Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54936.1

JCVISYN3A_0706

Thiamine ABC transporter permease.
M. mycoides homolog: Q6MSI6.
TIGRfam Classification: 3=Putative.
Category: Quasiessential.

Statistics

Total GO Annotation: 24
Unique PROST Go: 9
Unique BLAST Go: 0
Unique Foldseek Go: 1

Total Homologs: 80
Unique PROST Homologs: 59
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 4

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: ABC transporter, permease component
Zhang et al. [4]: GO:0022804|active transmembrane transporter activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P75369 (ABC transport system permease protein p69) with a FATCAT P-Value: 0 and RMSD of 3.08 angstrom. The sequence alignment identity is 28.3%.
Structural alignment shown in left. Query protein AVX54936.1 colored as red in alignment, homolog P75369 colored as blue. Query protein AVX54936.1 is also shown in right top, homolog P75369 showed in right bottom. They are colored based on secondary structures.

  AVX54936.1 MATRQNYKKPFLVKESNFFKYRYINRTTNTKTSWKFHPIYFHL-LAFLVLVLVGYCFYSQASLIKIDNF--YQVAKKLVLLFSFEN--KNFL-----DTS 90
      P75369 --------------MTSLFFYQ-I---SDKQKRWNW---YWKLALAIIVLVVIIYSF--------IDNFSGFNVS-------GFRNFSRNFIRLFTPDT- 63

  AVX54936.1 YISNEYTNLFLDTLSLLWVTIKLALTGTFIGFILAVITSFLSFSKVNNKFLSYL-LSAVI--LILRSTPELIFITLITSTFRNDLSLLLVYIWFTWLWLH 187
      P75369 --ARDY---FLGS-YLL-QTIFYVVSGSILGFVIALWFSYLTAFKIQP--L-YIALPTRLFTIFLRSFPVLVFAFLFNNLFNKQLTATLTITWFSWLWST 153

  AVX54936.1 KY---YIDMLNSFDLQAYYVSISQGNSKFKAFFKEIYPRIKN--RVIALF-IFSFESNIRWASILAALSLPGIGRLIV--YGSENTAHFNQLGIPLLVLM 279
      P75369 KYITAFFE--NSA-LKQFFNQSSRYIHKFKAFWNTVV--ISQAER-LWLFLLYSLEANFRWTTVLSIAGITGIGELIATPLG--GTVQLNLVLIPMLTLI 245

  AVX54936.1 SFILVLELLNYLFKKYLVEARSKVYKQKNETKFEYY----TRLSKKLNVNKIIISLIFISLTIISIITFINIPIYIFNLDY-VK------SFFNNLLNPN 368
      P75369 GFLLFLEASVFLLTKFVLQ------KQSQAG--DYFLQAKT-LQKR-KWKKVMIYI--LAL-VLAAFTLAN----LVQLDYTVKAPGFVADFFKQFFQTK 328

  AVX54936.1 FVSFSIFNKHIEN-NPILLIWNSLQFTIVAM-FICI--VITII-GIRLQSIRLNNLFVVIICRSLNVL---IRLIPTIVYFYVFHPIFSNVLTLVIIVVS 460
      P75369 -TAF-LISED-ANINPLLML---LKLTTQAISLITLVFVLALLFGF-LAS----KLFSTITSISLKLLLLVIRVIPSVLLFRLFDPIIFRPETTIIFVLA 417

  AVX54936.1 LHQASSKAKQLVEV-VDNLNIQIINNLKIQGYSNNQIFLKYVLPAIKIEFI-SLSIFYFELIFRTSITYYILASDKLYIGHLITKYLDTRAFYPRLA--- 555
      P75369 IHSAASYG-QLITINFDNANEGVINNMQNHGFSRFYILWNYLIPTTKPQLLNTLS-DSFDNAIRDLVVFGIFGGS--IIGGRINNFFE-RAQYSELGTIT 512

  AVX54936.1 ---MSYVWIGTFAILVINLIARYINK-KIRK---- 582
      P75369 LPLMVYLMV--FEVI---LMAVRLNKLKVWQRHLW 542

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0015716	organic phosphonate transport
1. PBF	GO:0055085	transmembrane transport
1. PBF	GO:0005887	integral component of plasma membrane
1. PBF	GO:0006817	phosphate ion transport
1. PBF	GO:0043190	ATP-binding cassette (ABC) transporter complex
1. PBF	GO:0015416	ABC-type phosphonate transporter activity
2. PF	GO:0022857	transmembrane transporter activity
2. PF	GO:0015888	thiamine transport
2. PF	GO:0005315	inorganic phosphate transmembrane transporter activity
2. PF	GO:0016021	integral component of membrane
2. PF	GO:0005886	plasma membrane
2. PF	GO:0035435	phosphate ion transmembrane transport
2. PF	GO:0006811	ion transport
2. PF	GO:0055072	iron ion homeostasis
5. P	GO:0015234	thiamine transmembrane transporter activity
5. P	GO:0015295	solute:proton symporter activity
5. P	GO:0015385	sodium:proton antiporter activity
5. P	GO:0051452	intracellular pH reduction
5. P	GO:0071934	thiamine transmembrane transport
5. P	GO:0010226	response to lithium ion
5. P	GO:0015491	cation:cation antiporter activity
5. P	GO:0015129	lactate transmembrane transporter activity
5. P	GO:0033214	siderophore-dependent iron import into cell
6. F	GO:0015833	peptide transport

Uniprot GO Annotations

GO	Description
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0055085	transmembrane transport
GO:0016021	integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P75369	ABC transport system permease protein p69	0.00e+00	1.72e-47	3.97e-36	0.8652
1. PBF	A0QQ68	Phosphate-import permease protein PhnE	0.00e+00	1.88e-32	6.46e-05	0.7616
1. PBF	P15362	ABC transport system permease protein p69	0.00e+00	2.21e-34	1.91e-53	0.8379
1. PBF	P47533	ABC transport system permease protein p69	0.00e+00	5.23e-44	3.72e-31	0.8839
2. PF	P75185	Phosphate transport system permease protein PstA homolog	8.82e-10	5.81e-13	NA	0.5245
2. PF	P47651	Phosphate transport system permease protein PstA homolog	6.74e-10	4.68e-11	NA	0.4985
2. PF	P71338	Fe(3+)-transport system permease protein FbpB 2	5.31e-10	4.81e-16	NA	0.6006
2. PF	Q8FYV0	Thiamine transport system permease protein ThiP	1.43e-10	1.94e-23	NA	0.5352
2. PF	P44985	Thiamine transport system permease protein ThiP	1.40e-09	3.84e-26	NA	0.5532
2. PF	Q44123	Ferric transport system permease protein FbpB	1.92e-09	9.51e-05	NA	0.5324
2. PF	Q57BC3	Thiamine transport system permease protein ThiP	1.69e-09	2.55e-24	NA	0.5372
2. PF	P21409	Fe(3+)-transport system permease protein SfuB	9.13e-09	3.88e-20	NA	0.5494
2. PF	Q8ZRV1	Thiamine transport system permease protein ThiP	7.57e-10	3.12e-24	NA	0.5435
2. PF	Q8YJ03	Thiamine transport system permease protein ThiP	1.40e-09	2.26e-24	NA	0.5131
2. PF	P55452	Probable ABC transporter permease protein y4fN	3.11e-09	2.38e-17	NA	0.5141
2. PF	Q2YLW7	Thiamine transport system permease protein ThiP	1.66e-10	2.55e-24	NA	0.5381
3. BF	O69053	Phosphite transport system permease protein PtxC	6.88e-15	NA	1.20e-04	0.7541
5. P	B5R2W4	Na(+)/H(+) antiporter NhaB	9.47e-04	1.95e-02	NA	NA
5. P	P06972	Iron(3+)-hydroxamate import system permease protein FhuB	2.13e-03	1.04e-04	NA	NA
5. P	A9MP57	Na(+)/H(+) antiporter NhaB	1.01e-03	2.15e-02	NA	NA
5. P	B7MTW4	Na(+)/H(+) antiporter NhaB	8.50e-04	3.87e-02	NA	NA
5. P	Q9K5Z9	L-lactate permease	3.25e-03	1.34e-02	NA	NA
5. P	Q31ZM7	Na(+)/H(+) antiporter NhaB	9.17e-04	1.89e-02	NA	NA
5. P	B7LXA0	Na(+)/H(+) antiporter NhaB	8.68e-04	1.89e-02	NA	NA
5. P	B1IUA6	Na(+)/H(+) antiporter NhaB	9.53e-04	1.89e-02	NA	NA
5. P	B5XQ77	Na(+)/H(+) antiporter NhaB	5.57e-04	1.20e-02	NA	NA
5. P	C0Q328	Na(+)/H(+) antiporter NhaB	9.10e-04	1.95e-02	NA	NA
5. P	P65253	L-lactate permease	5.68e-03	1.38e-02	NA	NA
5. P	A9MVW2	Na(+)/H(+) antiporter NhaB	9.12e-04	2.19e-02	NA	NA
5. P	Q8ZL63	L-lactate permease	4.79e-03	2.74e-02	NA	NA
5. P	P31549	Thiamine transport system permease protein ThiP	5.84e-10	2.20e-25	NA	NA
5. P	B7LSJ8	Na(+)/H(+) antiporter NhaB	1.00e-03	2.03e-02	NA	NA
5. P	B6I9P7	Na(+)/H(+) antiporter NhaB	8.24e-04	1.89e-02	NA	NA
5. P	P0AFA7	Na(+)/H(+) antiporter NhaB	9.09e-04	1.89e-02	NA	NA
5. P	A7ZKV7	Na(+)/H(+) antiporter NhaB	8.19e-04	1.89e-02	NA	NA
5. P	B5FTM8	Na(+)/H(+) antiporter NhaB	9.53e-04	1.95e-02	NA	NA
5. P	B5BI47	Na(+)/H(+) antiporter NhaB	8.83e-04	2.63e-02	NA	NA
5. P	Q8FI24	Na(+)/H(+) antiporter NhaB	1.02e-03	1.52e-02	NA	NA
5. P	B4SUJ8	Na(+)/H(+) antiporter NhaB	9.25e-04	1.95e-02	NA	NA
5. P	C5B9W2	Na(+)/H(+) antiporter NhaB	2.84e-04	4.73e-02	NA	NA
5. P	B2TZB2	Na(+)/H(+) antiporter NhaB	8.86e-04	1.89e-02	NA	NA
5. P	P71067	L-lactate permease	4.00e-03	2.79e-02	NA	NA
5. P	C4ZTM7	Na(+)/H(+) antiporter NhaB	9.99e-04	1.89e-02	NA	NA
5. P	B5YXL0	Na(+)/H(+) antiporter NhaB	8.79e-04	1.89e-02	NA	NA
5. P	Q83RQ5	Na(+)/H(+) antiporter NhaB	8.27e-04	1.89e-02	NA	NA
5. P	A7ZZC0	Na(+)/H(+) antiporter NhaB	8.79e-04	1.89e-02	NA	NA
5. P	Q57NK6	Na(+)/H(+) antiporter NhaB	9.69e-04	1.95e-02	NA	NA
5. P	B7LGU6	Na(+)/H(+) antiporter NhaB	9.66e-04	2.87e-02	NA	NA
5. P	B4TKD6	Na(+)/H(+) antiporter NhaB	9.46e-04	2.07e-02	NA	NA
5. P	Q32H30	Na(+)/H(+) antiporter NhaB	9.55e-04	1.89e-02	NA	NA
5. P	Q57251	Putative L-lactate permease	5.86e-03	3.43e-03	NA	NA
5. P	Q9CPJ1	Na(+)/H(+) antiporter NhaB	4.17e-04	4.06e-02	NA	NA
5. P	Q0T5L5	Na(+)/H(+) antiporter NhaB	8.92e-04	1.89e-02	NA	NA
5. P	Q81L64	Petrobactin import system permease protein FpuB	1.82e-03	4.75e-05	NA	NA
5. P	Q8Z684	Na(+)/H(+) antiporter NhaB	9.66e-04	2.23e-02	NA	NA
5. P	B4TXX6	Na(+)/H(+) antiporter NhaB	9.21e-04	1.87e-02	NA	NA
5. P	B7N3Z0	Na(+)/H(+) antiporter NhaB	8.33e-04	1.89e-02	NA	NA
5. P	Q8Z2E3	L-lactate permease	4.48e-03	2.01e-02	NA	NA
5. P	B5F4E1	Na(+)/H(+) antiporter NhaB	9.37e-04	2.23e-02	NA	NA
5. P	B1LHY1	Na(+)/H(+) antiporter NhaB	9.46e-04	3.16e-02	NA	NA
5. P	P76224	Inner membrane ABC transporter permease protein YnjC	3.45e-10	1.08e-15	NA	NA
5. P	B7NJF4	Na(+)/H(+) antiporter NhaB	9.40e-04	2.93e-02	NA	NA
5. P	B7MK83	Na(+)/H(+) antiporter NhaB	9.58e-04	3.87e-02	NA	NA
5. P	O87656	Iron(3+)-hydroxamate import system permease protein FhuB	1.18e-03	4.66e-03	NA	NA
5. P	Q0TII9	Na(+)/H(+) antiporter NhaB	8.98e-04	1.87e-02	NA	NA
5. P	Q8ZP14	Na(+)/H(+) antiporter NhaB	8.90e-04	2.07e-02	NA	NA
5. P	P65254	L-lactate permease	4.14e-03	1.38e-02	NA	NA
5. P	B5R8Z5	Na(+)/H(+) antiporter NhaB	9.02e-04	1.33e-02	NA	NA
5. P	B7UQ70	Na(+)/H(+) antiporter NhaB	8.87e-04	2.23e-02	NA	NA
5. P	Q3Z2W2	Na(+)/H(+) antiporter NhaB	9.25e-04	3.10e-02	NA	NA
5. P	A1AAA9	Na(+)/H(+) antiporter NhaB	9.53e-04	3.87e-02	NA	NA
5. P	Q1RCR0	Na(+)/H(+) antiporter NhaB	8.38e-04	3.87e-02	NA	NA
5. P	P33231	L-lactate permease	5.05e-03	7.74e-03	NA	NA
5. P	Q5PCR8	Na(+)/H(+) antiporter NhaB	9.12e-04	2.63e-02	NA	NA
5. P	P0AFA8	Na(+)/H(+) antiporter NhaB	8.63e-04	1.89e-02	NA	NA
5. P	B1XA73	Na(+)/H(+) antiporter NhaB	9.44e-04	1.89e-02	NA	NA
6. F	A2RI76	Dipeptide transport system permease protein DppC	7.00e-07	NA	NA	0.5623
6. F	A0A140NFA3	Phosphonate transport system permease protein PhnE	0.00e+00	NA	NA	0.7988
6. F	O69062	Putative phosphite transport system permease protein HtxC	2.11e-15	NA	NA	0.7954
6. F	Q57341	Putative ferric transport system permease protein FbpB 1	9.23e-09	NA	NA	0.4775