Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54929.1

JCVISYN3A_0691

Uncharacterized protein.
M. mycoides homolog: Q6MSK7.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 62
Unique PROST Go: 39
Unique BLAST Go: 0
Unique Foldseek Go: 2

Total Homologs: 135
Unique PROST Homologs: 71
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 28

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Chaperone protein HtpG
Antczak et al. [3]: Transmembrane transporter, likely transporting cations, drugs or toxins
Zhang et al. [4]: GO:0015893|drug transport
Bianchi et al. [5]: "Unclear Membrane Protein, Transport"

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was O34674 (Lipid II flippase MurJ) with a FATCAT P-Value: 0 and RMSD of 3.15 angstrom. The sequence alignment identity is 19.4%.
Structural alignment shown in left. Query protein AVX54929.1 colored as red in alignment, homolog O34674 colored as blue. Query protein AVX54929.1 is also shown in right top, homolog O34674 showed in right bottom. They are colored based on secondary structures.

  AVX54929.1 MQVNVESTTANMPINDSKKTTSAK--SGVFSALLGV-VSSITNMIIQFLLIYWV-LQSFGTEI--SGFIRISMSLSIIGGTAEG-ALALSTVLMLTEPLS 93
      O34674 --------------------MSSKLLRGTFVLTLGTYISRILGMV--YLIPFSIMVGATGGALFQYGYNQYTLFLNI--ATM-GFPAAVSK--FVSKYNS 73

  AVX54929.1 KKDWITVNEIFSTAKRNYNNKIVSGFILVFLLSILYPLQIAISPLITSGESIKWGIDFTTPLSKTTSTLKFWELSAVFLILGTKQTLLAGLF-GVHENIM 192
      O34674 KGDYETSRKML---KAGMSVMLVTGMIAFFILYLSAPMFAEIS-L--GGKDNN-GL--T--IDHVVYVIRM--VSLALLVVPI-MSLVRGFFQG-H-QMM 157

  AVX54929.1 ------Q-ADQ--K-----NAS----K----KLVV-----LFCDVL--FYGIFFVLLNSYIYWNDKHTPVLLFLPFLFYPVIRGLLITSYVKK------K 257
      O34674 GPTAVSQVVEQIVRIIFLLSATFLILKVFNGGLVIAVGYATFAALIGAFGGL--VVL--YIYWNKRKGSLLAMMPNT-GPTA-NL---SY-KKMFFELFS 247

  AVX54929.1 Y--P------AIKFYN--DFNNLN--LIRRSTKIYWSSIGQSIL------VNSDLIIIFLALGS-IGLKVSSLI-SL--------YMVVAINLRI--IMT 327
      O34674 YAAPYVFVGLAIPLYNYIDTNTFNKAMIEAGHQ----AISQDMLAILTLYVQK-LVMIPVSLATAFGL---TLIPTITESFTSGNYKL--LNQQINQTMQ 337

  AVX54929.1 SLVTSFKEYFSSVIIKK--G--RLDWETYSNYEFYS--YI---VGVFSFLITSIMTPYIVTGLFSKIILNDVDTTGLTKKTIEFIIFSPFFSGIFGATTG 418
      O34674 TIL--F------LIIPAVVGISLLSGPTYT-F-FYGSESLHPELGA-NILLW--YSPVAI--LFSLFTVNAAILQGINKQ--KFAVVSL----VIGVVIK 416

  AVX54929.1 LIV---LLESKITLIHAKGMHRTIAKPLNLIAFSFFISSFIITLLLNRFIGNVESKISWVIIVFYSSKILFLIIAYIY---LWIFSWDKLVYNARFNRII 512
      O34674 LVLNVPLI--K--LMQADGA--ILATALGYIA-S-LLYGFI---MIKRHAG-----YSYKILV--KRTVLMLVLSAIMGIAVKIVQW--VL---GF---- 489

  AVX54929.1 PNILFVT-----LSAC--LVIAFSLSADDIYILLKFDTNKKVPVDILHIILGLIIIFIASFF-----IGILTFVYNKIVKNTSVTRLIFYSLPFIKRLNK 600
      O34674 ----FISYQDGQMQAAIVVVIAAAVGG-AVYLYCGY------RLGFLQKILGR---RLPGFFRKGRHAG------------------------------- 544

  AVX54929.1 EKQEKAKRDLFEKENINIDKFLLKQEDLLKAMYGFKEKKVIDQDEFEKYSKYKPKPKVYILKASDMNKDESEY 673
      O34674 ------------------------------------------------------------------------- 544

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
2. PF	GO:0042910	xenobiotic transmembrane transporter activity
2. PF	GO:0022857	transmembrane transporter activity
2. PF	GO:0005887	integral component of plasma membrane
2. PF	GO:0016021	integral component of membrane
2. PF	GO:0009252	peptidoglycan biosynthetic process
2. PF	GO:0005886	plasma membrane
2. PF	GO:0045232	S-layer organization
2. PF	GO:0006811	ion transport
2. PF	GO:0071555	cell wall organization
2. PF	GO:0015648	lipid-linked peptidoglycan transporter activity
2. PF	GO:0034204	lipid translocation
2. PF	GO:0006855	xenobiotic transmembrane transport
2. PF	GO:0015297	antiporter activity
2. PF	GO:0046677	response to antibiotic
2. PF	GO:0000271	polysaccharide biosynthetic process
2. PF	GO:0015836	lipid-linked peptidoglycan transport
2. PF	GO:0009243	O antigen biosynthetic process
2. PF	GO:0034203	glycolipid translocation
2. PF	GO:0098567	periplasmic side of plasma membrane
2. PF	GO:0008360	regulation of cell shape
2. PF	GO:0006488	dolichol-linked oligosaccharide biosynthetic process
5. P	GO:0006119	oxidative phosphorylation
5. P	GO:0030504	inorganic diphosphate transmembrane transporter activity
5. P	GO:0015231	5-formyltetrahydrofolate transmembrane transporter activity
5. P	GO:0098655	cation transmembrane transport
5. P	GO:0015179	L-amino acid transmembrane transporter activity
5. P	GO:0050845	teichuronic acid biosynthetic process
5. P	GO:0005507	copper ion binding
5. P	GO:0008517	folic acid transmembrane transporter activity
5. P	GO:0004129	cytochrome-c oxidase activity
5. P	GO:0015114	phosphate ion transmembrane transporter activity
5. P	GO:0034202	glycolipid floppase activity
5. P	GO:0070469	respirasome
5. P	GO:0097638	L-arginine import across plasma membrane
5. P	GO:0009060	aerobic respiration
5. P	GO:0009486	cytochrome bo3 ubiquinol oxidase activity
5. P	GO:0015884	folic acid transport
5. P	GO:0015453	oxidoreduction-driven active transmembrane transporter activity
5. P	GO:0089718	amino acid import across plasma membrane
5. P	GO:0008643	carbohydrate transport
5. P	GO:0000935	division septum
5. P	GO:0015990	electron transport coupled proton transport
5. P	GO:0015885	5-formyltetrahydrofolate transport
5. P	GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
5. P	GO:0042887	amide transmembrane transporter activity
5. P	GO:0031982	vesicle
5. P	GO:0005789	endoplasmic reticulum membrane
5. P	GO:0009246	enterobacterial common antigen biosynthetic process
5. P	GO:0009319	cytochrome o ubiquinol oxidase complex
5. P	GO:0020037	heme binding
5. P	GO:0022904	respiratory electron transport chain
5. P	GO:0016020	membrane
5. P	GO:0061459	L-arginine transmembrane transporter activity
5. P	GO:0051958	methotrexate transport
5. P	GO:0015350	methotrexate transmembrane transporter activity
5. P	GO:0042908	xenobiotic transport
5. P	GO:1902475	L-alpha-amino acid transmembrane transport
5. P	GO:0015695	organic cation transport
5. P	GO:1901612	cardiolipin binding
5. P	GO:0009242	colanic acid biosynthetic process
6. F	GO:0015774	polysaccharide transport
6. F	GO:0006814	sodium ion transport

Uniprot GO Annotations

GO	Description
GO:0016020	membrane
GO:0016021	integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
2. PF	P33699	Succinoglycan biosynthesis transport protein ExoT	1.22e-15	1.33e-10	NA	0.6838
2. PF	B4E9G3	Lipid II flippase MurJ	5.77e-11	4.59e-13	NA	0.5781
2. PF	P26400	Putative O-antigen transporter	9.21e-13	9.15e-03	NA	0.7374
2. PF	Q89AI1	Probable lipid II flippase MurJ	1.38e-13	8.41e-11	NA	0.641
2. PF	Q8K9L3	Probable lipid II flippase MurJ	0.00e+00	2.26e-10	NA	0.6658
2. PF	O34238	Probable lipid II flippase MurJ	7.09e-14	6.99e-09	NA	0.664
2. PF	P75130	Uncharacterized protein MG447 homolog	1.86e-10	9.92e-03	NA	0.4897
2. PF	Q05347	Putative O-antigen export protein	0.00e+00	1.25e-02	NA	0.6982
2. PF	Q9ZCW4	Probable lipid II flippase MurJ	0.00e+00	3.20e-09	NA	0.6786
2. PF	O34674	Lipid II flippase MurJ	0.00e+00	9.11e-17	NA	0.6591
2. PF	P37555	Uncharacterized membrane protein YabM	4.96e-13	1.19e-12	NA	0.6226
2. PF	P56882	Probable lipid II flippase MurJ	5.55e-13	4.57e-14	NA	0.6239
2. PF	Q4L8N9	Multidrug export protein MepA	2.78e-15	7.81e-04	NA	0.5924
2. PF	Q8VNZ2	Probable lipid II flippase MurJ	2.96e-14	3.34e-09	NA	0.6805
2. PF	Q7N1G0	Probable multidrug resistance protein NorM	2.71e-13	1.26e-03	NA	0.6355
2. PF	P37169	Probable lipid II flippase MurJ	1.23e-13	8.68e-10	NA	0.6614
2. PF	Q8UDF5	Probable multidrug resistance protein NorM	3.78e-11	5.14e-03	NA	0.5438
2. PF	O67658	Probable lipid II flippase MurJ	4.00e-11	3.87e-11	NA	0.6728
2. PF	P71060	Uncharacterized membrane protein EpsK	0.00e+00	9.05e-14	NA	0.6732
2. PF	P53660	Uncharacterized protein MG447 homolog MYCGA2290	2.75e-05	4.22e-04	NA	0.4848
2. PF	Q00758	Stage V sporulation protein B	5.05e-14	6.41e-17	NA	0.5803
2. PF	O05467	Probable lipid II flippase MurJ	0.00e+00	1.14e-13	NA	0.6098
2. PF	P0AF17	Probable lipid II flippase MurJ	7.48e-14	1.40e-13	NA	0.6658
2. PF	D4GYG8	Probable flippase AglR	5.56e-11	2.29e-11	NA	0.6336
2. PF	Q9HTR0	Probable multidrug resistance protein NorM	6.33e-10	1.14e-02	NA	0.4721
2. PF	P44958	Probable lipid II flippase MurJ	3.68e-10	8.62e-14	NA	0.6768
2. PF	P57415	Probable lipid II flippase MurJ	0.00e+00	9.61e-12	NA	0.6038
2. PF	B7IE18	Lipid II flippase MurJ	3.08e-10	2.47e-11	NA	0.6235
2. PF	D4GU68	Probable low-salt glycan biosynthesis flippase Agl15	2.23e-11	6.26e-05	NA	0.646
2. PF	O07940	Uncharacterized transporter YisQ	1.18e-12	1.32e-03	NA	0.4877
2. PF	Q9WXU1	Probable lipid II flippase MurJ	4.97e-13	2.64e-06	NA	0.5869
2. PF	Q48457	Uncharacterized membrane protein in cps region	3.33e-16	3.95e-09	NA	0.6192
2. PF	Q55179	Probable lipid II flippase MurJ	1.66e-09	9.51e-14	NA	0.6732
2. PF	Q49VC5	Multidrug export protein MepA	2.44e-15	1.25e-03	NA	0.5996
2. PF	Q2YVH4	Multidrug export protein MepA	1.33e-15	4.49e-02	NA	0.5694
2. PF	O51750	Probable lipid II flippase MurJ	7.13e-12	3.69e-18	NA	0.6229
5. P	Q0D2E8	Protein RFT1 homolog	2.80e-09	2.25e-04	NA	NA
5. P	Q5RFD2	Multidrug and toxin extrusion protein 1	2.13e-09	3.52e-02	NA	NA
5. P	O32273	Teichuronic acid biosynthesis protein TuaB	1.11e-16	1.65e-09	NA	NA
5. P	Q9ZKW7	Probable lipid II flippase MurJ	9.04e-11	8.96e-03	NA	NA
5. P	P34956	Quinol oxidase subunit 1	3.24e-04	2.28e-05	NA	NA
5. P	Q49WI3	Probable quinol oxidase subunit 1	6.43e-05	6.63e-04	NA	NA
5. P	Q89AA4	Cytochrome bo(3) ubiquinol oxidase subunit 1	5.48e-05	1.00e-04	NA	NA
5. P	P0ABI9	Cytochrome bo(3) ubiquinol oxidase subunit 1	4.97e-05	3.09e-04	NA	NA
5. P	O83529	Probable lipid II flippase MurJ	5.44e-14	3.48e-12	NA	NA
5. P	Q8K994	Cytochrome bo(3) ubiquinol oxidase subunit 1	1.92e-04	9.59e-06	NA	NA
5. P	Q92AG2	Probable multidrug resistance protein NorM	1.40e-11	3.66e-02	NA	NA
5. P	Q754Q7	Oligosaccharide translocation protein RFT1	3.51e-09	2.28e-09	NA	NA
5. P	Q96FL8	Multidrug and toxin extrusion protein 1	2.26e-09	6.20e-03	NA	NA
5. P	P45272	Multidrug resistance protein HmrM	1.78e-15	5.09e-03	NA	NA
5. P	Q3V050	Multidrug and toxin extrusion protein 2	1.01e-08	6.49e-04	NA	NA
5. P	P98057	Probable cytochrome c oxidase subunit 1	3.17e-05	9.72e-04	NA	NA
5. P	P58368	Progressive ankylosis protein homolog B	4.36e-09	4.20e-02	NA	NA
5. P	P0AAA7	Lipid III flippase	0.00e+00	1.41e-02	NA	NA
5. P	P47685	Uncharacterized protein MG447	2.98e-14	7.80e-06	NA	NA
5. P	Q9WWR2	Cytochrome bo(3) ubiquinol oxidase subunit 1	1.59e-04	3.38e-04	NA	NA
5. P	Q2YX15	Probable quinol oxidase subunit 1	6.60e-05	2.70e-04	NA	NA
5. P	Q4L564	Probable quinol oxidase subunit 1	6.89e-05	4.17e-04	NA	NA
5. P	Q71YH0	Probable multidrug resistance protein NorM	1.58e-11	4.49e-02	NA	NA
5. P	P0ABJ0	Cytochrome bo(3) ubiquinol oxidase subunit 1	4.71e-05	3.09e-04	NA	NA
5. P	Q5HH24	Probable quinol oxidase subunit 1	6.47e-05	3.49e-04	NA	NA
5. P	P42726	Trifolitoxin-processing protein TfxD	1.13e-08	7.08e-03	NA	NA
5. P	Q23444	Protein RFT1 homolog	5.70e-09	8.08e-07	NA	NA
5. P	Q6FPE8	Oligosaccharide translocation protein RFT1	1.92e-08	3.74e-09	NA	NA
5. P	A4IIS8	Multidrug and toxin extrusion protein 1	5.24e-08	9.43e-03	NA	NA
5. P	Q9Z7H5	Probable lipid II flippase MurJ	1.57e-09	1.06e-21	NA	NA
5. P	P98009	Ubiquinol oxidase subunit 1	1.82e-04	6.59e-03	NA	NA
5. P	Q9LE20	Protein DETOXIFICATION 54	7.43e-09	3.81e-02	NA	NA
5. P	P0AF16	Lipid II flippase MurJ	2.22e-16	1.40e-13	NA	NA
5. P	P0ABI8	Cytochrome bo(3) ubiquinol oxidase subunit 1	4.82e-05	3.09e-04	NA	NA
5. P	Q58467	Uncharacterized membrane protein MJ1068	5.66e-14	4.10e-13	NA	NA
5. P	P24010	Cytochrome c oxidase subunit 1	1.25e-04	6.32e-03	NA	NA
5. P	Q6GI24	Probable quinol oxidase subunit 1	6.48e-05	3.05e-04	NA	NA
5. P	Q7N3V2	Multidrug resistance protein MdtK	3.88e-09	4.28e-02	NA	NA
5. P	Q5I0E9	Multidrug and toxin extrusion protein 1	1.82e-08	8.09e-03	NA	NA
5. P	O31695	Uncharacterized MFS-type transporter YkuC	2.89e-05	3.59e-02	NA	NA
5. P	P0AAA8	Lipid III flippase	0.00e+00	1.41e-02	NA	NA
5. P	Q55721	Folate-biopterin transporter	1.05e-04	5.88e-03	NA	NA
5. P	Q46378	Probable lipid II flippase MurJ	4.30e-09	9.42e-19	NA	NA
5. P	P40913	Oligosaccharide translocation protein RFT1	1.75e-08	1.41e-11	NA	NA
5. P	Q8Y654	Probable multidrug resistance protein NorM	1.37e-11	1.44e-02	NA	NA
5. P	Q5HQB0	Probable quinol oxidase subunit 1	6.17e-05	2.55e-04	NA	NA
5. P	Q96AA3	Protein RFT1 homolog	9.90e-10	1.17e-04	NA	NA
5. P	Q54IV7	Protein RFT1 homolog	6.28e-07	1.02e-04	NA	NA
5. P	Q58119	Uncharacterized transporter MJ0709	9.91e-11	1.17e-02	NA	NA
5. P	Q9I426	Cytochrome bo(3) ubiquinol oxidase subunit 1	2.05e-04	3.86e-04	NA	NA
5. P	Q6GAF3	Probable quinol oxidase subunit 1	6.40e-05	2.70e-04	NA	NA
5. P	Q99V37	Probable quinol oxidase subunit 1	6.45e-05	2.70e-04	NA	NA
5. P	Q7A699	Probable quinol oxidase subunit 1	6.40e-05	2.70e-04	NA	NA
5. P	P57543	Cytochrome bo(3) ubiquinol oxidase subunit 1	2.10e-04	3.27e-04	NA	NA
5. P	Q5QWR6	Probable multidrug resistance protein NorM	5.11e-10	1.52e-02	NA	NA
5. P	Q8CPP7	Probable quinol oxidase subunit 1	6.32e-05	2.55e-04	NA	NA
5. P	P38206	Oligosaccharide translocation protein RFT1	8.71e-09	5.65e-07	NA	NA
5. P	O25551	Probable lipid II flippase MurJ	9.28e-11	3.61e-04	NA	NA
5. P	Q9WZS2	Probable multidrug resistance protein NorM	5.12e-13	5.65e-03	NA	NA
5. P	Q5R7E4	Multidrug and toxin extrusion protein 2	1.78e-08	2.15e-03	NA	NA
5. P	P77377	Lipopolysaccharide biosynthesis protein WzxC	1.11e-16	2.39e-11	NA	NA
5. P	E0TW66	Quinol oxidase subunit 1	6.89e-05	2.53e-05	NA	NA
5. P	Q8VYL8	Protein DETOXIFICATION 10	7.24e-09	3.01e-02	NA	NA
5. P	Q7A182	Probable quinol oxidase subunit 1	6.74e-05	2.70e-04	NA	NA
5. P	Q9PJB9	Probable lipid II flippase MurJ	4.88e-10	1.66e-18	NA	NA
5. P	Q8C3B8	Protein RFT1 homolog	5.14e-09	2.34e-03	NA	NA
5. P	O94302	Oligosaccharide translocation protein rft1	1.98e-09	4.61e-09	NA	NA
5. P	Q5A6N8	Oligosaccharide translocation protein RFT1	4.71e-09	2.19e-11	NA	NA
5. P	Q2FI18	Probable quinol oxidase subunit 1	6.62e-05	2.70e-04	NA	NA
5. P	Q9CMZ9	Probable multidrug resistance protein NorM	3.98e-13	1.91e-02	NA	NA
5. P	Q2FZK0	Probable quinol oxidase subunit 1	6.41e-05	2.70e-04	NA	NA
6. F	Q5HIW0	Multidrug export protein MepA	2.00e-15	NA	NA	0.5984
6. F	P9WLW0	Uncharacterized protein MT1558/MT1560	2.93e-11	NA	NA	0.5442
6. F	Q6NB79	Probable multidrug resistance protein NorM	2.78e-10	NA	NA	0.5445
6. F	Q88CB9	Probable multidrug resistance protein NorM	5.46e-09	NA	NA	0.566
6. F	Q6GJY2	Multidrug export protein MepA	2.33e-15	NA	NA	0.55
6. F	Q99191	Putative O-antigen transporter	3.33e-16	NA	NA	0.6988
6. F	P37781	Putative O-antigen transporter	0.00e+00	NA	NA	0.729
6. F	Q8NYB0	Multidrug export protein MepA	2.89e-15	NA	NA	0.584
6. F	Q7A7N0	Multidrug export protein MepA	2.11e-15	NA	NA	0.596
6. F	Q9KRU4	Multidrug resistance protein NorM	3.37e-10	NA	NA	0.4962
6. F	Q7WJR0	Probable multidrug resistance protein NorM	1.23e-10	NA	NA	0.5023
6. F	Q45411	EPS I polysaccharide export inner membrane protein EpsE	0.00e+00	NA	NA	0.6092
6. F	Q03583	Putative O-antigen transporter	0.00e+00	NA	NA	0.7025
6. F	Q98D15	Probable multidrug resistance protein NorM	2.86e-10	NA	NA	0.5182
6. F	P59985	Uncharacterized protein Mb3654	1.49e-10	NA	NA	0.6706
6. F	Q6C6S3	Oligosaccharide translocation protein RFT1	2.93e-09	NA	NA	0.4892
6. F	Q9F5N7	Multidrug resistance protein NorM	8.91e-10	NA	NA	0.5185
6. F	Q99WP2	Multidrug export protein MepA	2.22e-15	NA	NA	0.5935
6. F	P9WJK2	Probable peptidoglycan biosynthesis protein MviN	7.45e-08	NA	NA	0.564
6. F	Q9CNC5	Uncharacterized membrane protein PM0507	1.33e-13	NA	NA	0.6366
6. F	Q55364	Probable multidrug resistance protein NorM	3.90e-10	NA	NA	0.5573
6. F	Q8YFD7	Probable multidrug resistance protein NorM	2.20e-10	NA	NA	0.4794
6. F	A7KAU2	Multidrug and toxin extrusion protein 1	7.44e-10	NA	NA	0.4851
6. F	Q6GCD7	Multidrug export protein MepA	2.78e-15	NA	NA	0.5993
6. F	P9WKX8	Uncharacterized protein MT3732	1.60e-10	NA	NA	0.6794
6. F	Q92PZ0	Probable multidrug resistance protein NorM	8.48e-10	NA	NA	0.5659
6. F	Q2FJS9	Multidrug export protein MepA	2.11e-15	NA	NA	0.5606
6. F	Q7NXN3	Probable multidrug resistance protein NorM	6.23e-10	NA	NA	0.5332