 2.17e-03 NA NA
5. P A7ZWA3 H(+)/Cl(-) exchange transporter ClcA 5.65e-03 2.64e-02 NA NA
5. P Q7N1G0 Probable multidrug resistance protein NorM 7.31e-04 5.07e-04 NA NA
5. P A9MYK0 L-carnitine/gamma-butyrobetaine antiporter 3.34e-03 2.23e-03 NA NA
5. P Q9PEL3 Divalent metal cation transporter MntH 7.65e-03 8.98e-04 NA NA
5. P Q9PR97 Uncharacterized protein UU048 2.85e-03 3.17e-03 NA NA
5. P B1LMI9 Divalent metal cation transporter MntH 3.80e-03 1.73e-02 NA NA
5. P P0AGM7 Uracil permease 1.39e-02 2.78e-03 NA NA
5. P Q83QP2 Fructose-like permease IIC component 2.91e-03 4.71e-03 NA NA
5. P Q24SP9 Probable glycine betaine transporter 3.54e-03 1.24e-02 NA NA
5. P O35544 Excitatory amino acid transporter 4 4.10e-03 2.46e-02 NA NA
5. P P9WKF3 Potassium-transporting ATPase potassium-binding subunit 2.00e-06 6.96e-06 NA NA
5. P Q8FFD5 Fructose-like permease IIC component 2.76e-03 9.87e-03 NA NA
5. P Q4ULY0 ADP,ATP carrier protein 2 4.22e-03 6.00e-03 NA NA
5. P Q0TLH6 H(+)/Cl(-) exchange transporter ClcA 5.93e-03 2.91e-02 NA NA
5. P Q9CKD8 Na(+)/H(+) antiporter NhaA 1.26e-02 2.73e-02 NA NA
5. P P16336 Protein translocase subunit SecY 4.48e-03 3.79e-02 NA NA
5. P Q87EJ9 Divalent metal cation transporter MntH 6.28e-03 2.86e-03 NA NA
5. P B4TBA7 Potassium-transporting ATPase potassium-binding subunit 9.05e-08 1.37e-03 NA NA
5. P P0AGN1 Xanthine permease XanP 6.78e-03 2.53e-05 NA NA
5. P Q79VE0 Ectoine/glycine betaine/proline transporter EctP 1.60e-02 8.68e-03 NA NA
5. P B7MV39 Voltage-gated ClC-type chloride channel ClcB 5.91e-03 3.17e-02 NA NA
5. P Q1R8X7 Putative ion-transport protein YfeO 1.09e-03 3.38e-02 NA NA
5. P B7NB42 Voltage-gated ClC-type chloride channel ClcB 1.69e-02 3.44e-02 NA NA
5. P C4ZY54 Voltage-gated ClC-type chloride channel ClcB 1.49e-02 4.92e-02 NA NA
5. P B6I6U2 Divalent metal cation transporter MntH 3.81e-03 1.73e-02 NA NA
5. P B4T6J9 L-carnitine/gamma-butyrobetaine antiporter 3.17e-03 2.23e-03 NA NA
5. P P38397 Protein translocase subunit SecY (Fragment) 4.55e-03 1.02e-02 NA NA
5. P Q93AK1 Ectoine/hydroxyectoine transporter 4.24e-03 1.45e-02 NA NA
5. P Q8Z9L1 L-carnitine/gamma-butyrobetaine antiporter 1.16e-02 1.84e-03 NA NA
5. P B7M6Q9 Putative ion-transport protein YfeO 1.07e-03 1.61e-02 NA NA
5. P Q4L5B9 Divalent metal cation transporter MntH 4.12e-03 2.76e-02 NA NA
5. P A5IRZ2 Divalent metal cation transporter MntH 5.45e-03 3.83e-03 NA NA
5. P Q2YX69 Divalent metal cation transporter MntH 5.55e-03 1.97e-03 NA NA
5. P P23462 Protein PucC 8.91e-04 3.69e-02 NA NA
5. P O51451 Protein translocase subunit SecY 2.56e-03 9.96e-03 NA NA
5. P P57864 Uncharacterized protein PM0681 2.01e-03 6.17e-03 NA NA
5. P P0C184 Ascorbate-specific PTS system EIIC component 4.23e-03 2.88e-03 NA NA
5. P Q92GI5 ADP,ATP carrier protein 5 1.13e-03 2.41e-03 NA NA
5. P B7NHE4 L-carnitine/gamma-butyrobetaine antiporter 3.07e-03 4.05e-03 NA NA
5. P Q38UX8 Divalent metal cation transporter MntH 4.35e-03 2.70e-03 NA NA
5. P Q2FWH9 Potassium-transporting ATPase potassium-binding subunit 3.71e-07 2.50e-07 NA NA
5. P Q8X691 Cytosine permease 3.74e-02 2.34e-04 NA NA
5. P Q87NZ5 Glycine betaine/proline/choline transporter VP1723 2.97e-03 3.82e-02 NA NA
5. P Q4UL85 ADP,ATP carrier protein 3 9.42e-04 8.68e-03 NA NA
5. P P0A4H1 Protein translocase subunit SecY 2.57e-03 4.15e-04 NA NA
5. P Q328K4 Ascorbate-specific PTS system EIIC component 4.27e-03 8.14e-04 NA NA
5. P B7MH51 Divalent metal cation transporter MntH 3.81e-03 1.73e-02 NA NA
5. P Q03TH5 Divalent metal cation transporter MntH 3.65e-03 6.17e-03 NA NA
5. P P9WIW5 NADH-quinone oxidoreductase subunit M 1.03e-02 4.47e-02 NA NA
5. P P28540 Protein translocase subunit SecY 3.05e-03 1.53e-03 NA NA
5. P C4ZVS6 Putative ion-transport protein YfeO 1.02e-03 1.57e-02 NA NA
5. P Q8Z6Y0 Voltage-gated ClC-type chloride channel ClcB 2.81e-03 4.53e-03 NA NA
5. P C0Q4L6 L-carnitine/gamma-butyrobetaine antiporter 3.19e-03 2.23e-03 NA NA
5. P A6SWX0 Na(+)/H(+) antiporter NhaA 2.12e-03 1.87e-04 NA NA
5. P P26400 Putative O-antigen transporter 1.28e-03 3.11e-03 NA NA
5. P P77579 Fructose-like permease IIC component 1 2.43e-03 2.83e-02 NA NA
5. P B7N824 H(+)/Cl(-) exchange transporter ClcA 5.84e-03 2.85e-02 NA NA
5. P P03959 Potassium-transporting ATPase potassium-binding subunit 1.18e-07 2.39e-04 NA NA
5. P Q9USK3 Uncharacterized transporter C4B3.13 8.97e-04 3.23e-02 NA NA
5. P B4SUY5 H(+)/Cl(-) exchange transporter ClcA 5.37e-03 1.43e-02 NA NA
5. P A5FTA4 Na(+)/H(+) antiporter NhaA 3 5.56e-03 1.74e-03 NA NA
5. P B7MXQ1 Putative ion-transport protein YfeO 1.04e-03 3.38e-02 NA NA
5. P Q1RGS8 ADP,ATP carrier protein 1 4.41e-03 4.34e-05 NA NA
5. P B7NPS5 Putative ion-transport protein YfeO 1.07e-03 1.34e-02 NA NA
5. P Q8FAJ3 Ascorbate-specific PTS system EIIC component 3.81e-03 3.14e-03 NA NA
5. P Q7N3V2 Multidrug resistance protein MdtK 2.55e-04 1.33e-02 NA NA
5. P Q84TI7 Sodium transporter HKT1 6.66e-08 2.52e-02 NA NA
5. P Q9ZDF2 ADP,ATP carrier protein 2 4.39e-03 3.23e-03 NA NA
5. P Q0JNB6 Cation transporter HKT8 3.14e-07 6.89e-03 NA NA
5. P Q9Z8J2 ADP,ATP carrier protein 1 7.39e-04 5.26e-03 NA NA
5. P Q1QF31 Na(+)/H(+) antiporter NhaA 1.78e-02 1.69e-02 NA NA
5. P Q6G791 Protein translocase subunit SecY 3.38e-03 1.82e-03 NA NA
5. P A3CK84 Protein translocase subunit SecY 2.18e-03 1.41e-02 NA NA
5. P Q3Z4A5 Potassium-transporting ATPase potassium-binding subunit 1.11e-07 3.14e-04 NA NA
5. P Q0TF71 Putative ion-transport protein YfeO 9.32e-04 4.88e-02 NA NA
5. P P38680 N amino acid transport system protein 1.57e-02 3.41e-02 NA NA
5. P Q5PJ48 Ascorbate-specific PTS system EIIC component 4.16e-03 2.78e-03 NA NA
5. P Q68WZ7 ADP,ATP carrier protein 2 2.03e-03 4.28e-03 NA NA
5. P A6W9V1 Na(+)/H(+) antiporter NhaA 2 7.78e-03 2.46e-02 NA NA
5. P Q2G2G3 Divalent metal cation transporter MntH 5.49e-03 3.83e-03 NA NA
5. P B2TWY6 Putative ion-transport protein YfeO 9.63e-04 1.36e-02 NA NA
5. P P0A770 Divalent metal cation transporter MntH 3.82e-03 1.73e-02 NA NA
5. P Q92JI6 ADP,ATP carrier protein 1 1.50e-03 1.80e-04 NA NA
5. P P21608 Citrate-sodium symporter 3.77e-03 3.08e-03 NA NA
5. P B7LGL7 H(+)/Cl(-) exchange transporter ClcA 6.07e-03 2.85e-02 NA NA
5. P A7X111 Divalent metal cation transporter MntH 5.58e-03 3.65e-03 NA NA
5. P A6QFW1 Divalent metal cation transporter MntH 5.49e-03 3.83e-03 NA NA
5. P B5QWF0 Potassium-transporting ATPase potassium-binding subunit 9.09e-08 9.62e-04 NA NA
5. P P98004 Quinol oxidase subunit 1 2.54e-03 2.51e-04 NA NA
5. P B7LL85 Divalent metal cation transporter MntH 3.81e-03 1.73e-02 NA NA
5. P Q4L8N9 Multidrug export protein MepA 9.53e-04 5.17e-04 NA NA
5. P Q9YDD0 Protein translocase subunit SecY 4.89e-03 1.64e-03 NA NA
5. P A7N307 Divalent metal cation transporter MntH 1.34e-03 1.93e-02 NA NA
5. P P49977 Protein translocase subunit SecY 2.61e-03 6.17e-03 NA NA
5. P B7UI86 L-carnitine/gamma-butyrobetaine antiporter 3.39e-03 3.83e-03 NA NA
5. P A8ALR3 L-carnitine/gamma-butyrobetaine antiporter 3.61e-03 4.17e-03 NA NA
5. P B7NUP7 Voltage-gated ClC-type chloride channel ClcB 1.57e-02 4.32e-02 NA NA
5. P Q5HQ64 Divalent metal cation transporter MntH 3.82e-03 4.75e-03 NA NA
5. P B7LWB6 H(+)/Cl(-) exchange transporter ClcA 6.05e-03 1.88e-02 NA NA
5. P B1LLE2 Potassium-transporting ATPase potassium-binding subunit 1.15e-07 1.19e-03 NA NA
5. P Q31Y82 Putative ion-transport protein YfeO 1.08e-03 1.37e-02 NA NA
5. P P0AFZ7 Trk system potassium uptake protein TrkH 1.15e-10 3.36e-12 NA NA
5. P Q9KGA4 Uncharacterized protein BH0208 5.59e-03 6.62e-04 NA NA
5. P B1IX73 Putative ion-transport protein YfeO 1.06e-03 1.57e-02 NA NA
5. P P49978 Protein translocase subunit SecY 1.54e-02 3.44e-02 NA NA
5. P P39301 Ascorbate-specific PTS system EIIC component 4.01e-03 2.17e-03 NA NA
5. P Q92I98 ADP,ATP carrier protein 2 4.69e-03 1.37e-02 NA NA
5. P Q47MI6 Na(+)/H(+) antiporter NhaA 5.92e-03 3.47e-02 NA NA
5. P A7ZHD1 L-carnitine/gamma-butyrobetaine antiporter 3.41e-03 4.79e-03 NA NA
5. P P94392 High-affinity proline transporter PutP 2.24e-03 3.12e-02 NA NA
5. P Q8VYL8 Protein DETOXIFICATION 10 1.36e-04 3.08e-03 NA NA
5. P A7ZPJ9 Putative ion-transport protein YfeO 9.91e-04 1.50e-02 NA NA
5. P P33108 Protein translocase subunit SecY 5.06e-03 7.77e-03 NA NA
5. P Q8CNF3 Protein translocase subunit SecY 1.77e-03 8.64e-04 NA NA
5. P Q0BW85 Divalent metal cation transporter MntH 1.58e-03 5.62e-03 NA NA
5. P O80695 Protein DETOXIFICATION 37 5.60e-04 1.63e-02 NA NA
5. P B5RGA7 L-carnitine/gamma-butyrobetaine antiporter 3.18e-03 2.05e-03 NA NA
5. P P65544 Divalent metal cation transporter MntH 8.13e-03 9.09e-03 NA NA
5. P B7LWN1 L-carnitine/gamma-butyrobetaine antiporter 1.15e-02 6.28e-03 NA NA
5. P Q8XDJ5 Ascorbate-specific PTS system EIIC component 3.71e-03 3.32e-03 NA NA
5. P Q99SH9 Potassium-transporting ATPase potassium-binding subunit 1 1.64e-07 3.02e-07 NA NA
5. P Q6H501 Probable cation transporter HKT6 1.84e-08 2.72e-04 NA NA
5. P A6W4F5 Na(+)/H(+) antiporter NhaA 1 2.00e-02 8.84e-03 NA NA
5. P P0AGM8 Uracil permease 7.10e-03 2.78e-03 NA NA
5. P P59334 L-carnitine/gamma-butyrobetaine antiporter 3.36e-03 3.04e-02 NA NA
5. P B2I7I7 C4-dicarboxylate transport protein 2.98e-02 3.79e-02 NA NA
5. P P0AGN2 Xanthine permease XanP 6.41e-03 2.53e-05 NA NA
5. P A5FT18 Na(+)/H(+) antiporter NhaA 1 7.52e-03 9.43e-04 NA NA
5. P Q8CPM6 Divalent metal cation transporter MntH 3.96e-03 5.02e-03 NA NA
5. P O32859 Multidrug efflux pump Tap 1.33e-03 2.91e-02 NA NA
5. P B4TXQ7 H(+)/Cl(-) exchange transporter ClcA 5.38e-03 1.67e-02 NA NA
5. P P54582 Glycine betaine transporter BetP 6.32e-03 1.72e-03 NA NA
5. P C5BG86 Potassium-transporting ATPase potassium-binding subunit 3.39e-07 9.75e-09 NA NA
5. P B4TWR7 L-carnitine/gamma-butyrobetaine antiporter 3.54e-03 2.23e-03 NA NA
5. P Q9RPF2 Divalent metal cation transporter MntH 2 6.05e-03 2.52e-03 NA NA
5. P Q9HPB1 Protein translocase subunit SecY 2.73e-02 2.31e-02 NA NA
5. P B4TK31 H(+)/Cl(-) exchange transporter ClcA 3.86e-03 1.60e-02 NA NA
5. P Q8L4K5 Probable cation transporter HKT9 6.22e-09 1.85e-04 NA NA
5. P B4TIH3 L-carnitine/gamma-butyrobetaine antiporter 3.80e-03 2.23e-03 NA NA
5. P B5XVU3 Divalent metal cation transporter MntH 8.46e-04 1.67e-02 NA NA
5. P Q83W27 ADP,ATP carrier protein 4 1.12e-03 1.10e-04 NA NA
5. P P75712 Putative allantoin permease 6.78e-03 1.14e-03 NA NA
5. P B7LAA5 Potassium-transporting ATPase potassium-binding subunit 1.11e-07 3.95e-04 NA NA
5. P Q57484 Uncharacterized membrane protein HI_0867 1.51e-03 2.61e-02 NA NA
5. P Q2YVH4 Multidrug export protein MepA 1.14e-03 4.75e-02 NA NA
5. P Q8L481 Probable cation transporter HKT3 1.73e-08 2.09e-03 NA NA
5. P Q8Z8E4 Potassium-transporting ATPase potassium-binding subunit 9.12e-08 1.08e-03 NA NA
5. P B1XBG5 L-carnitine/gamma-butyrobetaine antiporter 2.95e-03 4.79e-03 NA NA
5. P P9WP46 Peptide transporter CstA 7.83e-03 3.26e-02 NA NA
5. P B7N9U1 Potassium-transporting ATPase potassium-binding subunit 1.16e-07 4.87e-04 NA NA
5. P P46133 p-aminobenzoyl-glutamate transport protein 1.06e-02 3.62e-02 NA NA
5. P B5FNE1 Potassium-transporting ATPase potassium-binding subunit 1.32e-07 6.75e-04 NA NA
5. P Q0T8F4 L-carnitine/gamma-butyrobetaine antiporter 2.38e-03 3.94e-03 NA NA
5. P A0A2A5K1W4 Uracil permease 1.17e-02 4.59e-02 NA NA
5. P Q57LU5 Divalent metal cation transporter MntH 4.27e-04 5.17e-03 NA NA
5. P P44963 Sodium/pantothenate symporter 1.46e-03 5.62e-03 NA NA
5. P A0QW18 Na(+)/H(+) antiporter NhaA 1.48e-02 1.67e-02 NA NA
5. P O07556 Uncharacterized symporter YhjB 4.63e-03 1.47e-02 NA NA
5. P Q324K9 Potassium-transporting ATPase potassium-binding subunit 1.08e-07 3.14e-04 NA NA
5. P B7LKR6 Potassium-transporting ATPase potassium-binding subunit 1.15e-07 9.00e-03 NA NA
5. P B7UIK2 H(+)/Cl(-) exchange transporter ClcA 7.13e-03 2.85e-02 NA NA
5. P P76175 Voltage-gated ClC-type chloride channel ClcB 2.48e-03 4.92e-02 NA NA
5. P Q99S39 Protein translocase subunit SecY 3.95e-03 1.82e-03 NA NA
5. P Q31Y80 Divalent metal cation transporter MntH 3.84e-03 1.73e-02 NA NA
5. P Q03D26 Divalent metal cation transporter MntH 1.01e-02 4.79e-02 NA NA
5. P P98059 Cytochrome c oxidase subunit 1 2.08e-03 8.44e-03 NA NA
5. P B1XD25 H(+)/Cl(-) exchange transporter ClcA 7.78e-03 2.85e-02 NA NA
5. P B5RHE1 H(+)/Cl(-) exchange transporter ClcA 3.73e-03 1.73e-02 NA NA
5. P D9IA43 Cbb3-type cytochrome c oxidase subunit CcoN1 1.11e-03 2.50e-02 NA NA
5. P B6HYZ1 L-carnitine/gamma-butyrobetaine antiporter 3.25e-03 3.86e-03 NA NA
5. P C0Q5R6 H(+)/Cl(-) exchange transporter ClcA 5.79e-03 1.81e-02 NA NA
5. P O19105 Neutral amino acid transporter B(0) 4.99e-03 3.26e-02 NA NA
5. P A8A2P6 Divalent metal cation transporter MntH 3.81e-03 2.83e-02 NA NA
5. P A8M1G0 Na(+)/H(+) antiporter NhaA 2 1.82e-03 1.58e-02 NA NA
5. P A9MQH4 L-carnitine/gamma-butyrobetaine antiporter 3.60e-03 1.46e-02 NA NA
5. P B1X9R3 Divalent metal cation transporter MntH 3.81e-03 1.73e-02 NA NA
5. P Q9FME8 Oligopeptide transporter 4 1.76e-02 4.75e-02 NA NA
5. P Q0RPD5 Na(+)/H(+) antiporter NhaA 1 8.14e-03 1.84e-02 NA NA
5. P Q2FHX5 Divalent metal cation transporter MntH 6.07e-03 3.83e-03 NA NA
5. P Q8ZPK5 Voltage-gated ClC-type chloride channel ClcB 1.12e-03 4.05e-03 NA NA
5. P P76103 Inner membrane protein YdcO 8.26e-03 3.15e-02 NA NA
5. P Q8NVI1 Potassium-transporting ATPase potassium-binding subunit 3.30e-07 1.98e-07 NA NA
5. P Q7XPF7 Probable cation transporter HKT7 5.58e-07 4.37e-04 NA NA
5. P A8AZK5 Protein translocase subunit SecY 3.32e-03 1.15e-02 NA NA
5. P B7MY49 Divalent metal cation transporter MntH 5.49e-03 1.73e-02 NA NA
5. P P58594 EPS I polysaccharide export inner membrane protein EpsE 1.05e-03 1.67e-02 NA NA
5. P Q5PIN5 L-carnitine/gamma-butyrobetaine antiporter 3.17e-03 2.03e-03 NA NA
5. P P67729 Putative ion-transport protein YfeO 1.09e-03 1.57e-02 NA NA
5. P Q8X794 Voltage-gated ClC-type chloride channel ClcB 1.88e-03 4.88e-02 NA NA
5. P P46317 Lichenan permease IIC component 1.26e-03 8.52e-03 NA NA
5. P B5R3U1 Divalent metal cation transporter MntH 7.47e-04 1.05e-02 NA NA
5. P C0PWC8 Potassium-transporting ATPase potassium-binding subunit 1.28e-07 9.62e-04 NA NA
5. P O42965 Uncharacterized protein C19G7.17 6.19e-03 1.49e-02 NA NA
5. P B7MBD8 H(+)/Cl(-) exchange transporter ClcA 5.73e-03 3.38e-02 NA NA
5. P Q9UT92 Uncharacterized transporter C323.07c 5.94e-04 4.88e-02 NA NA
5. P A1WCI8 Na(+)/H(+) antiporter NhaA 3.97e-03 5.83e-03 NA NA
5. P Q1IUD5 Potassium-transporting ATPase potassium-binding subunit 3.48e-07 3.51e-05 NA NA
5. P P77328 Putative purine permease YbbY 7.58e-03 5.43e-04 NA NA
5. P Q1CKH1 Potassium-transporting ATPase potassium-binding subunit 1.26e-07 4.43e-06 NA NA
5. P Q931T9 Divalent metal cation transporter MntH 5.72e-03 3.65e-03 NA NA
5. P F4I4Q3 Protein DETOXIFICATION 32 1.43e-04 7.63e-03 NA NA
5. P Q68XS7 ADP,ATP carrier protein 1 3.31e-03 6.67e-05 NA NA
5. P B1IQI5 H(+)/Cl(-) exchange transporter ClcA 6.40e-03 2.85e-02 NA NA
5. P Q7A166 Divalent metal cation transporter MntH 5.47e-03 3.83e-03 NA NA
5. P P17334 PTS system N,N'-diacetylchitobiose-specific EIIC component 6.44e-03 1.26e-02 NA NA
5. P B2XTD8 Protein translocase subunit SecY 4.22e-03 2.52e-03 NA NA
5. P P0A4H0 Protein translocase subunit SecY 2.84e-03 4.15e-04 NA NA
5. P B5Z0D5 H(+)/Cl(-) exchange transporter ClcA 5.66e-03 2.91e-02 NA NA
5. P B5R3G7 H(+)/Cl(-) exchange transporter ClcA 5.42e-03 1.43e-02 NA NA
5. P Q0D9S3 Cation transporter HKT1 2.84e-08 2.60e-03 NA NA
5. P Q0T2A8 Divalent metal cation transporter MntH 6.53e-03 1.24e-02 NA NA
5. P A1ADR5 Putative ion-transport protein YfeO 1.03e-03 3.38e-02 NA NA
5. P A3PYK5 Na(+)/H(+) antiporter NhaA 2 1.43e-02 1.97e-03 NA NA
5. P A8Z4Y0 Potassium-transporting ATPase potassium-binding subunit 2.07e-07 2.50e-07 NA NA
5. P Q9N1R2 Excitatory amino acid transporter 4 3.58e-03 4.93e-03 NA NA
5. P Q6GHY0 Divalent metal cation transporter MntH 4.02e-03 3.38e-02 NA NA
5. P B1IRD6 L-carnitine/gamma-butyrobetaine antiporter 1.19e-02 4.05e-03 NA NA
5. P Q1REL9 Potassium-transporting ATPase potassium-binding subunit 7.84e-08 6.49e-04 NA NA
5. P P96593 Divalent metal cation transporter MntH 1.17e-03 8.89e-04 NA NA
5. P Q05347 Putative O-antigen export protein 3.40e-04 5.62e-03 NA NA
5. P A9MPK6 H(+)/Cl(-) exchange transporter ClcA 5.10e-03 1.86e-02 NA NA
5. P P69832 PTS system galactitol-specific EIIC component 1.03e-02 2.68e-02 NA NA
5. P P59585 Putative ion-transport protein YfeO 1.05e-03 2.59e-02 NA NA
5. P B5XZE8 Potassium-transporting ATPase potassium-binding subunit 1.29e-07 3.74e-05 NA NA
5. P Q03DK0 Divalent metal cation transporter MntH 3.64e-03 1.98e-02 NA NA
5. P P75892 Putative pyrimidine permease RutG 1.89e-02 6.00e-03 NA NA
5. P P94575 Probable allantoin permease 2.85e-03 2.80e-03 NA NA
5. P B7M6R1 Divalent metal cation transporter MntH 3.79e-03 1.73e-02 NA NA
5. P Q83II9 Ascorbate-specific PTS system EIIC component 3.52e-03 2.88e-03 NA NA
5. P Q1RHU3 ADP,ATP carrier protein 2 3.96e-03 1.16e-02 NA NA
5. P Q5HGX9 Divalent metal cation transporter MntH 3.90e-03 3.83e-03 NA NA
5. P B5YZU5 Divalent metal cation transporter MntH 3.91e-03 1.73e-02 NA NA
5. P P54417 Glycine betaine transporter OpuD 2.60e-03 1.02e-02 NA NA
5. P O05962 ADP,ATP carrier protein 5 2.12e-03 3.43e-04 NA NA
5. P B5Z428 Voltage-gated ClC-type chloride channel ClcB 3.10e-03 4.88e-02 NA NA
5. P Q9CJ32 PTS system cellobiose-specific EIIC component 2.68e-02 1.53e-02 NA NA
5. P A7HH11 Na(+)/H(+) antiporter NhaA 8.55e-03 5.12e-03 NA NA
5. P Q5PD50 H(+)/Cl(-) exchange transporter ClcA 5.45e-03 1.63e-02 NA NA
5. P Q8XSF6 Divalent metal cation transporter MntH 1.49e-02 1.89e-03 NA NA
5. P Q92HV4 ADP,ATP carrier protein 4 9.42e-04 7.75e-04 NA NA
5. P B1LMI7 Putative ion-transport protein YfeO 1.08e-03 1.38e-02 NA NA
5. P Q92HP9 ADP,ATP carrier protein 3 1.31e-03 1.99e-03 NA NA
5. P B5YYD4 L-carnitine/gamma-butyrobetaine antiporter 3.38e-03 4.09e-03 NA NA
5. P Q8YFD7 Probable multidrug resistance protein NorM 1.95e-03 1.93e-02 NA NA
5. P Q57TI7 L-carnitine/gamma-butyrobetaine antiporter 3.53e-03 3.14e-03 NA NA
5. P A6U0S3 Divalent metal cation transporter MntH 4.38e-03 3.83e-03 NA NA
5. P P77964 Protein translocase subunit SecY 2.53e-03 3.20e-04 NA NA
5. P Q07307 Uric acid-xanthine permease 8.79e-03 3.72e-02 NA NA
5. P P37019 H(+)/Cl(-) exchange transporter ClcA 6.19e-03 2.85e-02 NA NA
5. P A5W1K7 Na(+)/H(+) antiporter NhaA 2 1.26e-02 1.22e-03 NA NA
5. P B5FHG8 L-carnitine/gamma-butyrobetaine antiporter 3.17e-03 2.23e-03 NA NA
5. P B7LCE3 Divalent metal cation transporter MntH 3.90e-03 1.73e-02 NA NA
5. P B7MH49 Putative ion-transport protein YfeO 1.00e-03 3.38e-02 NA NA
5. P Q9RPF4 Divalent metal cation transporter MntH 7.55e-04 5.17e-03 NA NA
5. P Q1RGF8 L-carnitine/gamma-butyrobetaine antiporter 3.41e-03 4.79e-03 NA NA
5. P Q8GH68 Divalent metal cation transporter MntH 1.11e-02 1.50e-03 NA NA
5. P Q8X9F8 Potassium-transporting ATPase potassium-binding subunit 7.74e-08 1.58e-03 NA NA
5. P P59638 Voltage-gated ClC-type chloride channel ClcB 4.61e-03 2.46e-02 NA NA
5. P A6T6D9 Potassium-transporting ATPase potassium-binding subunit 5.86e-08 6.66e-06 NA NA
5. P P58118 Protein translocase subunit SecY 3.94e-03 4.97e-04 NA NA
5. P B5BL58 L-carnitine/gamma-butyrobetaine antiporter 3.07e-03 2.03e-03 NA NA
5. P B6HZD1 H(+)/Cl(-) exchange transporter ClcA 4.91e-03 2.85e-02 NA NA
5. P F4JKB9 Protein DETOXIFICATION 38 5.19e-04 3.12e-02 NA NA
5. P Q5HDX8 Protein translocase subunit SecY 4.03e-03 1.82e-03 NA NA
5. P Q4ULJ8 ADP,ATP carrier protein 4 8.85e-04 2.22e-04 NA NA
5. P Q9RTP8 Divalent metal cation transporter MntH 2.25e-03 2.19e-02 NA NA
5. P B7LL87 Putative ion-transport protein YfeO 1.08e-03 1.17e-02 NA NA
5. P P46785 Protein translocase subunit SecY 2.02e-03 1.10e-02 NA NA
5. P Q57GJ9 Ascorbate-specific PTS system EIIC component 3.93e-03 1.97e-03 NA NA
5. P Q59647 Nitric oxide reductase subunit B 1.68e-04 3.24e-07 NA NA
5. P P31553 L-carnitine/gamma-butyrobetaine antiporter 3.05e-03 4.79e-03 NA NA
5. P O05507 PTS system oligo-beta-mannoside-specific EIIC component 2.33e-03 1.83e-02 NA NA
5. P C4ZRP8 H(+)/Cl(-) exchange transporter ClcA 4.71e-03 2.85e-02 NA NA
5. P Q6GAA9 Divalent metal cation transporter MntH 4.42e-03 3.83e-03 NA NA
5. P B7NIB8 H(+)/Cl(-) exchange transporter ClcA 5.15e-03 2.91e-02 NA NA
5. P O06493 Osmoregulated proline transporter OpuE 4.39e-03 3.65e-02 NA NA
5. P B5YZU3 Putative ion-transport protein YfeO 9.68e-04 1.57e-02 NA NA
5. P A4W861 Potassium-transporting ATPase potassium-binding subunit 1.08e-07 2.69e-05 NA NA
5. P Q57753 Uncharacterized protein MJ0305 6.61e-03 9.51e-03 NA NA
5. P B1LGV8 H(+)/Cl(-) exchange transporter ClcA 5.90e-03 2.91e-02 NA NA
5. P O67513 Uncharacterized protein aq_1569 7.09e-04 4.92e-02 NA NA
5. P A0JR38 Na(+)/H(+) antiporter NhaA 7.56e-03 1.13e-02 NA NA
5. P Q05572 Cytochrome c oxidase subunit 1 homolog, bacteroid 1.48e-03 3.29e-03 NA NA
5. P P98055 Cytochrome c oxidase subunit 1 homolog 2.95e-03 5.94e-03 NA NA
5. P B2TTJ6 Potassium-transporting ATPase potassium-binding subunit 1.10e-07 1.14e-04 NA NA
5. P Q8FL15 H(+)/Cl(-) exchange transporter ClcA 6.93e-03 3.38e-02 NA NA
5. P P37180 Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit 3.68e-03 1.69e-02 NA NA
5. P Q45411 EPS I polysaccharide export inner membrane protein EpsE 5.20e-04 7.56e-03 NA NA
5. P P0AGM9 Xanthine permease XanP 6.65e-03 2.53e-05 NA NA
5. P Q8Z4X5 Divalent metal cation transporter MntH 3.52e-04 6.46e-03 NA NA
5. P A1R4H0 Na(+)/H(+) antiporter NhaA 1.64e-02 3.58e-03 NA NA
5. P Q0T851 H(+)/Cl(-) exchange transporter ClcA 6.54e-03 4.75e-02 NA NA
5. P B7L4G3 L-carnitine/gamma-butyrobetaine antiporter 3.05e-03 4.79e-03 NA NA
5. P B7LCE1 Putative ion-transport protein YfeO 9.85e-04 2.05e-02 NA NA
5. P D0C9N4 Carnitine transporter 5.46e-03 2.84e-04 NA NA
5. P A1JQY4 Potassium-transporting ATPase potassium-binding subunit 1.20e-07 3.92e-06 NA NA
5. P Q6GEK3 Protein translocase subunit SecY 3.12e-03 1.82e-03 NA NA
5. P P48664 Excitatory amino acid transporter 4 4.27e-03 4.21e-02 NA NA
5. P B5FHR3 Voltage-gated ClC-type chloride channel ClcB 2.85e-03 3.45e-03 NA NA
5. P Q87EN2 C4-dicarboxylate transport protein 1.62e-02 3.79e-02 NA NA
5. P Q8XA30 L-carnitine/gamma-butyrobetaine antiporter 3.49e-03 4.09e-03 NA NA
5. P B1IX71 Divalent metal cation transporter MntH 3.95e-03 1.73e-02 NA NA
5. P Q68W11 ADP,ATP carrier protein 5 1.45e-03 2.70e-04 NA NA
5. P Q49VC5 Multidrug export protein MepA 2.73e-03 9.00e-03 NA NA
5. P Q9ZD47 ADP,ATP carrier protein 4 2.12e-03 9.02e-05 NA NA
5. P B7N5Z2 Divalent metal cation transporter MntH 3.79e-03 1.73e-02 NA NA
5. P B7UKX7 Potassium-transporting ATPase potassium-binding subunit 6.86e-08 3.30e-04 NA NA
5. P Q57T52 H(+)/Cl(-) exchange transporter ClcA 1.08e-02 1.81e-02 NA NA
5. P Q7XPF8 Cation transporter HKT4 1.82e-09 3.11e-04 NA NA
5. P Q10177 Manganese transporter pdt1 1.91e-03 5.07e-03 NA NA
5. P B1XF57 Voltage-gated ClC-type chloride channel ClcB 4.84e-03 4.92e-02 NA NA
5. P Q667S5 Potassium-transporting ATPase potassium-binding subunit 1.28e-07 3.10e-06 NA NA
5. P A1ADR7 Divalent metal cation transporter MntH 5.63e-03 1.73e-02 NA NA
5. P Q92Y37 Na(+)/H(+) antiporter NhaA 7.74e-03 1.08e-02 NA NA
5. P B5R1R3 L-carnitine/gamma-butyrobetaine antiporter 3.19e-03 2.23e-03 NA NA
5. P Q9S2H4 PTS system N-acetylglucosamine-specific EIIC component 2.79e-03 2.27e-02 NA NA
5. P Q6G0H9 Na(+)/H(+) antiporter NhaA 1.71e-03 3.65e-03 NA NA
5. P Q1CZI3 Na(+)/H(+) antiporter NhaA 2 1.61e-02 8.92e-03 NA NA
5. P P9WKX9 Uncharacterized protein Rv3630 1.53e-03 1.39e-04 NA NA
5. P P59985 Uncharacterized protein Mb3654 1.44e-03 3.23e-04 NA NA
5. P Q8SUG0 ADP,ATP carrier protein 3 1.67e-03 9.00e-03 NA NA
5. P B4TQE4 Divalent metal cation transporter MntH 3.69e-04 6.46e-03 NA NA
5. P P67446 Xanthine permease XanQ 7.28e-03 1.44e-05 NA NA
5. P Q6ABJ2 Potassium-transporting ATPase potassium-binding subunit 8.50e-07 1.55e-06 NA NA
5. P P27148 Protein translocase subunit SecY 3.88e-03 2.27e-03 NA NA
5. P Q92GA9 Putative transporter AmpG 3 2.97e-04 4.39e-02 NA NA
5. P A1A790 L-carnitine/gamma-butyrobetaine antiporter 3.64e-03 4.79e-03 NA NA
5. P Q3Z5W8 L-carnitine/gamma-butyrobetaine antiporter 3.47e-03 4.79e-03 NA NA
5. P B1LFX3 L-carnitine/gamma-butyrobetaine antiporter 3.48e-03 4.05e-03 NA NA
5. P P9WGN3 Protein translocase subunit SecY 2.85e-03 3.17e-02 NA NA
5. P Q6G5K1 Na(+)/H(+) antiporter NhaA 1.16e-02 4.19e-04 NA NA
5. P Q32K57 L-carnitine/gamma-butyrobetaine antiporter 3.83e-03 7.08e-03 NA NA
5. P Q31TC4 Ascorbate-specific PTS system EIIC component 5.97e-03 1.11e-03 NA NA
5. P Q99191 Putative O-antigen transporter 1.91e-03 2.96e-02 NA NA
5. P P19568 ADP,ATP carrier protein 1 1.03e-03 4.03e-05 NA NA
5. P A9IQG4 Na(+)/H(+) antiporter NhaA 1.42e-02 1.95e-04 NA NA
5. P P10250 Protein translocase subunit SecY 1.84e-03 1.37e-03 NA NA
5. P A4WD10 Divalent metal cation transporter MntH 3.82e-03 3.20e-02 NA NA
5. P Q8P8R8 Divalent metal cation transporter MntH 7.09e-03 4.98e-03 NA NA
5. P B2TWY8 Divalent metal cation transporter MntH 3.85e-03 1.73e-02 NA NA
5. P A1URT7 Na(+)/H(+) antiporter NhaA 1.03e-02 3.05e-03 NA NA
5. P P53744 7-keto 8-aminopelargonic acid transporter 9.26e-03 3.02e-03 NA NA
5. P C4ZPW6 L-carnitine/gamma-butyrobetaine antiporter 3.04e-03 4.79e-03 NA NA
5. P Q21JV7 Na(+)/H(+) antiporter NhaA 1 2.18e-02 8.21e-03 NA NA
5. P P69831 PTS system galactitol-specific EIIC component 1.02e-02 2.68e-02 NA NA
5. P P9WIW4 NADH-quinone oxidoreductase subunit M 1.04e-02 4.47e-02 NA NA
5. P B7MP17 H(+)/Cl(-) exchange transporter ClcA 5.71e-03 2.91e-02 NA NA
5. P Q1RIL2 ADP,ATP carrier protein 3 1.12e-03 1.14e-03 NA NA
5. P B2KA77 Potassium-transporting ATPase potassium-binding subunit 1.21e-07 4.38e-06 NA NA
5. P Q3Z5K2 H(+)/Cl(-) exchange transporter ClcA 1.01e-02 2.85e-02 NA NA
5. P Q8XBP8 Fructose-like permease IIC component 3.56e-03 3.17e-02 NA NA
5. P P48777 Purine permease 9.62e-03 1.64e-04 NA NA
5. P Q8FHC1 Voltage-gated ClC-type chloride channel ClcB 4.07e-03 3.17e-02 NA NA
5. P C4ZVS8 Divalent metal cation transporter MntH 3.84e-03 1.73e-02 NA NA
5. P P42628 Probable serine transporter 4.59e-03 1.51e-02 NA NA
5. P Q32JV3 H(+)/Cl(-) exchange transporter ClcA 6.07e-03 2.91e-02 NA NA
5. P P98008 Nitric oxide reductase subunit B 1.61e-04 9.26e-07 NA NA
5. P P0A5Z3 Protein translocase subunit SecY 2.57e-03 3.17e-02 NA NA
5. P P9WGN2 Protein translocase subunit SecY 2.49e-03 3.17e-02 NA NA
5. P A7ZPK2 Divalent metal cation transporter MntH 3.93e-03 1.73e-02 NA NA
5. P F6CD01 Protein translocase subunit SecY 1 7.42e-03 2.16e-04 NA NA
5. P Q3SNN8 Na(+)/H(+) antiporter NhaA 5.82e-03 5.49e-04 NA NA
5. P Q8ZRX1 L-carnitine/gamma-butyrobetaine antiporter 3.37e-03 2.23e-03 NA NA
5. P B7M196 H(+)/Cl(-) exchange transporter ClcA 5.05e-03 2.85e-02 NA NA
5. P P50487 Putative purine permease CPE0397 1.64e-02 4.17e-02 NA NA
5. P O33006 Protein translocase subunit SecY 1.96e-03 1.53e-02 NA NA
5. P A1UF43 Na(+)/H(+) antiporter NhaA 2 5.79e-03 2.23e-03 NA NA
5. P A4X6R9 Na(+)/H(+) antiporter NhaA 1 1.46e-03 4.88e-02 NA NA
5. P A9GMF2 Na(+)/H(+) antiporter NhaA 1 3.40e-03 2.52e-03 NA NA
5. P Q03073 Cytochrome c oxidase subunit 1 homolog, bacteroid 1.49e-03 5.94e-04 NA NA
5. P P39365 Putative permease IIC component 8.86e-03 5.12e-03 NA NA
5. P P0AAA8 Lipid III flippase 3.10e-04 1.84e-02 NA NA
5. P P37746 Putative O-antigen transporter 3.37e-03 1.97e-03 NA NA
5. P A8ALD3 H(+)/Cl(-) exchange transporter ClcA 2.94e-03 2.15e-02 NA NA
5. P B7URT1 Voltage-gated ClC-type chloride channel ClcB 5.70e-03 3.62e-02 NA NA
5. P B1X9R1 Putative ion-transport protein YfeO 1.10e-03 1.57e-02 NA NA
5. P Q3YZE3 Putative ion-transport protein YfeO 1.12e-03 1.26e-02 NA NA
5. P P59639 H(+)/Cl(-) exchange transporter ClcA 1.01e-02 4.75e-02 NA NA
5. P Q9ZD67 ADP,ATP carrier protein 3 1.59e-03 7.38e-04 NA NA
5. P Q1RK92 ADP,ATP carrier protein 5 3.31e-03 2.15e-03 NA NA
5. P B7UGA0 Divalent metal cation transporter MntH 3.87e-03 1.91e-02 NA NA
5. P P0AA82 Cytosine permease 3.72e-02 2.72e-04 NA NA
5. P B7N7R5 L-carnitine/gamma-butyrobetaine antiporter 3.38e-03 4.79e-03 NA NA
5. P B7MAG3 L-carnitine/gamma-butyrobetaine antiporter 3.41e-03 4.79e-03 NA NA
5. P Q88FW9 Na(+)/H(+) antiporter NhaA 2 2.70e-03 2.17e-03 NA NA
5. P Q5PNF0 Divalent metal cation transporter MntH 7.58e-04 6.46e-03 NA NA
5. P Q0T2B0 Putative ion-transport protein YfeO 4.10e-03 1.36e-02 NA NA
5. P Q0TLU9 L-carnitine/gamma-butyrobetaine antiporter 3.05e-03 3.83e-03 NA NA
5. P P92962 Proline transporter 2 7.02e-03 1.42e-02 NA NA
5. P P67444 Xanthine permease XanQ 6.14e-03 1.44e-05 NA NA
5. P Q05217 Protein translocase subunit SecY 4.11e-03 3.11e-03 NA NA
5. P Q1M7A2 Monocarboxylate transport permease protein 6.00e-03 4.59e-04 NA NA
5. P Q57RM9 Potassium-transporting ATPase potassium-binding subunit 8.82e-08 1.16e-03 NA NA
5. P Q99UZ7 Divalent metal cation transporter MntH 5.61e-03 3.83e-03 NA NA
5. P Q5HM19 Protein translocase subunit SecY 2.33e-03 8.64e-04 NA NA
5. P Q8SUG7 ADP,ATP carrier protein 4 9.14e-04 1.56e-04 NA NA
5. P Q0AM65 Na(+)/H(+) antiporter NhaA 1.48e-02 1.05e-02 NA NA
5. P Q9UX84 Protein translocase subunit SecY 4.60e-03 8.29e-03 NA NA
5. P Q8ZSB0 Divalent metal cation transporter MntH 5.84e-03 1.42e-02 NA NA
5. P Q8ZK90 Ascorbate-specific PTS system EIIC component 4.17e-03 2.13e-03 NA NA
5. P P46249 Protein translocase subunit SecY 1.73e-03 4.66e-03 NA NA
5. P Q97TN5 Divalent metal cation transporter MntH 4.35e-04 9.16e-04 NA NA
5. P A1A7K1 H(+)/Cl(-) exchange transporter ClcA 5.67e-03 3.38e-02 NA NA
5. P A9EYV6 Na(+)/H(+) antiporter NhaA 2 4.05e-03 6.89e-03 NA NA
5. P Q8XAF5 Serine transporter 3.67e-03 1.17e-02 NA NA
5. P P42726 Trifolitoxin-processing protein TfxD 2.57e-04 1.84e-02 NA NA
5. P P9WLW1 Uncharacterized protein Rv1510 5.39e-04 9.96e-03 NA NA
5. P A7ZVZ0 L-carnitine/gamma-butyrobetaine antiporter 3.06e-03 4.79e-03 NA NA
5. P Q8Z172 Ascorbate-specific PTS system EIIC component 2.81e-03 2.99e-03 NA NA
5. P A7MP48 Divalent metal cation transporter MntH 3.79e-04 9.17e-03 NA NA
5. P A8AGW0 Voltage-gated ClC-type chloride channel ClcB 1.47e-02 1.93e-02 NA NA
5. P P28527 Protein translocase subunit SecY 6.11e-03 3.20e-03 NA NA
5. P Q0K437 Na(+)/H(+) antiporter NhaA 8.42e-03 2.80e-03 NA NA
5. P A8GB62 Potassium-transporting ATPase potassium-binding subunit 1.24e-07 2.12e-07 NA NA
5. P Q8Z9B3 H(+)/Cl(-) exchange transporter ClcA 5.50e-03 1.73e-02 NA NA
5. P P9WKX8 Uncharacterized protein MT3732 1.53e-03 3.23e-04 NA NA
5. P Q68WQ3 ADP,ATP carrier protein 3 2.04e-03 1.60e-02 NA NA
5. P B5F753 L-carnitine/gamma-butyrobetaine antiporter 3.19e-03 2.23e-03 NA NA
5. P P39766 Uracil permease 3.25e-02 1.81e-02 NA NA
6. F P28569 High-affinity potassium transport protein 2.26e-03 NA NA 0.4293
7. B P47946 Potassium transport protein 1 4.35e-05 NA 0.001 NA