Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54934.1
JCVISYN3A_0696

Uncharacterized transporter.
M. mycoides homolog: Q6MSK2.
TIGRfam Classification: 1=Unknown.
Category: Essential.

Statistics

Total GO Annotation: 20
Unique PROST Go: 18
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 12
Unique PROST Homologs: 10
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Shikimate dehydrogenase
Antczak et al. [3]: RDD family, transmembrane protein, likely a cation transporter
Zhang et al. [4]: GO:0044119|growth of symbiont in host cell
Bianchi et al. [5]: "Unclear, RDD domain protein"

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q920C4 (Membrane-spanning 4-domains subfamily A member 3) with a FATCAT P-Value: 0.000327 and RMSD of 3.25 angstrom. The sequence alignment identity is 21.2%.
Structural alignment shown in left. Query protein AVX54934.1 colored as red in alignment, homolog Q920C4 colored as blue. Query protein AVX54934.1 is also shown in right top, homolog Q920C4 showed in right bottom. They are colored based on secondary structures. 

  AVX54934.1 MNNSLITSKQTD---FK-LDNNYKLASLWKVFFARLFDLL--ICSIPLI--IMSLFLKTKTGDIISLV-IKYLVS------FLWTFF--YFV--ILSFLL 81
      Q920C4 -----MKPEETGGSVYQPLDESRHV--------QR--GVLQALGAIQILNGILILAL----G--IFLVCLQH-VSHHFRHFFFFTFYTGYPLWGAVFFIS 78

  AVX54934.1 KGNSLSKKLFKIELKSLKTNKISFFQILIRETWFIFIPLFIGFIF-TLIFAFLLPTSYIK----TQSWRISLSLIVYQIGLV-IVLFWFLGLMISIRLQT 175
      Q920C4 SG-SLTVAAGRNPTRMLMQNS---FGINIASTTI----AFVGTVFLSVHLAF--NTQAFKGCQSSPSPDVCISLGSSSDGLVSLMLILTL-LELSVTISI 167

  AVX54934.1 NHQSFIDIKLGLIVIEKQKNIKQEP-IVSNQILTR-NDKHISLNEQPGNFDLEFIDELKQELNNQNQDNKQNTNNKNK 251
      Q920C4 SAMWCLGNVCGL-----REAITSPPNSVESGILPEGSDSE-NLNTQP-QASEE------------------------- 213

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
2. PF GO:0005886 plasma membrane
2. PF GO:0016021 integral component of membrane
5. P GO:0051726 regulation of cell cycle
5. P GO:0015556 C4-dicarboxylate transmembrane transporter activity
5. P GO:0005773 vacuole
5. P GO:0015740 C4-dicarboxylate transport
5. P GO:0008863 formate dehydrogenase (NAD+) activity
5. P GO:0051321 meiotic cell cycle
5. P GO:0046521 sphingoid catabolic process
5. P GO:0001561 fatty acid alpha-oxidation
5. P GO:0005783 endoplasmic reticulum
5. P GO:0006624 vacuolar protein processing
5. P GO:0102672 fatty acid alpha-oxygenase activity
5. P GO:0045047 protein targeting to ER
5. P GO:0009326 formate dehydrogenase complex
5. P GO:0009061 anaerobic respiration
5. P GO:0015944 formate oxidation
5. P GO:0036397 formate dehydrogenase (quinone) activity
5. P GO:0030176 integral component of endoplasmic reticulum membrane
5. P GO:0045048 protein insertion into ER membrane

Uniprot GO Annotations

GO Description
GO:0016020 membrane
GO:0016021 integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF P42401 Uncharacterized protein YckC 2.88e-07 1.08e-05 NA 0.5913
2. PF P47485 Uncharacterized protein MG243 1.99e-08 3.07e-28 NA 0.577
5. P P75439 Uncharacterized protein MG243 homolog 1.85e-06 6.17e-28 NA NA
5. P Q9KQS0 C4-dicarboxylate TRAP transporter small permease protein DctQ 7.19e-04 6.39e-04 NA NA
5. P Q920C4 Membrane-spanning 4-domains subfamily A member 3 3.27e-04 2.20e-02 NA NA
5. P P75083 Uncharacterized protein MG028 homolog 2.18e-03 1.85e-02 NA NA
5. P P25338 2-hydroxy-palmitic acid dioxygenase MPO1 3.43e-02 4.96e-02 NA NA
5. P Q54GE8 Putative uncharacterized transmembrane protein DDB_G0290203 1.21e-03 3.48e-02 NA NA
5. P P44451 Formate dehydrogenase, cytochrome b556 subunit 1.33e-03 8.59e-03 NA NA
5. P B9GHX8 CASP-like protein 2A2 1.69e-03 1.52e-02 NA NA
5. P P47274 Uncharacterized protein MG028 5.80e-04 4.19e-03 NA NA
5. P O14193 SRP-independent targeting protein 2 homolog 3.53e-03 1.37e-02 NA NA