Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54931.1
JCVISYN3A_0693

Uncharacterized protease.
M. mycoides homolog: Q6MSK5.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 5
Unique PROST Go: 2
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 13
Unique PROST Homologs: 9
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Oligoendopeptidase PepF
Antczak et al. [3]: CAAX protease
Zhang et al. [4]: GO:0005216|ion channel activity
Bianchi et al. [5]: pepF-like Oligoendopeptidase

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was A0A0H2XEK8 (Membrane-embedded CAAX protease MroQ) with a FATCAT P-Value: 3.24e-14 and RMSD of 3.02 angstrom. The sequence alignment identity is 20.8%.
Structural alignment shown in left. Query protein AVX54931.1 colored as red in alignment, homolog A0A0H2XEK8 colored as blue. Query protein AVX54931.1 is also shown in right top, homolog A0A0H2XEK8 showed in right bottom. They are colored based on secondary structures. 

  AVX54931.1 MIKKFSIKDTNVDQAYPFDFKFYKPKIEGMIILFSLVILPLVTVIFLNVFKKELNITDSRIGLIFQISSIVFTIIGGLIFWSRNPVS-FWKSGVGILFGF 99
  A0A0H2XEK8 -------------------------------------------------------------------------------------MTRLWAS---LL--- 9

  AVX54931.1 PIFLQLFAIFFSLLANVFNV--LKNNGV-WTQ--IY-NLLIQTVAEILIIIFAFN-KISNLKNKVKQTLKENKKLLIPIS-IGFAVVAFIVGNTLYSLII 191
  A0A0H2XEK8 TVIIYILSQFLPLLI-VKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIIL--INLKIKN-PTKLELEVKEPKKYIIPWALLGFALV--MIYQMVVSIVL 103

  AVX54931.1 SQLNLNLGESENQKSLVSPFQNDGIGKYIYM---I-IFI-ILTIFIAPLCEEIIARQALFTG-V-----SNKVLSII--T--SSLYFGVLHISSGDVYNI 276
  A0A0H2XEK8 TQI---YG---GQQ--VSP-NTE---KLIIIARKIPIFIFFVSI-IGPLLEEYVFRKVIF-GELFNAIKGNRIVAFIIATTVSSLIFALAH---ND-FKF 185

  AVX54931.1 FPYVIG-GFFFSLAFSISKGNLTYSWFSHSIYNTISVVLIIASLY---IK--------------- 322
  A0A0H2XEK8 IPVYFGMGVIFSLAYVWTK-RLAVPIIIHMLQN--GFVVIFQLLNPEALKKATEQANFIYHIFIP 247

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0071586 CAAX-box protein processing
1. PBF GO:0004222 metalloendopeptidase activity
2. PF GO:0016020 membrane
5. P GO:0005886 plasma membrane
5. P GO:0016021 integral component of membrane

Uniprot GO Annotations

GO Description
GO:0071586 CAAX-box protein processing
GO:0008233 peptidase activity
GO:0016021 integral component of membrane
GO:0016020 membrane
GO:0110165 cellular anatomical entity
GO:0080120 CAAX-box protein maturation
GO:0016485 protein processing
GO:0004222 metalloendopeptidase activity
GO:0004175 endopeptidase activity
GO:0006508 proteolysis

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P45613 Uncharacterized protein MCAP_0715 0.00e+00 3.61e-72 1.00e-172 0.9911
2. PF O05525 Putative membrane peptidase YdiL 1.19e-13 6.67e-05 NA 0.6887
5. P A0A0H2XEK8 Membrane-embedded CAAX protease MroQ 3.24e-14 1.95e-03 NA NA
5. P Q9CJB0 UPF0177 protein YajF 3.46e-08 9.55e-14 NA NA
5. P Q9CJB5 UPF0177 protein YaiF 5.45e-07 7.58e-15 NA NA
5. P P75603 Uncharacterized protein MPN_090 6.17e-05 1.02e-02 NA NA
5. P Q9CJ66 UPF0177 protein YbdJ 3.17e-08 1.53e-09 NA NA
5. P P13974 Uncharacterized 24.3 kDa protein 1.74e-07 1.09e-14 NA NA
5. P Q9CJB2 UPF0177 protein YaiH 1.24e-08 1.10e-12 NA NA
5. P Q48724 UPF0177 protein in abiGi 5'region 4.78e-06 3.49e-10 NA NA
5. P Q9CE03 UPF0177 protein YvdC 1.95e-09 2.71e-29 NA NA
7. B Q9CJ67 UPF0177 protein YbdI 2.72e-12 NA 0.019 NA
7. B Q9CDG9 UPF0177 protein YxdF 6.82e-11 NA 0.007 NA