Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54924.1
JCVISYN3A_0686

Potassium transporter.
M. mycoides homolog: Q6MSL1.
TIGRfam Classification: 3=Putative.
Category: Essential.

Statistics

Total GO Annotation: 30
Unique PROST Go: 12
Unique BLAST Go: 0
Unique Foldseek Go: 13

Total Homologs: 519
Unique PROST Homologs: 215
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 291

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: trkA; Potassium uptake protein
Zhang et al. [4]: GO:0015079|potassium ion transmembrane transporter activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O87952 (Ktr system potassium uptake protein A) with a FATCAT P-Value: 5.55e-16 and RMSD of 1.86 angstrom. The sequence alignment identity is 26.6%.
Structural alignment shown in left. Query protein AVX54924.1 colored as red in alignment, homolog O87952 colored as blue. Query protein AVX54924.1 is also shown in right top, homolog O87952 showed in right bottom. They are colored based on secondary structures. 

  AVX54924.1 MAK---KQNFAIIGVSNFTLSVIETLVQKRQSVTVFDIDERRLNL---YLSEFDTVEGIVIDTTNKVALAK-KGIQSYDWVIVGIENELESS-LVTVL-N 91
      O87952 M-KTGDKQ-FAVIGLGRFGLAVCKELQDSGSQVLAVDINEDRVKEAAGFVS-----QAIVANCTHEETVAELK-LDDYDMVMIAIGADVNASILATLIAK 92

  AVX54924.1 LLDLKCTNITVKAKDDNYR-RVLLALGLTENQIIVPNKIAGEITATRVIFNID-FDIEVHSIDDEFISSTLE-VKNPDLFNKNIQQVGLSTNKDFNIIQI 188
      O87952 EAGVK--SVWVKA-NDRFQARVLQKIG--ADHIIMPERDMG-IRVARKM--LDKRVLEFHPLGSG-LAMT-EFVVGSRLMGKTLSDLALCKVEGVQVLGY 182

  AVX54924.1 RRKG-KIL-LPDDYTELKEGDHIVVFARTTIINSLAEKIQGMIDEETDPNLLTEEQ 242
      O87952 KR-GPEIIKAPDMSTTLEIGDLIIVVGPQ---DKLANKLKSL-------------- 220

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0006813 potassium ion transport
1. PBF GO:0008324 cation transmembrane transporter activity
1. PBF GO:0005886 plasma membrane
2. PF GO:0005524 ATP binding
2. PF GO:0015079 potassium ion transmembrane transporter activity
5. P GO:0009435 NAD biosynthetic process
5. P GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
5. P GO:0106352 aspartate dehydrogenase NADP activity
5. P GO:0016639 oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
5. P GO:0051287 NAD binding
5. P GO:0009089 lysine biosynthetic process via diaminopimelate
5. P GO:0106351 aspartate dehydrogenase NAD activity
5. P GO:0005737 cytoplasm
5. P GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
5. P GO:0019877 diaminopimelate biosynthetic process
5. P GO:0050661 NADP binding
5. P GO:0016994 precorrin-6A reductase activity
6. F GO:0019899 enzyme binding
6. F GO:0004755 saccharopine dehydrogenase (NADP+, L-glutamate-forming) activity
6. F GO:0016021 integral component of membrane
6. F GO:0005887 integral component of plasma membrane
6. F GO:0005267 potassium channel activity
6. F GO:0015386 potassium:proton antiporter activity
6. F GO:0006884 cell volume homeostasis
6. F GO:0050660 flavin adenine dinucleotide binding
6. F GO:0015643 toxic substance binding
6. F GO:0046872 metal ion binding
6. F GO:0051595 response to methylglyoxal
6. F GO:0015503 glutathione-regulated potassium exporter activity
6. F GO:0015299 solute:proton antiporter activity

Uniprot GO Annotations

GO Description
GO:0006813 potassium ion transport
GO:0008324 cation transmembrane transporter activity
GO:0098655 cation transmembrane transport

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF O87952 Ktr system potassium uptake protein A 5.55e-16 3.57e-27 2.16e-08 0.7337
1. PBF P75322 Uncharacterized protein MG323 homolog 0.00e+00 1.55e-41 4.28e-23 0.6488
1. PBF P47565 Uncharacterized protein MG323 1.89e-15 8.99e-38 1.85e-23 0.6323
1. PBF O32080 Ktr system potassium uptake protein A 2.55e-15 8.78e-28 3.74e-10 0.7391
1. PBF P39760 Ktr system potassium uptake protein C 4.00e-15 3.44e-31 1.35e-13 0.7281
2. PF Q9UXU0 Trk system potassium uptake protein TrkA homolog 8.23e-12 3.96e-26 NA 0.6549
2. PF P9WFZ2 Trk system potassium uptake protein TrkA 2.41e-13 2.88e-28 NA 0.539
2. PF O27333 Trk system potassium uptake protein TrkA homolog 6.66e-16 1.03e-19 NA 0.6896
2. PF O57719 Trk system potassium uptake protein TrkA homolog 9.02e-12 1.93e-25 NA 0.6734
2. PF Q53949 Trk system potassium uptake protein TrkA 3.86e-11 2.01e-27 NA 0.5172
3. BF Q7MWN8 Uncharacterized transporter PG_0562 4.13e-02 NA 0.037 0.5645
3. BF Q8A8D8 Uncharacterized transporter BT_1229 6.15e-02 NA 0.001 0.547
3. BF Q64VB3 Uncharacterized transporter BF1818 4.73e-02 NA 0.002 0.5698
5. P Q6D0C7 4-hydroxy-tetrahydrodipicolinate reductase 4.63e-02 5.67e-03 NA NA
5. P B1XT71 4-hydroxy-tetrahydrodipicolinate reductase 6.19e-02 1.35e-02 NA NA
5. P Q4KIG9 4-hydroxy-tetrahydrodipicolinate reductase 4.26e-02 8.41e-03 NA NA
5. P B1VDC2 4-hydroxy-tetrahydrodipicolinate reductase 2.10e-02 3.72e-03 NA NA
5. P B7LWM1 4-hydroxy-tetrahydrodipicolinate reductase 1.37e-02 1.67e-02 NA NA
5. P Q5HAV4 4-hydroxy-tetrahydrodipicolinate reductase 2.80e-02 1.72e-02 NA NA
5. P Q4QKM7 4-hydroxy-tetrahydrodipicolinate reductase 4.21e-02 2.20e-02 NA NA
5. P B5YYC3 4-hydroxy-tetrahydrodipicolinate reductase 1.48e-02 2.11e-03 NA NA
5. P A0PQF8 4-hydroxy-tetrahydrodipicolinate reductase 4.67e-02 2.86e-02 NA NA
5. P B2UCA2 4-hydroxy-tetrahydrodipicolinate reductase 3.83e-02 2.06e-02 NA NA
5. P A0QVR3 4-hydroxy-tetrahydrodipicolinate reductase 4.17e-02 3.33e-02 NA NA
5. P Q6HL23 4-hydroxy-tetrahydrodipicolinate reductase 3.77e-02 3.41e-02 NA NA
5. P C1EN29 4-hydroxy-tetrahydrodipicolinate reductase 3.78e-02 3.41e-02 NA NA
5. P B3E935 4-hydroxy-tetrahydrodipicolinate reductase 4.61e-02 3.61e-02 NA NA
5. P B0TQB8 4-hydroxy-tetrahydrodipicolinate reductase 4.86e-02 4.29e-03 NA NA
5. P Q834S6 4-hydroxy-tetrahydrodipicolinate reductase 3.06e-02 4.08e-03 NA NA
5. P C3MBY7 4-hydroxy-tetrahydrodipicolinate reductase 3.20e-02 2.44e-02 NA NA
5. P A8FYT6 4-hydroxy-tetrahydrodipicolinate reductase 3.57e-02 2.29e-02 NA NA
5. P A7GN70 4-hydroxy-tetrahydrodipicolinate reductase 2.48e-02 2.14e-02 NA NA
5. P A9L0Q8 4-hydroxy-tetrahydrodipicolinate reductase 4.07e-02 3.08e-02 NA NA
5. P B7HHT6 4-hydroxy-tetrahydrodipicolinate reductase 3.89e-02 3.62e-03 NA NA
5. P Q0HY04 4-hydroxy-tetrahydrodipicolinate reductase 1.20e-02 2.09e-02 NA NA
5. P C0R2S2 4-hydroxy-tetrahydrodipicolinate reductase 4.09e-02 8.07e-03 NA NA
5. P B1LFW1 4-hydroxy-tetrahydrodipicolinate reductase 1.64e-02 1.50e-03 NA NA
5. P A6WRU0 4-hydroxy-tetrahydrodipicolinate reductase 1.07e-02 3.08e-02 NA NA
5. P Q326J2 4-hydroxy-tetrahydrodipicolinate reductase 1.64e-02 2.50e-03 NA NA
5. P A6T4H8 4-hydroxy-tetrahydrodipicolinate reductase 1.61e-02 1.72e-02 NA NA
5. P Q65TY2 4-hydroxy-tetrahydrodipicolinate reductase 1.45e-02 1.93e-02 NA NA
5. P Q58505 Trk system potassium uptake protein TrkA homolog 1.03e-14 6.22e-31 NA NA
5. P C3P5Q2 4-hydroxy-tetrahydrodipicolinate reductase 3.87e-02 2.64e-02 NA NA
5. P Q1LJ29 4-hydroxy-tetrahydrodipicolinate reductase 1.00e-01 3.76e-02 NA NA
5. P A5UCB3 4-hydroxy-tetrahydrodipicolinate reductase 4.21e-02 2.77e-02 NA NA
5. P C3PH06 4-hydroxy-tetrahydrodipicolinate reductase 4.54e-02 1.26e-02 NA NA
5. P Q3KLZ2 4-hydroxy-tetrahydrodipicolinate reductase 2.50e-02 3.85e-02 NA NA
5. P C5B7N2 4-hydroxy-tetrahydrodipicolinate reductase 1.37e-02 2.07e-03 NA NA
5. P B0KIS3 4-hydroxy-tetrahydrodipicolinate reductase 4.47e-02 1.23e-02 NA NA
5. P B4TWQ6 4-hydroxy-tetrahydrodipicolinate reductase 1.49e-02 4.06e-04 NA NA
5. P Q32K66 4-hydroxy-tetrahydrodipicolinate reductase 1.37e-02 2.95e-03 NA NA
5. P A6UEW2 4-hydroxy-tetrahydrodipicolinate reductase 3.81e-02 2.40e-02 NA NA
5. P C4ZPV7 4-hydroxy-tetrahydrodipicolinate reductase 1.59e-02 1.71e-03 NA NA
5. P A9VME3 4-hydroxy-tetrahydrodipicolinate reductase 3.87e-02 3.67e-02 NA NA
5. P A5UF10 4-hydroxy-tetrahydrodipicolinate reductase 4.49e-02 2.09e-02 NA NA
5. P P9WFZ3 Trk system potassium uptake protein TrkA 2.79e-13 2.88e-28 NA NA
5. P Q73AW1 4-hydroxy-tetrahydrodipicolinate reductase 3.50e-02 1.75e-02 NA NA
5. P B7I2B0 4-hydroxy-tetrahydrodipicolinate reductase 2.86e-02 1.26e-02 NA NA
5. P Q0BIB8 4-hydroxy-tetrahydrodipicolinate reductase 5.56e-02 3.41e-02 NA NA
5. P Q2YJN7 4-hydroxy-tetrahydrodipicolinate reductase 3.04e-02 4.03e-02 NA NA
5. P Q39Z66 4-hydroxy-tetrahydrodipicolinate reductase 4.55e-02 3.67e-02 NA NA
5. P B8GNX3 4-hydroxy-tetrahydrodipicolinate reductase 4.33e-02 2.85e-03 NA NA
5. P O86836 4-hydroxy-tetrahydrodipicolinate reductase 3.26e-02 1.76e-02 NA NA
5. P Q6NGP2 4-hydroxy-tetrahydrodipicolinate reductase 3.50e-02 1.43e-02 NA NA
5. P B1YT08 4-hydroxy-tetrahydrodipicolinate reductase 7.17e-02 2.07e-02 NA NA
5. P Q8ZRX8 4-hydroxy-tetrahydrodipicolinate reductase 1.41e-02 1.82e-03 NA NA
5. P A1VDM6 4-hydroxy-tetrahydrodipicolinate reductase 2.47e-02 3.73e-02 NA NA
5. P B1J256 4-hydroxy-tetrahydrodipicolinate reductase 3.73e-02 1.94e-02 NA NA
5. P A3D7S3 4-hydroxy-tetrahydrodipicolinate reductase 4.07e-02 3.08e-02 NA NA
5. P Q88DU4 4-hydroxy-tetrahydrodipicolinate reductase 3.74e-02 1.09e-02 NA NA
5. P B7HL46 4-hydroxy-tetrahydrodipicolinate reductase 3.47e-02 1.38e-02 NA NA
5. P B7L4F3 4-hydroxy-tetrahydrodipicolinate reductase 1.50e-02 1.76e-03 NA NA
5. P Q83SQ9 4-hydroxy-tetrahydrodipicolinate reductase 1.29e-02 1.50e-03 NA NA
5. P Q72BM6 4-hydroxy-tetrahydrodipicolinate reductase 2.62e-02 3.73e-02 NA NA
5. P Q02Y20 4-hydroxy-tetrahydrodipicolinate reductase 3.60e-02 6.12e-03 NA NA
5. P A8G9M8 4-hydroxy-tetrahydrodipicolinate reductase 3.96e-02 4.40e-02 NA NA
5. P Q2NVY2 4-hydroxy-tetrahydrodipicolinate reductase 5.52e-02 2.82e-02 NA NA
5. P A4XYF4 4-hydroxy-tetrahydrodipicolinate reductase 4.30e-02 1.23e-02 NA NA
5. P Q03M29 4-hydroxy-tetrahydrodipicolinate reductase 1.92e-02 2.18e-02 NA NA
5. P Q9CFC0 4-hydroxy-tetrahydrodipicolinate reductase 3.71e-02 1.16e-03 NA NA
5. P B7MNN7 4-hydroxy-tetrahydrodipicolinate reductase 1.65e-02 1.50e-03 NA NA
5. P Q5M5P2 4-hydroxy-tetrahydrodipicolinate reductase 1.94e-02 3.73e-02 NA NA
5. P C1DFM1 4-hydroxy-tetrahydrodipicolinate reductase 4.52e-02 7.30e-03 NA NA
5. P A5W9A1 4-hydroxy-tetrahydrodipicolinate reductase 3.70e-02 1.37e-02 NA NA
5. P A7HZ36 4-hydroxy-tetrahydrodipicolinate reductase 3.81e-02 1.54e-02 NA NA
5. P Q9KPH7 4-hydroxy-tetrahydrodipicolinate reductase 5.85e-02 4.33e-02 NA NA
5. P B7NHD5 4-hydroxy-tetrahydrodipicolinate reductase 1.35e-02 1.50e-03 NA NA
5. P C3L8Q7 4-hydroxy-tetrahydrodipicolinate reductase 3.84e-02 2.64e-02 NA NA
5. P B7M0C7 4-hydroxy-tetrahydrodipicolinate reductase 1.37e-02 1.76e-03 NA NA
5. P B7IPB0 4-hydroxy-tetrahydrodipicolinate reductase 3.79e-02 3.62e-03 NA NA
5. P Q0TLW0 4-hydroxy-tetrahydrodipicolinate reductase 1.39e-02 1.50e-03 NA NA
5. P A5F5N9 4-hydroxy-tetrahydrodipicolinate reductase 5.52e-02 4.47e-02 NA NA
5. P C6BTW9 4-hydroxy-tetrahydrodipicolinate reductase 6.55e-02 2.04e-02 NA NA
5. P Q8CP95 4-hydroxy-tetrahydrodipicolinate reductase 3.94e-02 3.58e-02 NA NA
5. P B2JGX9 4-hydroxy-tetrahydrodipicolinate reductase 4.79e-02 3.97e-02 NA NA
5. P B7MAF2 4-hydroxy-tetrahydrodipicolinate reductase 1.53e-02 1.50e-03 NA NA
5. P B7JH17 4-hydroxy-tetrahydrodipicolinate reductase 3.78e-02 3.41e-02 NA NA
5. P B8DWI3 4-hydroxy-tetrahydrodipicolinate reductase 6.64e-02 1.08e-02 NA NA
5. P B0V9I9 L-aspartate dehydrogenase 4.27e-02 4.00e-02 NA NA
5. P Q73I13 4-hydroxy-tetrahydrodipicolinate reductase 3.42e-02 5.13e-03 NA NA
5. P B9DRX8 4-hydroxy-tetrahydrodipicolinate reductase 1.19e-02 2.89e-02 NA NA
5. P B1JKZ4 4-hydroxy-tetrahydrodipicolinate reductase 4.28e-02 4.63e-03 NA NA
5. P P58210 4-hydroxy-tetrahydrodipicolinate reductase 1 1.17e-02 1.10e-02 NA NA
5. P Q5M154 4-hydroxy-tetrahydrodipicolinate reductase 1.92e-02 3.73e-02 NA NA
5. P B1HTF0 4-hydroxy-tetrahydrodipicolinate reductase 1.32e-02 7.48e-03 NA NA
5. P Q81FP4 4-hydroxy-tetrahydrodipicolinate reductase 3.86e-02 3.91e-03 NA NA
5. P Q6F6R2 4-hydroxy-tetrahydrodipicolinate reductase 1.65e-02 2.80e-03 NA NA
5. P C6E9Q8 4-hydroxy-tetrahydrodipicolinate reductase 5.34e-02 4.73e-02 NA NA
5. P A6VCL6 4-hydroxy-tetrahydrodipicolinate reductase 3.00e-02 1.50e-03 NA NA
5. P Q88W01 4-hydroxy-tetrahydrodipicolinate reductase 2.22e-02 5.53e-03 NA NA
5. P Q8FV07 4-hydroxy-tetrahydrodipicolinate reductase 7.95e-02 1.91e-02 NA NA
5. P Q02FR3 4-hydroxy-tetrahydrodipicolinate reductase 3.93e-02 1.50e-03 NA NA
5. P A1A780 4-hydroxy-tetrahydrodipicolinate reductase 1.30e-02 1.50e-03 NA NA
5. P Q1IF57 4-hydroxy-tetrahydrodipicolinate reductase 3.01e-02 5.35e-03 NA NA
5. P A8H756 4-hydroxy-tetrahydrodipicolinate reductase 1.20e-02 1.05e-02 NA NA
5. P B5Y210 4-hydroxy-tetrahydrodipicolinate reductase 1.62e-02 1.13e-02 NA NA
5. P Q2SMM6 4-hydroxy-tetrahydrodipicolinate reductase 4.32e-02 1.25e-02 NA NA
5. P Q607A7 4-hydroxy-tetrahydrodipicolinate reductase 3.91e-02 1.44e-03 NA NA
5. P Q3YRP2 4-hydroxy-tetrahydrodipicolinate reductase 5.24e-02 2.06e-02 NA NA
5. P B5F744 4-hydroxy-tetrahydrodipicolinate reductase 1.39e-02 1.92e-03 NA NA
5. P Q47RU3 4-hydroxy-tetrahydrodipicolinate reductase 2.76e-02 2.62e-02 NA NA
5. P Q57TJ7 4-hydroxy-tetrahydrodipicolinate reductase 4.54e-02 1.97e-03 NA NA
5. P Q8XVT2 4-hydroxy-tetrahydrodipicolinate reductase 3.44e-02 3.68e-03 NA NA
5. P Q7N8W3 4-hydroxy-tetrahydrodipicolinate reductase 1.15e-02 7.55e-03 NA NA
5. P B8E2S7 4-hydroxy-tetrahydrodipicolinate reductase 1.80e-02 5.47e-04 NA NA
5. P A1KRN3 4-hydroxy-tetrahydrodipicolinate reductase 5.96e-02 4.23e-02 NA NA
5. P B2K3N1 4-hydroxy-tetrahydrodipicolinate reductase 3.64e-02 3.75e-03 NA NA
5. P Q1C0I8 4-hydroxy-tetrahydrodipicolinate reductase 4.40e-02 3.75e-03 NA NA
5. P Q63DK0 4-hydroxy-tetrahydrodipicolinate reductase 3.78e-02 4.83e-03 NA NA
5. P Q576R4 4-hydroxy-tetrahydrodipicolinate reductase 3.06e-02 4.03e-02 NA NA
5. P B4RR35 4-hydroxy-tetrahydrodipicolinate reductase 6.24e-02 4.91e-02 NA NA
5. P B1IRE5 4-hydroxy-tetrahydrodipicolinate reductase 1.56e-02 1.71e-03 NA NA
5. P B7GY04 L-aspartate dehydrogenase 4.30e-02 4.00e-02 NA NA
5. P A8FEI3 4-hydroxy-tetrahydrodipicolinate reductase 1.09e-01 2.50e-03 NA NA
5. P Q5FFT0 4-hydroxy-tetrahydrodipicolinate reductase 3.14e-02 1.72e-02 NA NA
5. P B5RG99 4-hydroxy-tetrahydrodipicolinate reductase 1.53e-02 1.76e-03 NA NA
5. P B1KRS8 4-hydroxy-tetrahydrodipicolinate reductase 1.21e-02 2.61e-03 NA NA
5. P A7ZVX9 4-hydroxy-tetrahydrodipicolinate reductase 1.40e-02 1.76e-03 NA NA
5. P Q52419 4-hydroxy-tetrahydrodipicolinate reductase 4.52e-02 4.87e-03 NA NA
5. P B7I8C4 L-aspartate dehydrogenase 3.27e-02 4.00e-02 NA NA
5. P P38103 4-hydroxy-tetrahydrodipicolinate reductase 4.02e-02 1.50e-03 NA NA
5. P B5YEB2 4-hydroxy-tetrahydrodipicolinate reductase 1.54e-02 1.17e-03 NA NA
5. P B5FHF8 4-hydroxy-tetrahydrodipicolinate reductase 1.51e-02 1.79e-03 NA NA
5. P B8FQZ3 4-hydroxy-tetrahydrodipicolinate reductase 2.80e-02 1.04e-02 NA NA
5. P B7N7Q5 4-hydroxy-tetrahydrodipicolinate reductase 1.57e-02 1.71e-03 NA NA
5. P B4TIG4 4-hydroxy-tetrahydrodipicolinate reductase 1.51e-02 1.92e-03 NA NA
5. P P0AD13 Protein YeeZ 8.58e-03 7.24e-03 NA NA
5. P A9MYI6 4-hydroxy-tetrahydrodipicolinate reductase 1.57e-02 1.79e-03 NA NA
5. P P04036 4-hydroxy-tetrahydrodipicolinate reductase 1.49e-02 1.71e-03 NA NA
5. P B8E4S9 4-hydroxy-tetrahydrodipicolinate reductase 1.07e-02 3.08e-02 NA NA
5. P C3LQT6 4-hydroxy-tetrahydrodipicolinate reductase 6.28e-02 4.47e-02 NA NA
5. P Q8XRV9 L-aspartate dehydrogenase 2.88e-02 3.61e-02 NA NA
5. P B4T6J1 4-hydroxy-tetrahydrodipicolinate reductase 1.53e-02 1.92e-03 NA NA
5. P Q74GT5 4-hydroxy-tetrahydrodipicolinate reductase 4.12e-02 3.88e-02 NA NA
5. P A8ALS4 4-hydroxy-tetrahydrodipicolinate reductase 1.34e-02 9.22e-03 NA NA
5. P B8CKF7 4-hydroxy-tetrahydrodipicolinate reductase 4.20e-02 6.33e-03 NA NA
5. P Q5PIL9 4-hydroxy-tetrahydrodipicolinate reductase 1.43e-02 1.41e-03 NA NA
5. P O87691 Cobalt-precorrin-6A reductase 2.74e-03 1.40e-02 NA NA
5. P C5BWQ6 4-hydroxy-tetrahydrodipicolinate reductase 4.72e-02 4.69e-02 NA NA
5. P B5BL41 4-hydroxy-tetrahydrodipicolinate reductase 4.02e-02 1.41e-03 NA NA
5. P A2RJS9 4-hydroxy-tetrahydrodipicolinate reductase 3.48e-02 7.74e-03 NA NA
5. P C0Q4K5 4-hydroxy-tetrahydrodipicolinate reductase 1.54e-02 1.97e-03 NA NA
5. P Q0HLM3 4-hydroxy-tetrahydrodipicolinate reductase 4.18e-02 2.09e-02 NA NA
5. P Q8YDC8 4-hydroxy-tetrahydrodipicolinate reductase 3.05e-02 2.71e-02 NA NA
5. P B5EGX3 4-hydroxy-tetrahydrodipicolinate reductase 4.80e-02 3.10e-02 NA NA
5. P Q8EQD3 4-hydroxy-tetrahydrodipicolinate reductase 1.31e-02 5.49e-03 NA NA
5. P Q5GTA6 4-hydroxy-tetrahydrodipicolinate reductase 5.17e-02 1.15e-02 NA NA
5. P A0RBY6 4-hydroxy-tetrahydrodipicolinate reductase 3.80e-02 3.41e-02 NA NA
5. P Q8Z9L9 4-hydroxy-tetrahydrodipicolinate reductase 1.60e-02 1.79e-03 NA NA
5. P B2I2G4 4-hydroxy-tetrahydrodipicolinate reductase 2.82e-02 1.08e-02 NA NA
5. P A4TQE9 4-hydroxy-tetrahydrodipicolinate reductase 4.45e-02 3.75e-03 NA NA
5. P B5R1Q4 4-hydroxy-tetrahydrodipicolinate reductase 1.43e-02 1.83e-03 NA NA
5. P A1JJE5 4-hydroxy-tetrahydrodipicolinate reductase 3.35e-02 4.22e-03 NA NA
5. P Q2YBT6 4-hydroxy-tetrahydrodipicolinate reductase 3.55e-02 7.12e-03 NA NA
5. P B2GC12 4-hydroxy-tetrahydrodipicolinate reductase 2.57e-02 1.45e-03 NA NA
5. P A3MA87 4-hydroxy-tetrahydrodipicolinate reductase 2.78e-02 1.08e-02 NA NA
5. P B7V1H1 4-hydroxy-tetrahydrodipicolinate reductase 3.93e-02 1.50e-03 NA NA
5. P A6Q596 4-hydroxy-tetrahydrodipicolinate reductase 8.45e-03 1.99e-02 NA NA
5. P C6DF00 4-hydroxy-tetrahydrodipicolinate reductase 4.49e-02 2.90e-03 NA NA
5. P A9MR41 4-hydroxy-tetrahydrodipicolinate reductase 1.26e-02 7.74e-03 NA NA
5. P P58326 4-hydroxy-tetrahydrodipicolinate reductase 3.90e-02 1.17e-02 NA NA
5. P B4F2T9 4-hydroxy-tetrahydrodipicolinate reductase 3.90e-02 4.79e-03 NA NA
5. P A3M394 L-aspartate dehydrogenase 3.35e-02 4.00e-02 NA NA
5. P B2HVA8 L-aspartate dehydrogenase 3.44e-02 4.00e-02 NA NA
5. P B9IVQ5 4-hydroxy-tetrahydrodipicolinate reductase 3.56e-02 1.38e-02 NA NA
5. P O28955 Uncharacterized protein AF_1314 1.97e-02 1.60e-03 NA NA
5. P Q0AER1 4-hydroxy-tetrahydrodipicolinate reductase 2.90e-02 4.88e-02 NA NA
5. P A4VPQ3 4-hydroxy-tetrahydrodipicolinate reductase 3.70e-02 8.13e-03 NA NA
5. P B1XBF6 4-hydroxy-tetrahydrodipicolinate reductase 1.46e-02 1.71e-03 NA NA
5. P Q5F5Y7 4-hydroxy-tetrahydrodipicolinate reductase 6.17e-02 4.91e-02 NA NA
5. P Q3KI98 4-hydroxy-tetrahydrodipicolinate reductase 2.12e-02 1.50e-02 NA NA
5. P Q8FLB4 4-hydroxy-tetrahydrodipicolinate reductase 1.47e-02 1.50e-03 NA NA
5. P A4JBH8 4-hydroxy-tetrahydrodipicolinate reductase 5.54e-02 3.36e-02 NA NA
5. P P42976 4-hydroxy-tetrahydrodipicolinate reductase 1.06e-01 6.17e-03 NA NA
5. P B7UI76 4-hydroxy-tetrahydrodipicolinate reductase 1.40e-02 1.57e-03 NA NA
5. P P58209 4-hydroxy-tetrahydrodipicolinate reductase 1.45e-02 2.11e-03 NA NA
5. P Q1CMU5 4-hydroxy-tetrahydrodipicolinate reductase 3.74e-02 3.75e-03 NA NA
5. P A4W6E7 4-hydroxy-tetrahydrodipicolinate reductase 1.44e-02 3.24e-03 NA NA
5. P B0VA26 4-hydroxy-tetrahydrodipicolinate reductase 3.03e-02 1.26e-02 NA NA
5. P Q24UK0 4-hydroxy-tetrahydrodipicolinate reductase 2.71e-02 1.04e-02 NA NA
5. P P0AD12 Protein YeeZ 8.44e-03 7.24e-03 NA NA
5. P Q48E64 4-hydroxy-tetrahydrodipicolinate reductase 4.54e-02 2.90e-03 NA NA
5. P Q8EHS7 4-hydroxy-tetrahydrodipicolinate reductase 1.07e-02 3.67e-02 NA NA
5. P Q8DUL9 4-hydroxy-tetrahydrodipicolinate reductase 1.93e-02 7.80e-03 NA NA
5. P A9R003 4-hydroxy-tetrahydrodipicolinate reductase 4.24e-02 3.75e-03 NA NA
5. P Q7MNU2 4-hydroxy-tetrahydrodipicolinate reductase 5.59e-02 4.13e-02 NA NA
5. P A7FMD2 4-hydroxy-tetrahydrodipicolinate reductase 4.32e-02 5.04e-03 NA NA
5. P Q66ER9 4-hydroxy-tetrahydrodipicolinate reductase 5.19e-02 3.75e-03 NA NA
5. P A7ZHC0 4-hydroxy-tetrahydrodipicolinate reductase 1.49e-02 1.76e-03 NA NA
5. P A3QGV8 4-hydroxy-tetrahydrodipicolinate reductase 3.60e-02 1.40e-03 NA NA
5. P Q1RGH0 4-hydroxy-tetrahydrodipicolinate reductase 1.38e-02 1.50e-03 NA NA
5. P B7GV10 4-hydroxy-tetrahydrodipicolinate reductase 3.06e-02 1.26e-02 NA NA
5. P Q87WP2 4-hydroxy-tetrahydrodipicolinate reductase 4.43e-02 1.47e-02 NA NA
5. P Q65I50 4-hydroxy-tetrahydrodipicolinate reductase 1.11e-01 3.58e-02 NA NA
5. P Q4ZNP9 4-hydroxy-tetrahydrodipicolinate reductase 4.50e-02 5.49e-03 NA NA
5. P Q8ZIL6 4-hydroxy-tetrahydrodipicolinate reductase 4.28e-02 3.75e-03 NA NA
5. P B3CN84 4-hydroxy-tetrahydrodipicolinate reductase 1.71e-02 4.86e-04 NA NA
5. P B7GUF6 4-hydroxy-tetrahydrodipicolinate reductase 2.29e-02 3.00e-02 NA NA
5. P Q81SU0 4-hydroxy-tetrahydrodipicolinate reductase 3.96e-02 2.64e-02 NA NA
5. P Q3Z5X9 4-hydroxy-tetrahydrodipicolinate reductase 1.49e-02 2.59e-03 NA NA
5. P B8F8Q1 4-hydroxy-tetrahydrodipicolinate reductase 4.26e-02 7.67e-03 NA NA
5. P B0VPZ8 4-hydroxy-tetrahydrodipicolinate reductase 2.84e-02 1.03e-02 NA NA
5. P B2U250 4-hydroxy-tetrahydrodipicolinate reductase 1.56e-02 2.80e-03 NA NA
5. P A7Z600 4-hydroxy-tetrahydrodipicolinate reductase 1.10e-01 4.80e-02 NA NA
5. P Q8DEM0 4-hydroxy-tetrahydrodipicolinate reductase 5.84e-02 1.68e-02 NA NA
5. P B6HYX9 4-hydroxy-tetrahydrodipicolinate reductase 1.49e-02 1.76e-03 NA NA
5. P Q8RQN0 4-hydroxy-tetrahydrodipicolinate reductase 1.20e-01 1.72e-02 NA NA
5. P A0KTT2 4-hydroxy-tetrahydrodipicolinate reductase 1.23e-02 3.36e-02 NA NA
6. F A1JMY5 K(+)/H(+) antiporter NhaP2 3.90e-02 NA NA 0.286
6. F B1IPB4 Glutathione-regulated potassium-efflux system protein KefB 6.35e-04 NA NA 0.8353
6. F A9MT17 Glutathione-regulated potassium-efflux system protein KefB 6.13e-04 NA NA 0.8334
6. F P65525 K(+)/H(+) antiporter NhaP2 1.96e-02 NA NA 0.2822
6. F B1JIU4 Glutathione-regulated potassium-efflux system protein KefB 2.64e-04 NA NA 0.7905
6. F B7MTW9 K(+)/H(+) antiporter NhaP2 2.81e-02 NA NA 0.7134
6. F B5FJN1 Glutathione-regulated potassium-efflux system protein KefB 2.65e-04 NA NA 0.8163
6. F A4WBF0 K(+)/H(+) antiporter NhaP2 2.63e-02 NA NA 0.6848
6. F B6I3R8 Putative transport protein YidE 2.73e-02 NA NA 0.5465
6. F Q9P4R4 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] 1.15e-02 NA NA 0.4614
6. F Q64PN7 Uncharacterized transporter BF3802 2.38e-02 NA NA 0.5426
6. F Q8FLA1 Glutathione-regulated potassium-efflux system protein KefC 7.03e-04 NA NA 0.8206
6. F A6TAW2 K(+)/H(+) antiporter NhaP2 2.69e-02 NA NA 0.6852
6. F A7FPA6 Putative transport protein YpsIP31758_4141 2.62e-02 NA NA 0.547
6. F A4TGM8 Putative transport protein YPDSF_0014 2.80e-02 NA NA 0.5471
6. F A0KTG6 K(+)/H(+) antiporter NhaP2 2.16e-02 NA NA 0.6563
6. F B2U255 Glutathione-regulated potassium-efflux system protein KefC 7.09e-04 NA NA 0.8197
6. F P39448 Trk system potassium uptake protein TrkA 3.13e-08 NA NA 0.6621
6. F Q1C2S9 Glutathione-regulated potassium-efflux system protein KefB 2.35e-03 NA NA 0.8183
6. F B1LL09 Putative transport protein YidE 2.70e-02 NA NA 0.5588
6. F B5BI52 K(+)/H(+) antiporter NhaP2 2.47e-02 NA NA 0.2841
6. F A8A6E4 Putative transport protein YidE 2.61e-02 NA NA 0.5591
6. F A5EX03 Putative transport protein DNO_0009 2.26e-02 NA NA 0.687
6. F B1X9B5 Putative transport protein YidE 2.58e-02 NA NA 0.3084
6. F Q0SYM8 Putative transport protein YidE 3.78e-02 NA NA 0.5591
6. F Q3KJ66 K(+)/H(+) antiporter NhaP2 3.29e-02 NA NA 0.3244
6. F Q8FNP2 Uncharacterized transporter CE2102 6.82e-02 NA NA 0.8249
6. F A4SJA2 Putative transport protein ASA_0825 4.09e-02 NA NA 0.51
6. F A9MN27 Glutathione-regulated potassium-efflux system protein KefB 2.93e-04 NA NA 0.8018
6. F B2K7E7 Putative transport protein YPTS_4123 2.55e-02 NA NA 0.5297
6. F Q8NSS8 Uncharacterized transporter Cgl0590/cg0683 6.74e-02 NA NA 0.8298
6. F B7L4M7 Glutathione-regulated potassium-efflux system protein KefB 3.06e-04 NA NA 0.82
6. F Q8ZRW2 Glutathione-regulated potassium-efflux system protein KefC 6.59e-04 NA NA 0.8202
6. F Q32H24 K(+)/H(+) antiporter NhaP2 2.71e-02 NA NA 0.7129
6. F Q795M8 Putative potassium channel protein YugO 1.88e-07 NA NA 0.4873
6. F E1V6C6 Trk system potassium uptake protein TrkA 2.16e-08 NA NA 0.6248
6. F B7MGA5 Putative transport protein YidE 3.99e-02 NA NA 0.3056
6. F B5YXL5 K(+)/H(+) antiporter NhaP2 2.69e-02 NA NA 0.7147
6. F B7LGV1 K(+)/H(+) antiporter NhaP2 2.86e-02 NA NA 0.6864
6. F A4TGX5 Glutathione-regulated potassium-efflux system protein KefB 4.36e-04 NA NA 0.8023
6. F B5FI29 Glutathione-regulated potassium-efflux system protein KefC 6.93e-04 NA NA 0.8202
6. F C0Q332 K(+)/H(+) antiporter NhaP2 2.54e-02 NA NA 0.2872
6. F B8F3F2 Putative transport protein HAPS_0158 3.36e-02 NA NA 0.5589
6. F Q664Q5 Glutathione-regulated potassium-efflux system protein KefB 4.00e-04 NA NA 0.8169
6. F C3LSD1 K(+)/H(+) antiporter NhaP2 2.66e-02 NA NA 0.287
6. F Q57NL1 K(+)/H(+) antiporter NhaP2 2.69e-02 NA NA 0.7172
6. F A6T4I3 Glutathione-regulated potassium-efflux system protein KefC 6.27e-04 NA NA 0.8328
6. F B5BIJ0 Putative transport protein YidE 2.87e-02 NA NA 0.557
6. F B1XC48 Glutathione-regulated potassium-efflux system protein KefC 6.92e-04 NA NA 0.8213
6. F B5QU35 Putative transport protein YidE 2.65e-02 NA NA 0.5583
6. F B7NQY5 Putative transport protein YidE 2.70e-02 NA NA 0.5465
6. F Q9KNM9 K(+)/H(+) antiporter NhaP2 2.77e-02 NA NA 0.3046
6. F B5BL23 Glutathione-regulated potassium-efflux system protein KefC 6.43e-04 NA NA 0.8198
6. F Q1R5T2 Glutathione-regulated potassium-efflux system protein KefB 6.74e-04 NA NA 0.8341
6. F C4ZTN2 K(+)/H(+) antiporter NhaP2 2.55e-02 NA NA 0.7152
6. F A9MJX2 Putative transport protein YidE 3.77e-02 NA NA 0.558
6. F Q57TH4 Glutathione-regulated potassium-efflux system protein KefC 6.83e-04 NA NA 0.82
6. F Q6CZU5 Glutathione-regulated potassium-efflux system protein KefB 4.00e-04 NA NA 0.817
6. F Q0HFK8 K(+)/H(+) antiporter NhaP2 2.16e-02 NA NA 0.6564
6. F B2TZB6 K(+)/H(+) antiporter NhaP2 2.20e-02 NA NA 0.6228
6. F B7LXA5 K(+)/H(+) antiporter NhaP2 2.88e-02 NA NA 0.72
6. F B7MK88 K(+)/H(+) antiporter NhaP2 2.91e-02 NA NA 0.7158
6. F P0CW17 Trk system potassium uptake protein TrkA homolog 1 8.33e-10 NA NA 0.5879
6. F B7MNQ4 Glutathione-regulated potassium-efflux system protein KefC 7.17e-04 NA NA 0.8205
6. F B5F767 Glutathione-regulated potassium-efflux system protein KefC 6.88e-04 NA NA 0.8093
6. F A7ZHE0 Glutathione-regulated potassium-efflux system protein KefC 7.13e-04 NA NA 0.8206
6. F A8ACJ7 Putative transport protein CKO_00031 4.02e-02 NA NA 0.5152
6. F A7FGZ9 K(+)/H(+) antiporter NhaP2 2.98e-02 NA NA 0.3514
6. F Q8YVX4 tRNA (guanine-N(7)-)-methyltransferase 3.05e-03 NA NA 0.3375
6. F Q89PK4 Uncharacterized transporter bll3476 8.06e-02 NA NA 0.609
6. F B4TXX1 K(+)/H(+) antiporter NhaP2 2.57e-02 NA NA 0.7178
6. F P44933 Glutathione-regulated potassium-efflux system protein 1.97e-04 NA NA 0.8292
6. F A1RGC9 K(+)/H(+) antiporter NhaP2 1.92e-02 NA NA 0.6577
6. F B5EY82 Putative transport protein YidE 2.34e-02 NA NA 0.56
6. F Q8AAG5 Uncharacterized transporter BT_0500 3.81e-02 NA NA 0.8129
6. F P60874 Putative transport protein YidE 2.70e-02 NA NA 0.3075
6. F Q3Z5W2 Glutathione-regulated potassium-efflux system protein KefC 6.91e-04 NA NA 0.8209
6. F B1X6K0 Glutathione-regulated potassium-efflux system protein KefB 3.42e-04 NA NA 0.8217
6. F A6TEY9 Glutathione-regulated potassium-efflux system protein KefB 5.63e-04 NA NA 0.8341
6. F A7ZVZ9 Glutathione-regulated potassium-efflux system protein KefC 8.47e-04 NA NA 0.8162
6. F A6TFY7 Putative transport protein KPN78578_40470 2.64e-02 NA NA 0.5676
6. F B4TMX5 Putative transport protein YidE 2.37e-02 NA NA 0.4922
6. F Q8FBW6 Putative transport protein YidE 3.97e-02 NA NA 0.3132
6. F B7MAH0 Glutathione-regulated potassium-efflux system protein KefC 7.13e-04 NA NA 0.8203
6. F O27564 Calcium-gated potassium channel MthK 5.08e-09 NA NA 0.5219
6. F Q48P74 K(+)/H(+) antiporter NhaP2 3.21e-02 NA NA 0.3234
6. F A8A5F8 Glutathione-regulated potassium-efflux system protein KefB 3.77e-04 NA NA 0.8204
6. F Q8ZL04 Putative transport protein YidE 2.35e-02 NA NA 0.5598
6. F P0A3R8 K(+)/H(+) antiporter NhaP2 2.79e-02 NA NA 0.7133
6. F Q87VB6 K(+)/H(+) antiporter NhaP2 3.31e-02 NA NA 0.3095
6. F A7ZTN8 Putative transport protein YidE 2.73e-02 NA NA 0.5113
6. F B6HZ28 Glutathione-regulated potassium-efflux system protein KefC 6.35e-04 NA NA 0.8214
6. F Q67MD6 Uncharacterized transporter STH2172 5.07e-02 NA NA 0.8665
6. F A9R473 Glutathione-regulated potassium-efflux system protein KefB 2.56e-03 NA NA 0.8189
6. F Q1RGF1 Glutathione-regulated potassium-efflux system protein KefC 7.03e-04 NA NA 0.8212
6. F A8G7S0 Putative transport protein Spro_0050 2.53e-02 NA NA 0.6134
6. F A8AQP0 Glutathione-regulated potassium-efflux system protein KefB 3.13e-04 NA NA 0.8318
6. F Q1RCQ5 K(+)/H(+) antiporter NhaP2 2.91e-02 NA NA 0.713
6. F Q979Z2 Calcium-gated potassium channel TvoK 2.94e-08 NA NA 0.4635
6. F Q9X756 Glutathione-regulated potassium-efflux system protein KefC 1.96e-05 NA NA 0.8223
6. F B4T6L2 Glutathione-regulated potassium-efflux system protein KefC 6.63e-04 NA NA 0.82
6. F B7M0E4 Glutathione-regulated potassium-efflux system protein KefC 7.02e-04 NA NA 0.8207
6. F B5F4E6 K(+)/H(+) antiporter NhaP2 2.03e-02 NA NA 0.713
6. F B5XN76 Glutathione-regulated potassium-efflux system protein KefB 6.59e-04 NA NA 0.8335
6. F P58936 Trk system potassium uptake protein TrkA homolog 2 1.98e-10 NA NA 0.6021
6. F P0A3R7 K(+)/H(+) antiporter NhaP2 2.77e-02 NA NA 0.6223
6. F Q1CD76 Putative transport protein YPN_3727 2.66e-02 NA NA 0.5416
6. F B2K787 K(+)/H(+) antiporter NhaP2 3.99e-02 NA NA 0.3486
6. F Q0ZAH6 K(+)/H(+) antiporter NhaP 6.97e-02 NA NA 0.3332
6. F A7ME23 Glutathione-regulated potassium-efflux system protein KefB 3.46e-04 NA NA 0.8353
6. F Q57I28 Putative transport protein YidE 2.43e-02 NA NA 0.5588
6. F A5F4U3 K(+)/H(+) antiporter NhaP2 2.77e-02 NA NA 0.3073
6. F B7UI93 Glutathione-regulated potassium-efflux system protein KefC 7.08e-04 NA NA 0.8213
6. F A1AHM0 Putative transport protein YidE 3.92e-02 NA NA 0.3002
6. F A1AAB4 K(+)/H(+) antiporter NhaP2 2.75e-02 NA NA 0.7133
6. F B7NDV9 Glutathione-regulated potassium-efflux system protein KefB 2.82e-04 NA NA 0.8195
6. F A4VRA1 K(+)/H(+) antiporter NhaP2 2.34e-02 NA NA 0.2993
6. F A3N0X4 Putative transport protein APL_0966 3.21e-02 NA NA 0.5474
6. F O29420 Trk system potassium uptake protein TrkA homolog 1.90e-11 NA NA 0.544
6. F Q83PY0 Putative glutathione-regulated potassium-efflux system protein KefB 3.47e-04 NA NA 0.8298
6. F B4TWT1 Glutathione-regulated potassium-efflux system protein KefC 7.12e-04 NA NA 0.8208
6. F Q1R4Q2 Putative transport protein YidE 3.98e-02 NA NA 0.3112
6. F P65524 K(+)/H(+) antiporter NhaP2 2.05e-02 NA NA 0.7098
6. F Q6APL9 Uncharacterized transporter DP0976 2.89e-02 NA NA 0.5522
6. F A1WYD5 Siroheme synthase 2 2.74e-02 NA NA 0.3991
6. F A0KIB2 K(+)/H(+) antiporter NhaP2 1.98e-02 NA NA 0.32
6. F P0A2J9 Trk system potassium uptake protein TrkA 2.68e-08 NA NA 0.6541
6. F A7MIA0 Glutathione-regulated potassium-efflux system protein KefC 6.07e-04 NA NA 0.834
6. F Q8FCY0 Glutathione-regulated potassium-efflux system protein KefB 3.63e-04 NA NA 0.8162
6. F A6VKA8 Putative transport protein Asuc_0023 3.22e-02 NA NA 0.5997
6. F Q31ZN1 K(+)/H(+) antiporter NhaP2 2.78e-02 NA NA 0.2861
6. F Q64TC3 Uncharacterized transporter BF2507 5.58e-02 NA NA 0.5171
6. F Q326I6 Glutathione-regulated potassium-efflux system protein KefC 7.26e-04 NA NA 0.8097
6. F B4TJ42 Glutathione-regulated potassium-efflux system protein KefC 6.74e-04 NA NA 0.8207
6. F A4YA01 K(+)/H(+) antiporter NhaP2 2.18e-02 NA NA 0.6563
6. F A7ZZC5 K(+)/H(+) antiporter NhaP2 2.17e-02 NA NA 0.7137
6. F Q31UU4 Putative transport protein YidE 2.64e-02 NA NA 0.5231
6. F B0URX9 Putative transport protein HSM_0534 3.56e-02 NA NA 0.3079
6. F Q6NJ43 Uncharacterized transporter DIP0570 8.99e-02 NA NA 0.8363
6. F B4TKN2 Glutathione-regulated potassium-efflux system protein KefB 3.25e-04 NA NA 0.8043
6. F Q7MUS4 Uncharacterized transporter PG_1411 4.66e-02 NA NA 0.5308
6. F A9R4H0 Putative transport protein YpAngola_A3793 2.83e-02 NA NA 0.5305
6. F B1IUA1 K(+)/H(+) antiporter NhaP2 2.65e-02 NA NA 0.7128
6. F B5F8G9 Glutathione-regulated potassium-efflux system protein KefB 2.91e-04 NA NA 0.8126
6. F Q74EE6 Uncharacterized transporter GSU1016 5.08e-02 NA NA 0.868
6. F Q57J15 Glutathione-regulated potassium-efflux system protein KefB 5.68e-04 NA NA 0.8321
6. F Q0TB22 Putative transport protein YidE 3.87e-02 NA NA 0.378
6. F Q8Z9K0 Glutathione-regulated potassium-efflux system protein KefC 6.53e-04 NA NA 0.8205
6. F Q7WJ43 Uncharacterized transporter BB2657 6.25e-02 NA NA 0.5824
6. F Q0HYC2 K(+)/H(+) antiporter NhaP2 1.96e-02 NA NA 0.6583
6. F A7MKD6 K(+)/H(+) antiporter NhaP2 2.54e-02 NA NA 0.7155
6. F B7NF02 Putative transport protein YidE 2.70e-02 NA NA 0.3136
6. F Q5PIL3 Glutathione-regulated potassium-efflux system protein KefC 7.39e-04 NA NA 0.8263
6. F B3GXV8 Putative transport protein APP7_1021 3.20e-02 NA NA 0.475
6. F D3FSJ2 Ammonium/H(+) antiporter subunit AmhM 1.00e-02 NA NA 0.5591
6. F B5YZ83 Glutathione-regulated potassium-efflux system protein KefC 6.38e-04 NA NA 0.8222
6. F Q5PKS7 Putative transport protein YidE 3.65e-02 NA NA 0.4984
6. F C5BC80 Putative transport protein NT01EI_3867 2.64e-02 NA NA 0.4476
6. F B5XT62 Putative transport protein KPK_0013 2.40e-02 NA NA 0.5671
6. F C3KBV7 K(+)/H(+) antiporter NhaP2 3.05e-02 NA NA 0.3241
6. F Q3YWS1 Glutathione-regulated potassium-efflux system protein KefB 4.35e-04 NA NA 0.8327
6. F A4WFE4 Glutathione-regulated potassium-efflux system protein KefB 3.53e-04 NA NA 0.7996
6. F Q0T8E8 Glutathione-regulated potassium-efflux system protein KefC 7.06e-04 NA NA 0.8208
6. F B5BH03 Glutathione-regulated potassium-efflux system protein KefB 3.19e-04 NA NA 0.7985
6. F B7LS57 Glutathione-regulated potassium-efflux system protein KefB 5.66e-04 NA NA 0.833
6. F Q83RQ1 K(+)/H(+) antiporter NhaP2 3.40e-02 NA NA 0.71
6. F A5WA99 K(+)/H(+) antiporter NhaP2 3.36e-02 NA NA 0.3221
6. F B8EE41 K(+)/H(+) antiporter NhaP2 1.94e-02 NA NA 0.6575
6. F B7MCW6 Glutathione-regulated potassium-efflux system protein KefB 6.25e-04 NA NA 0.8201
6. F Q6NIE7 Uncharacterized transporter DIP0830 2.81e-02 NA NA 0.8476
6. F C0Q247 Putative transport protein YidE 3.95e-02 NA NA 0.5586
6. F Q89PK9 Uncharacterized transporter bll3471 7.02e-02 NA NA 0.5366
6. F B1JHF7 K(+)/H(+) antiporter NhaP2 3.78e-02 NA NA 0.3468
6. F Q1IG71 K(+)/H(+) antiporter NhaP2 3.12e-02 NA NA 0.3238
6. F B5XQ83 K(+)/H(+) antiporter NhaP2 2.85e-02 NA NA 0.6116
6. F B7UQ75 K(+)/H(+) antiporter NhaP2 2.76e-02 NA NA 0.7144
6. F B4TA59 Putative transport protein YidE 2.54e-02 NA NA 0.5458
6. F Q7WA16 Uncharacterized transporter BPP1579 5.01e-02 NA NA 0.5853
6. F Q0ZAH7 Putative K(+) efflux antiporter KefB 2.54e-06 NA NA 0.4851
6. F C4ZPX3 Glutathione-regulated potassium-efflux system protein KefC 6.94e-04 NA NA 0.8208
6. F Q3Z2V7 K(+)/H(+) antiporter NhaP2 2.73e-02 NA NA 0.714
6. F B7NHF1 Glutathione-regulated potassium-efflux system protein KefC 7.28e-04 NA NA 0.8196
6. F Q3YWC7 Putative transport protein YidE 2.66e-02 NA NA 0.5469
6. F Q663W8 Putative transport protein YPTB3906 2.64e-02 NA NA 0.5221
6. F B2VK47 Glutathione-regulated potassium-efflux system protein KefB 3.15e-04 NA NA 0.7994
6. F B7L4H0 Glutathione-regulated potassium-efflux system protein KefC 7.20e-04 NA NA 0.817
6. F A6WJS5 K(+)/H(+) antiporter NhaP2 2.66e-02 NA NA 0.6561
6. F B7M4H4 Putative transport protein YidE 2.59e-02 NA NA 0.5469
6. F Q31VU0 Glutathione-regulated potassium-efflux system protein KefB 4.03e-04 NA NA 0.8166
6. F Q83SQ3 Glutathione-regulated potassium-efflux system protein KefC 7.00e-04 NA NA 0.8294
6. F B4SY75 Putative transport protein YidE 3.77e-02 NA NA 0.5585
6. F B7LVT8 Glutathione-regulated potassium-efflux system protein KefC 6.74e-04 NA NA 0.8214
6. F A0KNW5 Putative transport protein AHA_3492 4.85e-02 NA NA 0.518
6. F B1XA78 K(+)/H(+) antiporter NhaP2 2.67e-02 NA NA 0.7134
6. F C0Q4N0 Glutathione-regulated potassium-efflux system protein KefC 6.90e-04 NA NA 0.8198
6. F Q8ZLL3 Glutathione-regulated potassium-efflux system protein KefB 2.78e-04 NA NA 0.8003
6. F A8G002 K(+)/H(+) antiporter NhaP2 1.97e-02 NA NA 0.3206
6. F B5R2W9 K(+)/H(+) antiporter NhaP2 2.82e-02 NA NA 0.6617
6. F Q4ZZ50 K(+)/H(+) antiporter NhaP2 3.37e-02 NA NA 0.3208
6. F Q8Z2L7 Putative transport protein YidE 3.86e-02 NA NA 0.5581
6. F Q5PN10 K(+)/H(+) antiporter NhaP2 2.20e-02 NA NA 0.2833
6. F Q1C3K8 Putative transport protein YPA_3002 2.76e-02 NA NA 0.5295
6. F B5R1S4 Glutathione-regulated potassium-efflux system protein KefC 7.02e-04 NA NA 0.8019
6. F A1AGN6 Glutathione-regulated potassium-efflux system protein KefB 6.10e-04 NA NA 0.8347
6. F A9L2N8 K(+)/H(+) antiporter NhaP2 1.96e-02 NA NA 0.657
6. F B5R2A8 Glutathione-regulated potassium-efflux system protein KefB 2.88e-04 NA NA 0.798
6. F B4SUJ3 K(+)/H(+) antiporter NhaP2 1.92e-02 NA NA 0.2823
6. F C4ZUK6 Glutathione-regulated potassium-efflux system protein KefB 3.32e-04 NA NA 0.8353
6. F A3D839 K(+)/H(+) antiporter NhaP2 2.01e-02 NA NA 0.6567
6. F B6I2Q9 Glutathione-regulated potassium-efflux system protein KefB 2.73e-04 NA NA 0.8207
6. F A9MWJ2 Putative transport protein YidE 2.33e-02 NA NA 0.5601
6. F Q329C8 Putative transport protein YidE 3.83e-02 NA NA 0.3118
6. F Q6LQ84 Putative transport protein PBPRA2144 5.14e-02 NA NA 0.5492
6. F A9MQG6 Glutathione-regulated potassium-efflux system protein KefC 6.66e-04 NA NA 0.8204
6. F B1JGZ7 Putative transport protein YPK_0013 2.77e-02 NA NA 0.5225
6. F C6DG97 Glutathione-regulated potassium-efflux system protein KefB 5.41e-04 NA NA 0.8346
6. F B7N7S2 Glutathione-regulated potassium-efflux system protein KefC 6.92e-04 NA NA 0.821
6. F B7NUV2 K(+)/H(+) antiporter NhaP2 2.79e-02 NA NA 0.7155
6. F Q5NLV5 Uncharacterized transporter ZMO1681 7.78e-02 NA NA 0.5679
6. F B5Y1Z8 Glutathione-regulated potassium-efflux system protein KefC 5.71e-04 NA NA 0.8325
6. F P60873 Putative transport protein YidE 3.82e-02 NA NA 0.7212
6. F Q669I8 K(+)/H(+) antiporter NhaP2 2.87e-02 NA NA 0.3496
6. F B7M1Q2 Glutathione-regulated potassium-efflux system protein KefB 6.46e-04 NA NA 0.8339
6. F B2TUT7 Putative transport protein YidE 2.71e-02 NA NA 0.3875
6. F Q8Z1Y7 Glutathione-regulated potassium-efflux system protein KefB 3.74e-04 NA NA 0.8333
6. F B7UK61 Glutathione-regulated potassium-efflux system protein KefB 5.14e-04 NA NA 0.8206
6. F A4W6F3 Glutathione-regulated potassium-efflux system protein KefC 4.81e-04 NA NA 0.8139
6. F A7ZSM6 Glutathione-regulated potassium-efflux system protein KefB 6.27e-04 NA NA 0.8225
6. F Q8Z9V7 Putative transport protein YPO4083/y4100/YP_3992 2.83e-02 NA NA 0.5559
6. F Q0TII4 K(+)/H(+) antiporter NhaP2 2.73e-02 NA NA 0.7129
6. F P71354 Trk system potassium uptake protein TrkA 1.48e-08 NA NA 0.6414
6. F B5R8Z9 K(+)/H(+) antiporter NhaP2 3.94e-02 NA NA 0.7219
6. F Q04856 Trk system potassium uptake protein TrkA 4.78e-09 NA NA 0.6776
6. F B7N2D1 Putative transport protein YidE 3.88e-02 NA NA 0.3066
6. F Q0T5K9 K(+)/H(+) antiporter NhaP2 2.83e-02 NA NA 0.7152
6. F Q5PL21 Glutathione-regulated potassium-efflux system protein KefB 3.08e-04 NA NA 0.8156
6. F Q87KV8 K(+)/H(+) antiporter NhaP2 1.96e-02 NA NA 0.3033
6. F Q0I5K7 Putative transport protein HS_1470 3.52e-02 NA NA 0.3093
6. F B1IYQ9 Putative transport protein YidE 2.70e-02 NA NA 0.3032
6. F B0KN20 K(+)/H(+) antiporter NhaP2 3.25e-02 NA NA 0.7507
6. F B7UMF2 Putative transport protein YidE 4.05e-02 NA NA 0.3074
6. F B1LHF1 Glutathione-regulated potassium-efflux system protein KefB 3.88e-04 NA NA 0.8025
6. F A8ALQ4 Glutathione-regulated potassium-efflux system protein KefC 6.34e-04 NA NA 0.8137
6. F B5FTN3 K(+)/H(+) antiporter NhaP2 2.53e-02 NA NA 0.2888
6. F A4W4S5 Putative transport protein Ent638_0015 2.39e-02 NA NA 0.3062
6. F Q2NTA7 K(+)/H(+) antiporter NhaP2 3.81e-02 NA NA 0.2847
6. F A7ZKW2 K(+)/H(+) antiporter NhaP2 2.72e-02 NA NA 0.7132
6. F Q64SU9 Uncharacterized transporter BF2680 4.02e-02 NA NA 0.79
6. F A1JT67 Putative transport protein YE4162 3.89e-02 NA NA 0.5856
6. F P56509 Uncharacterized protein Mfer_0534 9.78e-06 NA NA 0.5006
6. F B1LHX5 K(+)/H(+) antiporter NhaP2 3.00e-02 NA NA 0.7136
6. F B1J2K7 K(+)/H(+) antiporter NhaP2 3.37e-02 NA NA 0.3237
6. F Q8XA20 Glutathione-regulated potassium-efflux system protein KefC 7.51e-04 NA NA 0.809
6. F B7N3Z7 K(+)/H(+) antiporter NhaP2 2.92e-02 NA NA 0.6242
6. F B4TKD1 K(+)/H(+) antiporter NhaP2 2.83e-02 NA NA 0.718
6. F P0A2K0 Trk system potassium uptake protein TrkA 2.58e-08 NA NA 0.6606
6. F B7N1D2 Glutathione-regulated potassium-efflux system protein KefB 5.38e-04 NA NA 0.8346
6. F Q8ZJC4 Glutathione-regulated potassium-efflux system protein KefB 4.00e-04 NA NA 0.819
6. F B1LFY1 Glutathione-regulated potassium-efflux system protein KefC 7.24e-04 NA NA 0.8199
6. F Q8EAZ0 K(+)/H(+) antiporter NhaP2 2.15e-02 NA NA 0.4884
6. F Q88CW4 K(+)/H(+) antiporter NhaP2 3.25e-02 NA NA 0.306
6. F B5FMC7 Putative transport protein YidE 2.71e-02 NA NA 0.5459
6. F A5UFK5 Putative transport protein CGSHiGG_02670 4.43e-02 NA NA 0.703
6. F B0BPQ8 Putative transport protein APJL_0985 3.10e-02 NA NA 0.6084
6. F Q6CYV4 Putative transport protein ECA4401 2.70e-02 NA NA 0.5305
6. F Q6ARA9 Uncharacterized transporter DP0386 1.31e-01 NA NA 0.556
6. F P0CW16 Trk system potassium uptake protein trkA homolog 1 1.19e-07 NA NA 0.5563
6. F B4TXF9 Glutathione-regulated potassium-efflux system protein KefB 3.93e-04 NA NA 0.8311
6. F P0AGJ1 Trk system potassium uptake protein TrkA 2.28e-08 NA NA 0.6649
6. F Q8FS11 Uncharacterized transporter CE0595 6.35e-02 NA NA 0.8289
6. F B4SUV7 Glutathione-regulated potassium-efflux system protein KefB 6.24e-04 NA NA 0.8334
6. F B2U3F5 Glutathione-regulated potassium-efflux system protein KefB 3.43e-04 NA NA 0.8343
6. F Q4QPK9 Putative transport protein NTHI0043 3.43e-02 NA NA 0.6989
6. F O31615 Putative Na(+)/H(+) antiporter YjbQ 2.37e-06 NA NA 0.4156
6. F Q8X878 Glutathione-regulated potassium-efflux system protein KefB 2.75e-04 NA NA 0.8206
6. F Q1CCS7 Glutathione-regulated potassium-efflux system protein KefB 4.32e-04 NA NA 0.8184
6. F B1IRC9 Glutathione-regulated potassium-efflux system protein KefC 7.29e-04 NA NA 0.8207
6. F A4SPT0 K(+)/H(+) antiporter NhaP2 2.09e-02 NA NA 0.7286
6. F C4ZYW2 Putative transport protein YidE 2.74e-02 NA NA 0.3129
6. F Q9CLX8 Putative transport protein PM1071 3.15e-02 NA NA 0.5764
6. F Q8A5Z4 Uncharacterized transporter BT_2092 2.67e-02 NA NA 0.5165
6. F A9MVW9 K(+)/H(+) antiporter NhaP2 2.77e-02 NA NA 0.7126
6. F A9MYL9 Glutathione-regulated potassium-efflux system protein KefC 7.10e-04 NA NA 0.8196
6. F C0Q0D3 Glutathione-regulated potassium-efflux system protein KefB 6.11e-04 NA NA 0.8331
6. F B7LSJ3 K(+)/H(+) antiporter NhaP2 4.28e-02 NA NA 0.7124
6. F Q4KJF1 K(+)/H(+) antiporter NhaP2 3.19e-02 NA NA 0.3208
6. F Q0TLU2 Glutathione-regulated potassium-efflux system protein KefC 6.98e-04 NA NA 0.82
6. F P0AGJ0 Trk system potassium uptake protein TrkA 2.60e-08 NA NA 0.6603
6. F A6VDE2 K(+)/H(+) antiporter NhaP2 2.21e-02 NA NA 0.7725
6. F B7L824 Putative transport protein YidE 2.69e-02 NA NA 0.3248
6. F P0AGI9 Trk system potassium uptake protein TrkA 2.69e-08 NA NA 0.6609