Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54937.1

JCVISYN3A_0707

Thiamine ABC transporter ATP-binding protein.
M. mycoides homolog: Q6MSH1.
TIGRfam Classification: 3=Putative.
Category: Quasiessential.

Statistics

Total GO Annotation: 537
Unique PROST Go: 10
Unique BLAST Go: 412
Unique Foldseek Go: 3

Total Homologs: 4088
Unique PROST Homologs: 51
Unique BLAST Homologs: 1681
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: phosphonate abc transporter
Zhang et al. [4]: GO:0015424|amino acid-transporting ATPase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A5U7B7 (Cell division ATP-binding protein FtsE) with a FATCAT P-Value: 0 and RMSD of 1.70 angstrom. The sequence alignment identity is 29.7%.
Structural alignment shown in left. Query protein AVX54937.1 colored as red in alignment, homolog A5U7B7 colored as blue. Query protein AVX54937.1 is also shown in right top, homolog A5U7B7 showed in right bottom. They are colored based on secondary structures.

  AVX54937.1 MNKVIELKEISVQYNNRSDLVLKDINLDIFQGELVAIIGPSGVGKSTLFKIIINSLRPVKGQVKVFDKDILKFNKKQKRLFISKIGFLTQTPNLIYTDNV 100
      A5U7B7 ---MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRV-SK--FHVNKLRGR-HVPK---LRQVIGCVFQD-- 88

  AVX54937.1 YNNIIRSTSKYKNNFYKFFSI-LTRKQKITIFEKLDELN-----ILD------KAFFKV-SELSGGQQQRVEIAKLLI-KDVELILADEPTSNLDKKTSI 186
      A5U7B7 F-RLLQQKTVYDN---VAFALEVIGKR--T-----DAINRVVPEVLETVGLSGKA-NRLPDELSGGEQQRVAIARAFVNRPL-VLLADEPTGNLDPETSR 175

  AVX54937.1 EVLKVLKNISKQNKTILVNIHDLSLVKRYFDRVIAINNKQIVFDKKTKDIKQWQLDRIIKSRS 249
      A5U7B7 DIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQ-RGV--YGMDR------ 229

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0015419	ABC-type sulfate transporter activity
1. PBF	GO:0015087	cobalt ion transmembrane transporter activity
1. PBF	GO:0048502	ABC-type thiamine transporter activity
1. PBF	GO:0055085	transmembrane transport
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0042626	ATPase-coupled transmembrane transporter activity
1. PBF	GO:0043213	bacteriocin transport
1. PBF	GO:0015633	ABC-type zinc transporter activity
1. PBF	GO:0032218	riboflavin transport
1. PBF	GO:0015716	organic phosphonate transport
1. PBF	GO:0015414	ABC-type nitrate transporter activity
1. PBF	GO:0015411	ABC-type taurine transporter transporter activity
1. PBF	GO:0008509	anion transmembrane transporter activity
1. PBF	GO:0015424	ABC-type amino acid transporter activity
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0015415	ATPase-coupled phosphate ion transmembrane transporter activity
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0016787	hydrolase activity
1. PBF	GO:0015774	polysaccharide transport
1. PBF	GO:0006824	cobalt ion transport
1. PBF	GO:0005315	inorganic phosphate transmembrane transporter activity
1. PBF	GO:0015599	ATPase-coupled L-glutamine transmembrane transporter activity
1. PBF	GO:1901238	ABC-type tungstate transporter activity
1. PBF	GO:0015416	ABC-type phosphonate transporter activity
1. PBF	GO:0015438	ABC-type teichoic acid transporter activity
1. PBF	GO:0006817	phosphate ion transport
1. PBF	GO:0015420	ABC-type vitamin B12 transporter activity
1. PBF	GO:0015833	peptide transport
1. PBF	GO:0102025	ABC-type thiosulfate transporter activity
1. PBF	GO:0032217	riboflavin transmembrane transporter activity
1. PBF	GO:0042959	alkanesulfonate transmembrane transporter activity
1. PBF	GO:0033232	ABC-type D-methionine transporter activity
1. PBF	GO:0044873	lipoprotein localization to membrane
1. PBF	GO:0015112	nitrate transmembrane transporter activity
1. PBF	GO:0015439	ABC-type heme transporter activity
1. PBF	GO:0043190	ATP-binding cassette (ABC) transporter complex
1. PBF	GO:0140306	lipoprotein releasing activity
1. PBF	GO:0017004	cytochrome complex assembly
1. PBF	GO:0042953	lipoprotein transport
1. PBF	GO:0055072	iron ion homeostasis
2. PF	GO:0008554	P-type sodium transporter activity
2. PF	GO:0070297	regulation of phosphorelay signal transduction system
3. BF	GO:0042882	L-arabinose transmembrane transport
3. BF	GO:0033212	iron import into cell
3. BF	GO:0001407	glycerophosphodiester transmembrane transport
3. BF	GO:0015612	ABC-type L-arabinose transporter activity
3. BF	GO:0015423	ABC-type maltose transporter activity
3. BF	GO:0015614	ABC-type D-xylose transporter activity
3. BF	GO:0015777	teichoic acid transport
3. BF	GO:0015430	ABC-type glycerol-3-phosphate transporter activity
3. BF	GO:0042888	molybdenum ion transmembrane transporter activity
3. BF	GO:0009276	Gram-negative-bacterium-type cell wall
3. BF	GO:0015408	ABC-type ferric iron transporter activity
3. BF	GO:0015752	D-ribose transmembrane transport
3. BF	GO:0015594	ABC-type putrescine transporter activity
3. BF	GO:0015417	ABC-type polyamine transporter activity
3. BF	GO:0008643	carbohydrate transport
3. BF	GO:0008272	sulfate transport
3. BF	GO:0008559	ABC-type xenobiotic transporter activity
3. BF	GO:0103116	ABC-type D-galactofuranose transporter
3. BF	GO:0015611	ABC-type D-ribose transporter activity
3. BF	GO:1905887	autoinducer AI-2 transmembrane transport
3. BF	GO:0015437	lipopolysaccharide floppase activity
3. BF	GO:0015412	ABC-type molybdate transporter activity
3. BF	GO:0043211	ABC-type carbohydrate transporter activity
3. BF	GO:0015689	molybdate ion transport
4. PB	GO:0015808	L-alanine transport
4. PB	GO:0098713	leucine import across plasma membrane
4. PB	GO:0015192	L-phenylalanine transmembrane transporter activity
4. PB	GO:0015823	phenylalanine transport
4. PB	GO:0005829	cytosol
4. PB	GO:0043215	daunorubicin transport
4. PB	GO:0015807	L-amino acid transport
4. PB	GO:0005304	L-valine transmembrane transporter activity
4. PB	GO:1900753	doxorubicin transport
4. PB	GO:0015190	L-leucine transmembrane transporter activity
4. PB	GO:1903785	L-valine transmembrane transport
4. PB	GO:0015847	putrescine transport
4. PB	GO:0015625	ABC-type ferric hydroxamate transporter activity
4. PB	GO:0015031	protein transport
4. PB	GO:0010043	response to zinc ion
4. PB	GO:0005975	carbohydrate metabolic process
4. PB	GO:0005634	nucleus
4. PB	GO:0042941	D-alanine transport
4. PB	GO:0015232	heme transmembrane transporter activity
4. PB	GO:0015489	putrescine transmembrane transporter activity
4. PB	GO:0015658	branched-chain amino acid transmembrane transporter activity
4. PB	GO:0044874	lipoprotein localization to outer membrane
4. PB	GO:0022857	transmembrane transporter activity
4. PB	GO:0051539	4 iron, 4 sulfur cluster binding
4. PB	GO:0015426	ATPase-coupled polar amino acid-transporter activity
4. PB	GO:0016021	integral component of membrane
4. PB	GO:0089705	protein localization to outer membrane
4. PB	GO:0015413	ABC-type nickel transporter activity
4. PB	GO:0015188	L-isoleucine transmembrane transporter activity
4. PB	GO:0042160	lipoprotein modification
4. PB	GO:1903714	isoleucine transmembrane transport
4. PB	GO:0035444	nickel cation transmembrane transport
4. PB	GO:0006865	amino acid transport
4. PB	GO:0005737	cytoplasm
4. PB	GO:0000287	magnesium ion binding
4. PB	GO:0055076	transition metal ion homeostasis
4. PB	GO:0030420	establishment of competence for transformation
4. PB	GO:0005506	iron ion binding
4. PB	GO:0005525	GTP binding
4. PB	GO:0015803	branched-chain amino acid transport
4. PB	GO:1903805	L-valine import across plasma membrane
4. PB	GO:0015675	nickel cation transport
4. PB	GO:1903806	L-isoleucine import across plasma membrane
4. PB	GO:0035435	phosphate ion transmembrane transport
4. PB	GO:0016020	membrane
4. PB	GO:0015436	ABC-type capsular-polysaccharide transporter activity
5. P	GO:0015234	thiamine transmembrane transporter activity
5. P	GO:1903810	L-histidine import across plasma membrane
5. P	GO:0005291	high-affinity L-histidine transmembrane transporter activity
5. P	GO:1904176	carbon phosphorus lyase complex
5. P	GO:0042935	achromobactin transport
5. P	GO:0061694	alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase complex
5. P	GO:0016151	nickel cation binding
5. P	GO:0006829	zinc ion transport
5. P	GO:0006826	iron ion transport
5. P	GO:1990229	iron-sulfur cluster assembly complex
6. F	GO:0015848	spermidine transport
6. F	GO:0015410	ABC-type manganese transporter activity
6. F	GO:0015921	lipopolysaccharide export
7. B	GO:1902995	positive regulation of phospholipid efflux
7. B	GO:0034188	apolipoprotein A-I receptor activity
7. B	GO:0010315	auxin efflux
7. B	GO:0006778	porphyrin-containing compound metabolic process
7. B	GO:0014850	response to muscle activity
7. B	GO:0042825	TAP complex
7. B	GO:0035351	heme transmembrane transport
7. B	GO:0030145	manganese ion binding
7. B	GO:0140326	ATPase-coupled intramembrane lipid transporter activity
7. B	GO:0097254	renal tubular secretion
7. B	GO:0007584	response to nutrient
7. B	GO:0006649	phospholipid transfer to membrane
7. B	GO:0031154	culmination involved in sorocarp development
7. B	GO:0030003	cellular cation homeostasis
7. B	GO:0035376	sterol import
7. B	GO:0090155	negative regulation of sphingolipid biosynthetic process
7. B	GO:0042908	xenobiotic transport
7. B	GO:1902602	aluminum ion transmembrane transport
7. B	GO:0015421	ABC-type oligopeptide transporter activity
7. B	GO:0015225	biotin transmembrane transporter activity
7. B	GO:0042632	cholesterol homeostasis
7. B	GO:0015106	bicarbonate transmembrane transporter activity
7. B	GO:0019829	ATPase-coupled cation transmembrane transporter activity
7. B	GO:0061135	endopeptidase regulator activity
7. B	GO:0042441	eye pigment metabolic process
7. B	GO:1902418	(+)-abscisic acid D-glucopyranosyl ester transmembrane transport
7. B	GO:0038183	bile acid signaling pathway
7. B	GO:0098838	folate transmembrane transport
7. B	GO:1903427	negative regulation of reactive oxygen species biosynthetic process
7. B	GO:1901140	p-coumaryl alcohol transport
7. B	GO:0008558	ABC-type guanine transporter activity
7. B	GO:0000054	ribosomal subunit export from nucleus
7. B	GO:0032383	regulation of intracellular cholesterol transport
7. B	GO:0006727	ommochrome biosynthetic process
7. B	GO:0046581	intercellular canaliculus
7. B	GO:0007588	excretion
7. B	GO:1905601	negative regulation of receptor-mediated endocytosis involved in cholesterol transport
7. B	GO:0031998	regulation of fatty acid beta-oxidation
7. B	GO:0002591	positive regulation of antigen processing and presentation of peptide antigen via MHC class I
7. B	GO:0008514	organic anion transmembrane transporter activity
7. B	GO:1903413	cellular response to bile acid
7. B	GO:0046691	intracellular canaliculus
7. B	GO:0009926	auxin polar transport
7. B	GO:0003723	RNA binding
7. B	GO:0015108	chloride transmembrane transporter activity
7. B	GO:0043481	anthocyanin accumulation in tissues in response to UV light
7. B	GO:0010208	pollen wall assembly
7. B	GO:0015842	aminergic neurotransmitter loading into synaptic vesicle
7. B	GO:0006364	rRNA processing
7. B	GO:0006413	translational initiation
7. B	GO:0005319	lipid transporter activity
7. B	GO:0071806	protein transmembrane transport
7. B	GO:0070455	positive regulation of heme biosynthetic process
7. B	GO:0051301	cell division
7. B	GO:0097233	alveolar lamellar body membrane
7. B	GO:0006412	translation
7. B	GO:0016853	isomerase activity
7. B	GO:0015865	purine nucleotide transport
7. B	GO:0010328	auxin influx transmembrane transporter activity
7. B	GO:0005730	nucleolus
7. B	GO:1901086	benzylpenicillin metabolic process
7. B	GO:0006856	eye pigment precursor transport
7. B	GO:0023029	MHC class Ib protein binding
7. B	GO:0015878	biotin transport
7. B	GO:0140481	ABC-type iron-sulfur cluster transporter activity
7. B	GO:0000325	plant-type vacuole
7. B	GO:0032585	multivesicular body membrane
7. B	GO:0015127	bilirubin transmembrane transporter activity
7. B	GO:0019389	glucuronoside metabolic process
7. B	GO:0120202	rod photoreceptor disc membrane
7. B	GO:0015434	ABC-type cadmium transporter activity
7. B	GO:0015418	ABC-type quaternary ammonium compound transporting activity
7. B	GO:0071366	cellular response to indolebutyric acid stimulus
7. B	GO:0000324	fungal-type vacuole
7. B	GO:1905075	positive regulation of tight junction disassembly
7. B	GO:0034976	response to endoplasmic reticulum stress
7. B	GO:0070505	pollen coat
7. B	GO:0071714	icosanoid transmembrane transporter activity
7. B	GO:0048240	sperm capacitation
7. B	GO:1902993	positive regulation of amyloid precursor protein catabolic process
7. B	GO:1901076	positive regulation of engulfment of apoptotic cell
7. B	GO:0036020	endolysosome membrane
7. B	GO:0030253	protein secretion by the type I secretion system
7. B	GO:0007165	signal transduction
7. B	GO:0046968	peptide antigen transport
7. B	GO:0042986	positive regulation of amyloid precursor protein biosynthetic process
7. B	GO:0015918	sterol transport
7. B	GO:0001573	ganglioside metabolic process
7. B	GO:1901656	glycoside transport
7. B	GO:0034041	ABC-type sterol transporter activity
7. B	GO:0080168	abscisic acid transport
7. B	GO:0003677	DNA binding
7. B	GO:1900721	positive regulation of uterine smooth muscle relaxation
7. B	GO:0042824	MHC class I peptide loading complex
7. B	GO:0008282	inward rectifying potassium channel
7. B	GO:0097708	intracellular vesicle
7. B	GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane
7. B	GO:0033700	phospholipid efflux
7. B	GO:0031901	early endosome membrane
7. B	GO:0033228	cysteine export across plasma membrane
7. B	GO:0009380	excinuclease repair complex
7. B	GO:1905039	carboxylic acid transmembrane transport
7. B	GO:0005774	vacuolar membrane
7. B	GO:0034707	chloride channel complex
7. B	GO:0015893
7. B	GO:0046967	cytosol to endoplasmic reticulum transport
7. B	GO:0046865	terpenoid transport
7. B	GO:0016887	ATP hydrolysis activity
7. B	GO:0005503	all-trans retinal binding
7. B	GO:0042887	amide transmembrane transporter activity
7. B	GO:1904479	negative regulation of intestinal absorption
7. B	GO:0005576	extracellular region
7. B	GO:0075139	response to host iron concentration
7. B	GO:0071072	negative regulation of phospholipid biosynthetic process
7. B	GO:0033762	response to glucagon
7. B	GO:0033013	tetrapyrrole metabolic process
7. B	GO:0098849	cellular detoxification of cadmium ion
7. B	GO:0070633	transepithelial transport
7. B	GO:0098662	inorganic cation transmembrane transport
7. B	GO:0015440	ABC-type peptide transporter activity
7. B	GO:0030301	cholesterol transport
7. B	GO:0015721	bile acid and bile salt transport
7. B	GO:0046677	response to antibiotic
7. B	GO:0018901	2,4-dichlorophenoxyacetic acid metabolic process
7. B	GO:0010874	regulation of cholesterol efflux
7. B	GO:0046898	response to cycloheximide
7. B	GO:0046943	carboxylic acid transmembrane transporter activity
7. B	GO:0015562	efflux transmembrane transporter activity
7. B	GO:0005260	intracellularly ATP-gated chloride channel activity
7. B	GO:2001225	regulation of chloride transport
7. B	GO:0042883	cysteine transport
7. B	GO:0045332	phospholipid translocation
7. B	GO:0030505	inorganic diphosphate transport
7. B	GO:0035672	oligopeptide transmembrane transport
7. B	GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I
7. B	GO:0006932	substrate-dependent cell migration, cell contraction
7. B	GO:0150110	negative regulation of cholesterol esterification
7. B	GO:0090374	oligopeptide export from mitochondrion
7. B	GO:0042884	microcin transport
7. B	GO:0006855	xenobiotic transmembrane transport
7. B	GO:1903825	organic acid transmembrane transport
7. B	GO:0046978	TAP1 binding
7. B	GO:0015910	long-chain fatty acid import into peroxisome
7. B	GO:0005654	nucleoplasm
7. B	GO:0062157	mitochondrial ATP-gated potassium channel complex
7. B	GO:0031526	brush border membrane
7. B	GO:0044604	ABC-type phytochelatin transporter activity
7. B	GO:0015723	bilirubin transport
7. B	GO:0060049	regulation of protein glycosylation
7. B	GO:0046980	tapasin binding
7. B	GO:0140603	obsolete ATP hydrolysis activity
7. B	GO:0090156	cellular sphingolipid homeostasis
7. B	GO:0071805	potassium ion transmembrane transport
7. B	GO:0015431	ABC-type glutathione S-conjugate transporter activity
7. B	GO:0030165	PDZ domain binding
7. B	GO:0009624	response to nematode
7. B	GO:0042168	heme metabolic process
7. B	GO:0008270	zinc ion binding
7. B	GO:0006289	nucleotide-excision repair
7. B	GO:0015125	bile acid transmembrane transporter activity
7. B	GO:0097232	lamellar body membrane
7. B	GO:0044857	plasma membrane raft organization
7. B	GO:0034436	glycoprotein transport
7. B	GO:0003746	translation elongation factor activity
7. B	GO:0060919	auxin influx
7. B	GO:0090108	positive regulation of high-density lipoprotein particle assembly
7. B	GO:0033344	cholesterol efflux
7. B	GO:0023061	signal release
7. B	GO:0005501	retinoid binding
7. B	GO:0140394	ABC-type azole transporter activity
7. B	GO:0015694	mercury ion transport
7. B	GO:0032384	negative regulation of intracellular cholesterol transport
7. B	GO:0008494	translation activator activity
7. B	GO:0005324	long-chain fatty acid transporter activity
7. B	GO:0106138	Sec61 translocon complex binding
7. B	GO:0015132	prostaglandin transmembrane transporter activity
7. B	GO:0031152	aggregation involved in sorocarp development
7. B	GO:0015216	purine nucleotide transmembrane transporter activity
7. B	GO:0060081	membrane hyperpolarization
7. B	GO:0042401	cellular biogenic amine biosynthetic process
7. B	GO:0002485	antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
7. B	GO:1905948	ABC-type 3',5'-cyclic GMP transmembrane transporter activity
7. B	GO:1904486	response to 17alpha-ethynylestradiol
7. B	GO:1905604	negative regulation of blood-brain barrier permeability
7. B	GO:0046623	sphingolipid floppase activity
7. B	GO:0140345	phosphatidylcholine flippase activity
7. B	GO:0030299	intestinal cholesterol absorption
7. B	GO:0140327	flippase activity
7. B	GO:1901557	response to fenofibrate
7. B	GO:0034040	ATPase-coupled lipid transmembrane transporter activity
7. B	GO:0044847	iron acquisition from host
7. B	GO:0031409	pigment binding
7. B	GO:0150172	regulation of phosphatidylcholine metabolic process
7. B	GO:0042493
7. B	GO:0008234	cysteine-type peptidase activity
7. B	GO:0002790	peptide secretion
7. B	GO:0017144
7. B	GO:0015794	glycerol-3-phosphate transmembrane transport
7. B	GO:0042910	xenobiotic transmembrane transporter activity
7. B	GO:1902476	chloride transmembrane transport
7. B	GO:0033231	carbohydrate export
7. B	GO:0015886	heme transport
7. B	GO:0015462	ABC-type protein transporter activity
7. B	GO:0070730	cAMP transport
7. B	GO:0150104	transport across blood-brain barrier
7. B	GO:0034375	high-density lipoprotein particle remodeling
7. B	GO:0010329	auxin efflux transmembrane transporter activity
7. B	GO:1901873	regulation of post-translational protein modification
7. B	GO:0070925	organelle assembly
7. B	GO:0043024	ribosomal small subunit binding
7. B	GO:1903064	positive regulation of reverse cholesterol transport
7. B	GO:0042270	protection from natural killer cell mediated cytotoxicity
7. B	GO:0005254	chloride channel activity
7. B	GO:0010222	stem vascular tissue pattern formation
7. B	GO:0016324	apical plasma membrane
7. B	GO:0015126	canalicular bile acid transmembrane transporter activity
7. B	GO:0031004	potassium ion-transporting ATPase complex
7. B	GO:0009432	SOS response
7. B	GO:0070894	regulation of transposon integration
7. B	GO:0019869	chloride channel inhibitor activity
7. B	GO:0097234	epidermal lamellar body membrane
7. B	GO:0048770	pigment granule
7. B	GO:0014045	establishment of endothelial blood-brain barrier
7. B	GO:0071403	cellular response to high density lipoprotein particle stimulus
7. B	GO:0015441	ABC-type beta-glucan transporter activity
7. B	GO:0140466	iron-sulfur cluster export from the mitochondrion
7. B	GO:0032367	intracellular cholesterol transport
7. B	GO:0055088	lipid homeostasis
7. B	GO:0071716	leukotriene transport
7. B	GO:0046471	phosphatidylglycerol metabolic process
7. B	GO:0005615	extracellular space
7. B	GO:0042288	MHC class I protein binding
7. B	GO:0043225	ATPase-coupled inorganic anion transmembrane transporter activity
7. B	GO:0033285	ATPase-coupled monocarboxylic acid transmembrane transporter activity
7. B	GO:1990962	xenobiotic transport across blood-brain barrier
7. B	GO:1904251	regulation of bile acid metabolic process
7. B	GO:0006633	fatty acid biosynthetic process
7. B	GO:0048545	response to steroid hormone
7. B	GO:0010217	cellular aluminum ion homeostasis
7. B	GO:0003336	corneocyte desquamation
7. B	GO:0010588	cotyledon vascular tissue pattern formation
7. B	GO:0035377	transepithelial water transport
7. B	GO:0032940	secretion by cell
7. B	GO:0009381	excinuclease ABC activity
7. B	GO:1904446	positive regulation of establishment of Sertoli cell barrier
7. B	GO:1903898	negative regulation of PERK-mediated unfolded protein response
7. B	GO:0006879	cellular iron ion homeostasis
7. B	GO:0043691	reverse cholesterol transport
7. B	GO:1902161	positive regulation of cyclic nucleotide-gated ion channel activity
7. B	GO:0042599	lamellar body
7. B	GO:0036246	phytochelatin 2 import into vacuole
7. B	GO:0097327	response to antineoplastic agent
7. B	GO:0015164	glucuronoside transmembrane transporter activity
7. B	GO:0016323	basolateral plasma membrane
7. B	GO:0007049	cell cycle
7. B	GO:0010872	regulation of cholesterol esterification
7. B	GO:0036249	cadmium ion import into vacuole
7. B	GO:0006695	cholesterol biosynthetic process
7. B	GO:0002489	antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
7. B	GO:0019534	toxin transmembrane transporter activity
7. B	GO:0085042	periarbuscular membrane
7. B	GO:0035690
7. B	GO:0099039	sphingolipid translocation
7. B	GO:1990060	maltose transport complex
7. B	GO:0005765	lysosomal membrane
7. B	GO:0031459	ABC-type glycine betaine transporter activity
7. B	GO:0010290	chlorophyll catabolite transmembrane transporter activity
7. B	GO:1901529	positive regulation of anion channel activity
7. B	GO:0055091	phospholipid homeostasis
7. B	GO:0046618	xenobiotic export
7. B	GO:0010496	intercellular transport
7. B	GO:1903232	melanosome assembly
7. B	GO:0034775	glutathione transmembrane transport
7. B	GO:0120188	regulation of bile acid secretion
7. B	GO:0010875	positive regulation of cholesterol efflux
7. B	GO:1905460	negative regulation of vascular associated smooth muscle cell apoptotic process
7. B	GO:0071995	phytochelatin import into vacuole
7. B	GO:0097744	renal urate salt excretion
7. B	GO:0032368	regulation of lipid transport
7. B	GO:0009610	response to symbiotic fungus
7. B	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
7. B	GO:0009507	chloroplast
7. B	GO:0042985	negative regulation of amyloid precursor protein biosynthetic process
7. B	GO:0050891	multicellular organismal water homeostasis
7. B	GO:0046890	regulation of lipid biosynthetic process
7. B	GO:0055038	recycling endosome membrane
7. B	GO:0080051	cutin transport
7. B	GO:1904680	peptide transmembrane transporter activity
7. B	GO:0015432	ABC-type bile acid transporter activity
7. B	GO:0080172	petal epidermis patterning
7. B	GO:0098591	external side of apical plasma membrane
7. B	GO:0006686	sphingomyelin biosynthetic process
7. B	GO:0005275	amine transmembrane transporter activity
7. B	GO:0099040	ceramide translocation
7. B	GO:0070731	cGMP transport
7. B	GO:0140357	heme export from vacuole to cytoplasm
7. B	GO:0045900	negative regulation of translational elongation
7. B	GO:0097208	alveolar lamellar body
7. B	GO:0015914	phospholipid transport
7. B	GO:0046415	urate metabolic process
7. B	GO:0008281	sulfonylurea receptor activity
7. B	GO:0015143	urate transmembrane transporter activity
7. B	GO:0090370	negative regulation of cholesterol efflux
7. B	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
7. B	GO:0019843	rRNA binding
7. B	GO:0033162	melanosome membrane
7. B	GO:0090556	phosphatidylserine floppase activity
7. B	GO:0030504	inorganic diphosphate transmembrane transporter activity
7. B	GO:0055092	sterol homeostasis
7. B	GO:0010540	basipetal auxin transport
7. B	GO:0120020	cholesterol transfer activity
7. B	GO:0048225	suberin network
7. B	GO:0120189	positive regulation of bile acid secretion
7. B	GO:1904411	positive regulation of secretory granule organization
7. B	GO:0001409	guanine nucleotide transmembrane transporter activity
7. B	GO:0003924	GTPase activity
7. B	GO:0043231	intracellular membrane-bounded organelle
7. B	GO:0010949	negative regulation of intestinal phytosterol absorption
7. B	GO:0061843	Sertoli cell barrier remodeling
7. B	GO:0032376	positive regulation of cholesterol transport
7. B	GO:0042802	identical protein binding
7. B	GO:0006869	lipid transport
7. B	GO:0034634	glutathione transmembrane transporter activity
7. B	GO:0048581	negative regulation of post-embryonic development
7. B	GO:0015711	organic anion transport
7. B	GO:0032464	positive regulation of protein homooligomerization
7. B	GO:0140328	floppase activity
7. B	GO:0061092	positive regulation of phospholipid translocation
7. B	GO:0061855	negative regulation of neuroblast migration
7. B	GO:0032782	bile acid secretion
7. B	GO:2001140	positive regulation of phospholipid transport
7. B	GO:2000077	negative regulation of type B pancreatic cell development
7. B	GO:0005887	integral component of plasma membrane
7. B	GO:0006684	sphingomyelin metabolic process
7. B	GO:0090539	peptide pheromone export by transmembrane transport
7. B	GO:0006448	regulation of translational elongation
7. B	GO:0099038	ceramide floppase activity
7. B	GO:0010312	detoxification of zinc ion
7. B	GO:0015433	ABC-type peptide antigen transporter activity
7. B	GO:0038027	apolipoprotein A-I-mediated signaling pathway
7. B	GO:0006904	vesicle docking involved in exocytosis
7. B	GO:0000049	tRNA binding
7. B	GO:0071320	cellular response to cAMP
7. B	GO:0006638	neutral lipid metabolic process
7. B	GO:0031427	response to methotrexate
7. B	GO:1902943	positive regulation of voltage-gated chloride channel activity
7. B	GO:0031460	glycine betaine transport
7. B	GO:0032310	prostaglandin secretion
7. B	GO:0061337	cardiac conduction
7. B	GO:0032289	central nervous system myelin formation
7. B	GO:0051454	intracellular pH elevation
7. B	GO:0015722	canalicular bile acid transport
7. B	GO:1903331	positive regulation of iron-sulfur cluster assembly
7. B	GO:0008206	bile acid metabolic process
7. B	GO:0006281	DNA repair
7. B	GO:0090554	phosphatidylcholine floppase activity
7. B	GO:0150094	amyloid-beta clearance by cellular catabolic process
7. B	GO:0140359	ABC-type transporter activity
7. B	GO:1904322	cellular response to forskolin
7. B	GO:1902417	(+)-abscisic acid D-glucopyranosyl ester transmembrane transporter activity
7. B	GO:0097209	epidermal lamellar body
7. B	GO:0140341	phosphatidylethanolamine floppase activity
7. B	GO:1902497	iron-sulfur cluster transmembrane transport
7. B	GO:0009245	lipid A biosynthetic process
7. B	GO:0043214	ABC-type bacteriocin transporter activity
7. B	GO:0043129	surfactant homeostasis
7. B	GO:0032805	positive regulation of low-density lipoprotein particle receptor catabolic process
7. B	GO:0071996	glutathione transmembrane import into vacuole
7. B	GO:0006357	regulation of transcription by RNA polymerase II
7. B	GO:0090740	integral component of pigment granule membrane
7. B	GO:1904375	regulation of protein localization to cell periphery
7. B	GO:0031288	sorocarp morphogenesis
7. B	GO:2000032	regulation of secondary shoot formation
7. B	GO:1902004	positive regulation of amyloid-beta formation
7. B	GO:0045796	negative regulation of intestinal cholesterol absorption
7. B	GO:2000010	positive regulation of protein localization to cell surface
7. B	GO:0000329	fungal-type vacuole membrane
7. B	GO:0140352	export from cell
7. B	GO:0140115	export across plasma membrane
7. B	GO:0034380	high-density lipoprotein particle assembly
7. B	GO:1990748	cellular detoxification
7. B	GO:0000770	peptide pheromone export
7. B	GO:0005769	early endosome
7. B	GO:0007031	peroxisome organization
7. B	GO:0015732	prostaglandin transport
7. B	GO:0015701	bicarbonate transport
7. B	GO:0032379	positive regulation of intracellular lipid transport
7. B	GO:0002481	antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
7. B	GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
7. B	GO:0015747	urate transport
7. B	GO:0120019	phosphatidylcholine transfer activity
7. B	GO:0031088	platelet dense granule membrane
7. B	GO:0010345	suberin biosynthetic process
7. B	GO:0035627	ceramide transport
7. B	GO:0015691	cadmium ion transport
7. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
7. B	GO:0030256	type I protein secretion system complex
7. B	GO:0005840	ribosome
7. B	GO:0009914	hormone transport
7. B	GO:0042605	peptide antigen binding
7. B	GO:0140347	N-retinylidene-phosphatidylethanolamine flippase activity
7. B	GO:0042760	very long-chain fatty acid catabolic process
7. B	GO:1902991	regulation of amyloid precursor protein catabolic process
7. B	GO:0046979	TAP2 binding
7. B	GO:0030644	cellular chloride ion homeostasis
7. B	GO:0045921	positive regulation of exocytosis
7. B	GO:1905598	negative regulation of low-density lipoprotein receptor activity
7. B	GO:0005548	phospholipid transporter activity
7. B	GO:0098657	import into cell
7. B	GO:0046906	tetrapyrrole binding
7. B	GO:0020037	heme binding
7. B	GO:0090555	phosphatidylethanolamine flippase activity

Uniprot GO Annotations

GO	Description
GO:0005524	ATP binding
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q65SC9	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.17e-37	1.36e-13	0.7705
1. PBF	Q87MK8	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.07e-17	8.28e-09	0.7487
1. PBF	Q6FFL0	Zinc import ATP-binding protein ZnuC	0.00e+00	6.06e-14	1.65e-15	0.7588
1. PBF	Q07LY2	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	1.99e-31	8.96e-32	0.8773
1. PBF	Q8DRS0	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	9.28e-22	4.54e-17	0.8033
1. PBF	P42360	Manganese import ATP-binding protein ScaC	0.00e+00	6.84e-34	3.39e-21	0.7872
1. PBF	O84071	Probable metal transport system ATP-binding protein CT_068	1.34e-12	4.38e-33	3.34e-23	0.7336
1. PBF	Q895C4	Methionine import ATP-binding protein MetN	0.00e+00	3.64e-05	2.64e-27	0.8436
1. PBF	Q4KK46	Methionine import ATP-binding protein MetN 2	0.00e+00	3.07e-03	2.44e-26	0.8607
1. PBF	Q0ASQ1	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.58e-51	5.97e-31	0.8583
1. PBF	Q6FAN3	Methionine import ATP-binding protein MetN 1	0.00e+00	1.96e-02	4.27e-25	0.8314
1. PBF	Q1JLH7	Phosphate import ATP-binding protein PstB 1	0.00e+00	6.77e-37	2.38e-17	0.8114
1. PBF	Q48HD9	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.45e-29	1.15e-15	0.8187
1. PBF	Q6ME20	Methionine import ATP-binding protein MetN	0.00e+00	4.42e-05	2.60e-22	0.8196
1. PBF	Q160Y9	Zinc import ATP-binding protein ZnuC	0.00e+00	1.06e-12	1.58e-20	0.735
1. PBF	Q834B4	Phosphate import ATP-binding protein PstB 1	0.00e+00	5.09e-39	2.46e-20	0.8065
1. PBF	Q8EG82	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.52e-26	1.71e-13	0.8171
1. PBF	P54954	Probable amino-acid import ATP-binding protein YxeO	0.00e+00	2.97e-31	4.38e-24	0.8086
1. PBF	Q8RQL7	Glutamate transport ATP-binding protein GluA	0.00e+00	1.41e-31	3.82e-25	0.8403
1. PBF	Q9CNP9	Thiamine import ATP-binding protein ThiQ	0.00e+00	3.89e-32	9.31e-14	0.8206
1. PBF	Q7N8M2	Methionine import ATP-binding protein MetN	0.00e+00	3.73e-02	2.33e-26	0.8183
1. PBF	Q471U2	Taurine import ATP-binding protein TauB	0.00e+00	1.60e-31	3.03e-19	0.7808
1. PBF	Q601T5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.39e-22	4.91e-16	0.7765
1. PBF	Q8U4L3	Putative ABC transporter ATP-binding protein PF0068	0.00e+00	2.16e-29	1.78e-17	0.7638
1. PBF	Q74KF8	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.18e-34	2.80e-16	0.8163
1. PBF	Q4JTG9	Methionine import ATP-binding protein MetN	0.00e+00	7.76e-04	3.70e-28	0.8403
1. PBF	Q668T8	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.54e-20	9.41e-17	0.7339
1. PBF	Q1IGZ0	Methionine import ATP-binding protein MetN 2	0.00e+00	2.08e-03	1.33e-24	0.8288
1. PBF	Q1M8E0	Methionine import ATP-binding protein MetN	0.00e+00	2.33e-03	8.56e-20	0.855
1. PBF	Q8DMX9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.20e-18	3.31e-14	0.7861
1. PBF	Q10V16	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	6.73e-42	3.50e-36	0.8783
1. PBF	Q8UIW7	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.14e-15	2.33e-33	0.8838
1. PBF	P0CZ27	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.30e-22	2.45e-19	0.805
1. PBF	Q9CNJ7	Phosphate import ATP-binding protein PstB	0.00e+00	3.44e-34	1.30e-14	0.7997
1. PBF	Q3Z3I7	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	3.81e-27	9.90e-16	0.7931
1. PBF	Q4FMG5	Taurine import ATP-binding protein TauB	0.00e+00	7.93e-29	9.79e-16	0.7693
1. PBF	Q9K789	Methionine import ATP-binding protein MetN	0.00e+00	4.27e-02	5.89e-23	0.8282
1. PBF	Q89C51	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.41e-32	4.24e-30	0.8777
1. PBF	Q8CTB2	Methionine import ATP-binding protein MetN 1	0.00e+00	4.82e-03	1.08e-24	0.82
1. PBF	P22040	Uncharacterized ABC transporter ATP-binding protein sll0415	0.00e+00	5.11e-05	8.74e-19	0.7958
1. PBF	Q65P77	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.41e-16	1.44e-14	0.805
1. PBF	Q5L5Z1	Methionine import ATP-binding protein MetN	0.00e+00	1.06e-03	2.05e-17	0.8276
1. PBF	Q0TKS1	Taurine import ATP-binding protein TauB	0.00e+00	4.90e-26	1.75e-14	0.7429
1. PBF	Q4FLF6	Phosphate import ATP-binding protein PstB	0.00e+00	7.71e-37	1.21e-16	0.8229
1. PBF	Q57BC2	Thiamine import ATP-binding protein ThiQ	0.00e+00	2.35e-39	2.51e-08	0.8316
1. PBF	O68106	Cobalt import ATP-binding protein CbiO	0.00e+00	1.89e-18	5.41e-20	0.8119
1. PBF	Q02DK6	Methionine import ATP-binding protein MetN 2	0.00e+00	1.24e-02	4.75e-25	0.8358
1. PBF	Q3JNY2	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.96e-08	1.65e-32	0.8931
1. PBF	Q601T6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	9.80e-21	8.51e-22	0.7548
1. PBF	P96117	Zinc transport system ATP-binding protein TroB	0.00e+00	5.06e-32	3.05e-30	0.7916
1. PBF	Q9PQU3	Phosphate import ATP-binding protein PstB	0.00e+00	2.14e-05	2.02e-17	0.8014
1. PBF	Q03EE4	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	3.87e-15	1.67e-15	0.8205
1. PBF	Q032H4	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.66e-16	8.22e-18	0.7786
1. PBF	Q98QH4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.10e-20	1.07e-14	0.7595
1. PBF	Q50293	Energy-coupling factor transporter ATP-binding protein EcfA2	3.33e-16	8.98e-18	2.19e-12	0.7727
1. PBF	Q67SV5	Methionine import ATP-binding protein MetN	0.00e+00	1.13e-03	1.56e-26	0.8463
1. PBF	Q5WJP0	Methionine import ATP-binding protein MetN 2	0.00e+00	6.75e-03	5.76e-18	0.8285
1. PBF	Q8FYU9	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.88e-39	9.61e-09	0.8394
1. PBF	Q97N50	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.20e-18	3.31e-14	0.7861
1. PBF	Q8CTM4	Teichoic acids export ATP-binding protein TagH	2.61e-10	6.70e-14	0.038	0.6413
1. PBF	Q16BJ3	Taurine import ATP-binding protein TauB	0.00e+00	8.07e-26	9.50e-16	0.807
1. PBF	Q8Y7R4	Putative ABC transporter ATP-binding protein lmo1207	0.00e+00	4.16e-23	1.15e-19	0.8313
1. PBF	Q0T7M2	Taurine import ATP-binding protein TauB	0.00e+00	6.44e-27	4.94e-12	0.7472
1. PBF	Q65M64	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	3.93e-26	3.06e-15	0.7827
1. PBF	Q8DFC3	Methionine import ATP-binding protein MetN	0.00e+00	4.82e-02	1.69e-25	0.8154
1. PBF	Q2ISN3	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	8.07e-26	2.92e-29	0.8823
1. PBF	Q2JB14	Phosphonates import ATP-binding protein PhnC	0.00e+00	9.07e-55	9.50e-34	0.8793
1. PBF	Q3J1N0	Methionine import ATP-binding protein MetN	0.00e+00	3.98e-04	3.55e-23	0.8405
1. PBF	O34677	Glutamine transport ATP-binding protein GlnQ	0.00e+00	6.85e-36	1.59e-27	0.8308
1. PBF	Q5X9B6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8085
1. PBF	Q730R7	Phosphate import ATP-binding protein PstB	0.00e+00	4.61e-31	6.36e-19	0.8227
1. PBF	Q67RG2	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.69e-32	4.32e-13	0.8003
1. PBF	Q81XB3	Petrobactin import ATP-binding protein FatE	0.00e+00	2.22e-34	2.78e-19	0.8158
1. PBF	C3LLU1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	6.55e-30	1.02e-11	0.7738
1. PBF	Q8ZRV2	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.40e-34	9.29e-20	0.8056
1. PBF	O31427	SkfA peptide export ATP-binding protein SkfE	0.00e+00	1.43e-30	1.40e-16	0.8168
1. PBF	Q1JNE0	Methionine import ATP-binding protein MetN	0.00e+00	2.12e-02	1.37e-21	0.8578
1. PBF	Q146E7	Taurine import ATP-binding protein TauB 1	0.00e+00	5.14e-27	6.74e-16	0.7849
1. PBF	P0AAF9	Arginine transport ATP-binding protein ArtP	0.00e+00	3.02e-41	1.26e-21	0.837
1. PBF	Q1M7W6	Nod factor export ATP-binding protein I	0.00e+00	1.53e-06	3.16e-26	0.8326
1. PBF	Q1LKJ2	Nod factor export ATP-binding protein I	0.00e+00	2.99e-05	1.08e-19	0.8299
1. PBF	Q6F0P3	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.06e-50	2.84e-36	0.9019
1. PBF	P63367	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.23e-38	3.25e-16	0.8196
1. PBF	Q32IZ6	Taurine import ATP-binding protein TauB	0.00e+00	2.81e-25	1.41e-14	0.744
1. PBF	Q83MG3	Thiamine import ATP-binding protein ThiQ	0.00e+00	6.85e-32	2.48e-18	0.8065
1. PBF	Q66CQ3	Methionine import ATP-binding protein MetN 1	0.00e+00	2.56e-04	3.40e-28	0.8344
1. PBF	Q2GE91	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.51e-25	6.83e-24	0.8206
1. PBF	A7MVV6	Vitamin B12 import ATP-binding protein BtuD	1.11e-16	1.14e-28	3.49e-13	0.7636
1. PBF	Q48PU6	Methionine import ATP-binding protein MetN 1	0.00e+00	1.91e-03	9.26e-25	0.8344
1. PBF	Q92AF9	Manganese transport system ATP-binding protein MntB	0.00e+00	1.72e-39	4.47e-25	0.7925
1. PBF	Q6MUF4	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.39e-50	1.58e-41	0.8842
1. PBF	Q8ZJD0	Taurine import ATP-binding protein TauB	0.00e+00	1.58e-26	5.88e-15	0.745
1. PBF	Q7MPC5	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.23e-35	1.57e-15	0.8184
1. PBF	P0C0E2	Lantibiotic transport ATP-binding protein SrtF	0.00e+00	8.85e-26	5.45e-16	0.8513
1. PBF	Q31TP8	Phosphonates import ATP-binding protein PhnC	0.00e+00	8.94e-50	1.13e-32	0.8811
1. PBF	Q2RWU0	Phosphate import ATP-binding protein PstB	0.00e+00	2.88e-40	2.14e-16	0.7909
1. PBF	P47425	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	5.90e-23	8.65e-17	0.7903
1. PBF	Q0SK28	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	2.70e-30	3.65e-23	0.7609
1. PBF	Q24QI5	Methionine import ATP-binding protein MetN	0.00e+00	5.87e-04	3.89e-24	0.8162
1. PBF	P69881	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	0.8265
1. PBF	Q4A8A1	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.88e-21	4.60e-22	0.7455
1. PBF	Q926D8	Zinc uptake system ATP-binding protein ZurA	0.00e+00	5.11e-34	1.70e-29	0.8257
1. PBF	Q3K4F5	Phosphate import ATP-binding protein PstB	0.00e+00	8.82e-22	1.07e-13	0.8153
1. PBF	Q11D92	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.66e-32	1.22e-17	0.8287
1. PBF	P63374	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.01e-40	1.36e-13	0.8167
1. PBF	Q1CCR9	Taurine import ATP-binding protein TauB	0.00e+00	1.58e-26	5.88e-15	0.7458
1. PBF	Q56953	Chelated iron transport system membrane protein YfeB	0.00e+00	2.63e-15	4.64e-22	0.8203
1. PBF	Q1LJ08	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	5.58e-37	4.70e-38	0.8823
1. PBF	Q7MN25	Methionine import ATP-binding protein MetN	0.00e+00	4.77e-02	1.51e-25	0.8138
1. PBF	Q62AW4	Taurine import ATP-binding protein TauB	0.00e+00	2.04e-28	4.08e-12	0.7522
1. PBF	Q3BNZ3	Methionine import ATP-binding protein MetN	0.00e+00	4.06e-02	9.65e-25	0.8212
1. PBF	Q4UMZ7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.35e-26	5.59e-28	0.841
1. PBF	Q46YX6	Nod factor export ATP-binding protein I	0.00e+00	1.92e-08	1.86e-19	0.822
1. PBF	Q97KD5	Methionine import ATP-binding protein MetN	0.00e+00	3.31e-04	5.13e-28	0.838
1. PBF	Q4KBU0	Methionine import ATP-binding protein MetN 3	0.00e+00	6.41e-04	4.80e-18	0.8381
1. PBF	Q5GRS1	Zinc import ATP-binding protein ZnuC	0.00e+00	5.11e-34	3.60e-14	0.8004
1. PBF	Q97KZ3	Putative ABC transporter ATP-binding protein CA_C0773	0.00e+00	2.21e-36	6.01e-24	0.7863
1. PBF	Q0BFQ0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	4.27e-07	7.22e-21	0.7757
1. PBF	Q4AA75	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.93e-22	1.81e-15	0.776
1. PBF	Q1JEC9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8072
1. PBF	Q4QLQ1	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.11e-34	7.55e-18	0.8316
1. PBF	Q7NTU0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.39e-23	1.85e-25	0.8597
1. PBF	Q5YRD1	Methionine import ATP-binding protein MetN	0.00e+00	1.03e-03	3.16e-28	0.8482
1. PBF	Q12BC9	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.01e-38	4.49e-28	0.7932
1. PBF	A2RI01	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.66e-16	8.22e-18	0.8015
1. PBF	P9WQL4	Probable ribonucleotide transport ATP-binding protein mkl	0.00e+00	2.93e-02	1.59e-18	0.8474
1. PBF	P63373	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.01e-40	1.36e-13	0.8204
1. PBF	A3CRB8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.07e-19	6.97e-16	0.7654
1. PBF	Q8DE95	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.23e-35	1.57e-15	0.8144
1. PBF	Q04HV7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.20e-18	3.31e-14	0.7891
1. PBF	P25885	Uncharacterized ABC transporter ATP-binding protein R00382	0.00e+00	2.12e-20	2.43e-15	0.8106
1. PBF	Q8DU24	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.92e-37	3.87e-13	0.8178
1. PBF	Q3J7S3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.72e-21	1.55e-28	0.8324
1. PBF	Q49W48	Methionine import ATP-binding protein MetN	0.00e+00	4.31e-02	8.93e-23	0.8192
1. PBF	Q3JSQ0	Nod factor export ATP-binding protein I	0.00e+00	2.33e-05	1.21e-20	0.8224
1. PBF	Q2NVW9	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.14e-35	3.28e-15	0.8267
1. PBF	Q1J449	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	0.8132
1. PBF	Q32K28	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.16e-33	1.38e-17	0.7986
1. PBF	Q57S53	Methionine import ATP-binding protein MetN 2	0.00e+00	2.96e-05	1.37e-28	0.8163
1. PBF	Q8ELT4	Phosphate import ATP-binding protein PstB	0.00e+00	2.12e-28	1.41e-19	0.8232
1. PBF	Q8PAG0	Phosphate import ATP-binding protein PstB	0.00e+00	1.19e-28	1.43e-15	0.8187
1. PBF	Q8Z5N5	Cobalt import ATP-binding protein CbiO	0.00e+00	7.69e-22	4.49e-18	0.8101
1. PBF	Q46TK4	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.32e-32	8.87e-31	0.8685
1. PBF	Q6G2E2	Methionine import ATP-binding protein MetN	0.00e+00	3.42e-05	5.91e-29	0.8436
1. PBF	Q9I1C8	Methionine import ATP-binding protein MetN 1	0.00e+00	2.12e-03	9.24e-25	0.8401
1. PBF	Q3JSR6	Aliphatic sulfonates import ATP-binding protein SsuB	1.11e-16	8.22e-04	2.45e-22	0.7799
1. PBF	P45022	Probable amino-acid ABC transporter ATP-binding protein HI_1078	0.00e+00	1.66e-32	5.74e-25	0.8151
1. PBF	Q8EUJ1	Phosphate import ATP-binding protein PstB	0.00e+00	2.54e-20	7.10e-16	0.815
1. PBF	Q4A8A2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.39e-22	4.91e-16	0.7755
1. PBF	Q1GKZ0	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	4.00e-26	1.97e-35	0.8853
1. PBF	P63388	Intermembrane phospholipid transport system ATP-binding protein MlaF	0.00e+00	1.35e-27	2.05e-14	0.8497
1. PBF	Q4ZZR8	Methionine import ATP-binding protein MetN 1	0.00e+00	1.65e-03	3.49e-25	0.835
1. PBF	Q0P9X7	Probable ABC transporter ATP-binding protein PEB1C	0.00e+00	2.95e-42	3.06e-27	0.8224
1. PBF	Q132E8	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.16e-31	9.40e-34	0.8833
1. PBF	Q8FJ95	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	5.48e-26	6.55e-16	0.7894
1. PBF	Q9CIS9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.76e-16	1.20e-17	0.7877
1. PBF	P47426	Energy-coupling factor transporter ATP-binding protein EcfA2	2.22e-16	6.84e-16	2.57e-12	0.7759
1. PBF	P37494	Uncharacterized ABC transporter ATP-binding protein YybJ	0.00e+00	6.25e-22	2.08e-06	0.8177
1. PBF	Q1GAD3	Phosphate import ATP-binding protein PstB	0.00e+00	6.65e-38	1.08e-14	0.8235
1. PBF	P63364	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.47e-31	1.83e-13	0.8152
1. PBF	Q8NXH5	Methionine import ATP-binding protein MetN 2	0.00e+00	2.03e-02	3.31e-25	0.8208
1. PBF	Q9HMZ4	Putative ABC transporter ATP-binding protein VNG_2317G	0.00e+00	6.32e-35	5.73e-16	0.8157
1. PBF	Q8YUI9	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	9.80e-55	5.48e-27	0.8631
1. PBF	Q5HRU5	Methionine import ATP-binding protein MetN 1	0.00e+00	1.83e-02	3.22e-24	0.8556
1. PBF	Q6AMR9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.18e-30	3.33e-21	0.8659
1. PBF	Q3Z542	Taurine import ATP-binding protein TauB	0.00e+00	1.47e-26	2.10e-14	0.7416
1. PBF	Q8ZNV7	Zinc import ATP-binding protein ZnuC	0.00e+00	8.87e-17	1.01e-18	0.7603
1. PBF	Q8XHV2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.75e-21	1.19e-08	0.8143
1. PBF	Q9YG51	Phosphate import ATP-binding protein PstB	0.00e+00	1.20e-37	1.51e-14	0.8111
1. PBF	Q8DMY0	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.33e-19	4.76e-20	0.801
1. PBF	A5U7B7	Cell division ATP-binding protein FtsE	0.00e+00	5.32e-41	4.40e-30	0.8939
1. PBF	P0A2V3	Octopine permease ATP-binding protein P	0.00e+00	2.06e-25	6.45e-22	0.8129
1. PBF	Q18KE1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.24e-03	2.05e-31	0.8645
1. PBF	Q3AKM8	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.76e-51	3.59e-35	0.8834
1. PBF	Q9KD30	Manganese transport system ATP-binding protein MntB	0.00e+00	5.49e-30	2.18e-26	0.7801
1. PBF	Q1QX72	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.57e-21	2.09e-22	0.8292
1. PBF	Q8ZD58	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.47e-20	1.78e-17	0.7378
1. PBF	A1VZQ5	Probable ABC transporter ATP-binding protein PEB1C	0.00e+00	2.57e-42	1.07e-26	0.8207
1. PBF	Q8Z5W6	Zinc import ATP-binding protein ZnuC	0.00e+00	2.48e-16	7.74e-19	0.744
1. PBF	P0AAI2	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.17e-25	3.78e-15	0.7864
1. PBF	Q2SVN0	Aliphatic sulfonates import ATP-binding protein SsuB	1.11e-16	4.06e-04	5.81e-22	0.7815
1. PBF	Q8FAV1	Phosphonates import ATP-binding protein PhnC	0.00e+00	8.24e-51	1.14e-33	0.8842
1. PBF	Q9KQB8	Zinc import ATP-binding protein ZnuC	0.00e+00	8.26e-09	1.93e-12	0.7715
1. PBF	Q3B2U2	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	3.79e-26	4.02e-20	0.8071
1. PBF	Q5LS19	Phosphate import ATP-binding protein PstB	0.00e+00	5.10e-31	2.48e-17	0.7999
1. PBF	P54537	Arginine transport ATP-binding protein ArtM	0.00e+00	6.53e-29	4.04e-24	0.8326
1. PBF	Q3ISC1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	2.26e-45	6.46e-22	0.8766
1. PBF	P45092	Arginine transport ATP-binding protein ArtP	0.00e+00	5.95e-37	1.72e-17	0.8447
1. PBF	Q20Y31	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	1.09e-31	9.18e-31	0.878
1. PBF	Q6GBJ3	Teichoic acids export ATP-binding protein TagH	4.32e-08	4.85e-13	6.08e-06	0.6429
1. PBF	Q03ZL5	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.55e-19	4.72e-21	0.7864
1. PBF	Q8NXS6	Teichoic acids export ATP-binding protein TagH	3.13e-10	4.85e-13	6.08e-06	0.6513
1. PBF	Q1LLB5	Phosphate import ATP-binding protein PstB	0.00e+00	1.95e-31	4.27e-14	0.8122
1. PBF	P0A9S0	Cell division ATP-binding protein FtsE	0.00e+00	4.91e-35	2.82e-25	0.8524
1. PBF	P72335	Nod factor export ATP-binding protein I	0.00e+00	4.10e-06	2.68e-23	0.8438
1. PBF	P55476	Nod factor export ATP-binding protein I	0.00e+00	5.07e-07	5.19e-25	0.8353
1. PBF	Q03I82	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	5.77e-18	6.64e-14	0.8031
1. PBF	Q2KCV5	Phosphate import ATP-binding protein PstB	0.00e+00	6.41e-29	2.81e-16	0.8194
1. PBF	P23703	Nod factor export ATP-binding protein I	0.00e+00	4.02e-06	8.13e-23	0.8352
1. PBF	Q4AA74	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	9.80e-21	8.51e-22	0.7438
1. PBF	O27739	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	1.76e-03	1.10e-27	0.7911
1. PBF	Q30W28	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.66e-42	2.93e-36	0.8876
1. PBF	Q9ZJ34	Methionine import ATP-binding protein MetN	0.00e+00	1.08e-04	4.03e-27	0.8443
1. PBF	Q5WIL7	Phosphonates import ATP-binding protein PhnC	0.00e+00	5.12e-37	6.07e-38	0.888
1. PBF	Q5FM62	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.95e-21	3.22e-12	0.7959
1. PBF	Q92LX3	Methionine import ATP-binding protein MetN	0.00e+00	4.52e-04	1.90e-21	0.8472
1. PBF	Q0SQH5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.28e-21	9.03e-09	0.8189
1. PBF	Q52666	Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD	0.00e+00	1.04e-25	7.36e-22	0.839
1. PBF	Q39CJ6	Taurine import ATP-binding protein TauB	0.00e+00	2.52e-26	1.87e-16	0.7847
1. PBF	P63358	Probable ribonucleotide transport ATP-binding protein mkl	0.00e+00	2.93e-02	1.59e-18	0.8442
1. PBF	Q0SXV5	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.74e-49	5.52e-31	0.8814
1. PBF	Q39GW5	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	1.97e-07	5.38e-21	0.7778
1. PBF	O57872	Putative ABC transporter ATP-binding protein PH0132	0.00e+00	6.95e-30	7.90e-18	0.7945
1. PBF	Q39GT7	Nod factor export ATP-binding protein I	0.00e+00	7.09e-05	6.27e-20	0.8254
1. PBF	Q48PN3	Methionine import ATP-binding protein MetN 2	0.00e+00	2.96e-03	2.09e-22	0.8521
1. PBF	Q02SA6	Taurine import ATP-binding protein TauB	0.00e+00	1.68e-25	1.11e-13	0.7467
1. PBF	Q7VP69	Thiamine import ATP-binding protein ThiQ	0.00e+00	7.62e-36	1.57e-15	0.857
1. PBF	Q6GIH9	Methionine import ATP-binding protein MetN 2	0.00e+00	1.02e-02	2.51e-25	0.8212
1. PBF	Q5FM17	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.51e-34	5.58e-17	0.8245
1. PBF	Q1C647	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.47e-20	1.78e-17	0.7391
1. PBF	Q8FKF5	Taurine import ATP-binding protein TauB	0.00e+00	6.12e-26	9.52e-15	0.7444
1. PBF	Q7MLE6	Vitamin B12 import ATP-binding protein BtuD	2.22e-16	9.02e-26	3.97e-12	0.7601
1. PBF	Q3Z5U5	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.30e-32	6.51e-18	0.8152
1. PBF	Q2T751	Taurine import ATP-binding protein TauB	0.00e+00	9.80e-29	4.62e-10	0.7456
1. PBF	Q5HI31	Teichoic acids export ATP-binding protein TagH	1.15e-08	4.85e-13	6.08e-06	0.6452
1. PBF	Q7CHF8	Methionine import ATP-binding protein MetN 2	0.00e+00	2.56e-04	3.40e-28	0.8333
1. PBF	Q87UI3	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	5.85e-19	2.97e-22	0.8125
1. PBF	Q8D385	Zinc import ATP-binding protein ZnuC	0.00e+00	9.41e-35	1.88e-12	0.7578
1. PBF	Q0T6A8	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.83e-26	4.05e-15	0.7941
1. PBF	Q48HL2	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	9.22e-36	1.54e-38	0.8685
1. PBF	Q5HQQ9	Methionine import ATP-binding protein MetN 2	0.00e+00	2.28e-02	8.07e-24	0.8229
1. PBF	Q3SGJ8	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.70e-45	1.02e-34	0.8802
1. PBF	P48243	Glutamate transport ATP-binding protein GluA	0.00e+00	1.07e-31	7.40e-25	0.8326
1. PBF	Q9CEW8	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.52e-37	5.59e-17	0.8238
1. PBF	P63387	Intermembrane phospholipid transport system ATP-binding protein MlaF	0.00e+00	1.35e-27	2.05e-14	0.8483
1. PBF	Q3ARY3	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	7.54e-23	1.47e-17	0.8225
1. PBF	Q0BTP1	Phosphate import ATP-binding protein PstB	0.00e+00	7.10e-19	1.69e-16	0.828
1. PBF	Q1LQB5	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	5.08e-29	4.03e-32	0.8683
1. PBF	Q1J450	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8109
1. PBF	Q63TW1	Aliphatic sulfonates import ATP-binding protein SsuB	1.11e-16	3.66e-08	1.87e-22	0.7753
1. PBF	Q1CHI9	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.47e-20	1.78e-17	0.7395
1. PBF	Q72D46	Phosphate import ATP-binding protein PstB	0.00e+00	5.71e-32	5.70e-15	0.8097
1. PBF	Q2SR40	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.45e-52	4.67e-35	0.8851
1. PBF	Q8X5I6	Taurine import ATP-binding protein TauB	0.00e+00	3.51e-26	8.87e-15	0.7503
1. PBF	Q5MZ53	Bicarbonate transport ATP-binding protein CmpD	0.00e+00	4.55e-20	7.72e-15	0.7749
1. PBF	P0CZ28	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	0.8141
1. PBF	Q5HLN4	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.50e-30	2.87e-17	0.8513
1. PBF	Q6KHL2	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.47e-18	7.07e-17	0.7389
1. PBF	Q1IGN4	Methionine import ATP-binding protein MetN 1	0.00e+00	3.10e-03	1.99e-26	0.8443
1. PBF	P63375	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.57e-38	2.41e-17	0.8114
1. PBF	Q1RFH8	Taurine import ATP-binding protein TauB	0.00e+00	4.90e-26	1.75e-14	0.7423
1. PBF	Q63NI4	Methionine import ATP-binding protein MetN 2	0.00e+00	1.53e-02	1.96e-23	0.8443
1. PBF	Q6D0F3	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.46e-37	1.38e-17	0.7908
1. PBF	Q8XDV7	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.90e-50	1.35e-34	0.8818
1. PBF	Q9KP42	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.30e-33	1.56e-20	0.8104
1. PBF	P0AAF7	Arginine transport ATP-binding protein ArtP	0.00e+00	3.02e-41	1.26e-21	0.8289
1. PBF	Q92SA1	Phosphate import ATP-binding protein PstB	0.00e+00	6.41e-29	3.82e-15	0.8129
1. PBF	Q0I354	Thiamine import ATP-binding protein ThiQ	0.00e+00	4.15e-34	6.29e-17	0.828
1. PBF	O21280	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-15	1.14e-25	1.05e-07	0.7398
1. PBF	Q65F80	Methionine import ATP-binding protein MetN 2	0.00e+00	6.11e-03	4.36e-22	0.8182
1. PBF	Q83HT1	Phosphate import ATP-binding protein PstB	0.00e+00	2.21e-36	1.31e-22	0.8167
1. PBF	P30769	Probable ribonucleotide transport ATP-binding protein mkl	0.00e+00	1.86e-02	9.78e-21	0.8414
1. PBF	P47650	Phosphate import ATP-binding protein PstB	1.11e-16	3.64e-06	9.46e-11	0.7937
1. PBF	Q7A2W2	Teichoic acids export ATP-binding protein TagH	3.74e-10	4.59e-13	6.93e-06	0.6507
1. PBF	P57383	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.92e-28	3.41e-15	0.853
1. PBF	Q8CRB0	Putative hemin import ATP-binding protein HrtA	0.00e+00	4.17e-30	1.07e-17	0.8493
1. PBF	O52618	Nod factor export ATP-binding protein I	0.00e+00	3.55e-09	5.45e-24	0.8276
1. PBF	Q99XI2	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8079
1. PBF	Q8TIW9	Putative ABC transporter ATP-binding protein MA_4021	0.00e+00	4.08e-21	2.27e-22	0.7585
1. PBF	Q6KIS8	Phosphate import ATP-binding protein PstB	0.00e+00	6.43e-20	4.69e-13	0.8185
1. PBF	Q83MA0	Taurine import ATP-binding protein TauB	0.00e+00	5.69e-26	4.94e-13	0.7445
1. PBF	Q65HC0	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.60e-38	4.77e-14	0.8198
1. PBF	Q9V2E4	Putative ABC transporter ATP-binding protein PYRAB01300	0.00e+00	4.95e-27	1.44e-19	0.7992
1. PBF	Q1XDP6	Probable ATP-dependent transporter ycf16	3.33e-16	1.59e-32	2.35e-10	0.738
1. PBF	P02915	Histidine transport ATP-binding protein HisP	0.00e+00	1.07e-23	4.76e-14	0.8181
1. PBF	Q9HPH7	Putative ABC transporter ATP-binding protein VNG_1631G	0.00e+00	2.13e-33	2.88e-11	0.7997
1. PBF	Q88YK7	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.23e-38	1.27e-16	0.8229
1. PBF	Q8CQS7	Methionine import ATP-binding protein MetN 2	0.00e+00	1.83e-02	3.22e-24	0.8537
1. PBF	Q8YJ04	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.88e-39	9.61e-09	0.8309
1. PBF	Q02ME3	Methionine import ATP-binding protein MetN 1	0.00e+00	1.76e-03	7.87e-24	0.8418
1. PBF	Q8A853	Phosphate import ATP-binding protein PstB	0.00e+00	8.90e-32	6.61e-13	0.8228
1. PBF	Q1R3F6	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.92e-51	2.42e-34	0.8806
1. PBF	Q5WKG4	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	6.72e-24	2.95e-16	0.7659
1. PBF	Q7UPK3	Lipoprotein-releasing system ATP-binding protein LolD 2	1.78e-15	1.03e-29	1.45e-21	0.8567
1. PBF	O27764	Phosphate import ATP-binding protein PstB	0.00e+00	4.30e-37	6.20e-15	0.8141
1. PBF	Q6N0I5	Phosphate import ATP-binding protein PstB	0.00e+00	2.38e-25	9.41e-13	0.8263
1. PBF	Q3AAA4	Phosphate import ATP-binding protein PstB	0.00e+00	2.88e-40	2.08e-21	0.8197
1. PBF	Q87SV4	Thiamine import ATP-binding protein ThiQ	0.00e+00	6.03e-34	1.05e-16	0.8236
1. PBF	P35116	Nopaline permease ATP-binding protein P	0.00e+00	3.08e-23	2.83e-20	0.804
1. PBF	O28881	Probable branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	1.03e-37	2.43e-16	0.8566
1. PBF	Q87UV4	Methionine import ATP-binding protein MetN 1	0.00e+00	4.52e-03	7.41e-23	0.8355
1. PBF	O28912	Phosphate import ATP-binding protein PstB	0.00e+00	1.41e-39	5.58e-18	0.8316
1. PBF	Q5E882	Thiamine import ATP-binding protein ThiQ	0.00e+00	2.56e-36	9.94e-16	0.8359
1. PBF	P27675	Glutamine transport ATP-binding protein GlnQ	0.00e+00	1.25e-33	2.41e-32	0.8371
1. PBF	Q8Y651	Manganese transport system ATP-binding protein MntB	0.00e+00	2.96e-38	6.66e-25	0.7998
1. PBF	Q98DA2	Methionine import ATP-binding protein MetN	0.00e+00	1.18e-03	3.63e-20	0.8333
1. PBF	Q1CR30	Methionine import ATP-binding protein MetN	0.00e+00	1.79e-04	4.66e-28	0.8479
1. PBF	Q48V78	Methionine import ATP-binding protein MetN	0.00e+00	1.81e-02	1.23e-21	0.8565
1. PBF	Q1MLW4	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.78e-29	8.34e-18	0.8121
1. PBF	Q83P97	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.74e-49	5.52e-31	0.88
1. PBF	Q55281	Manganese transport system ATP-binding protein MntA	0.00e+00	4.19e-29	2.73e-26	0.7595
1. PBF	Q4ZRT7	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.65e-29	2.19e-16	0.8184
1. PBF	Q2G607	Phosphate import ATP-binding protein PstB	0.00e+00	9.35e-26	1.12e-15	0.8116
1. PBF	Q97ZT9	Phosphate import ATP-binding protein PstB	0.00e+00	3.70e-37	1.77e-17	0.799
1. PBF	Q62K72	Nod factor export ATP-binding protein I	0.00e+00	2.33e-05	1.21e-20	0.8218
1. PBF	Q2KDV1	Phosphonates import ATP-binding protein PhnC	0.00e+00	8.08e-19	1.67e-35	0.8847
1. PBF	Q03I83	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.12e-15	2.33e-14	0.7849
1. PBF	Q5LVC2	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.42e-28	2.36e-34	0.8891
1. PBF	Q2K284	Methionine import ATP-binding protein MetN	0.00e+00	1.68e-02	4.71e-21	0.8615
1. PBF	Q9AB70	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.84e-44	2.36e-32	0.8633
1. PBF	Q13ZJ1	Nod factor export ATP-binding protein I	0.00e+00	2.41e-06	9.20e-18	0.8285
1. PBF	Q5KX47	Phosphate import ATP-binding protein PstB	0.00e+00	7.06e-29	2.53e-18	0.8158
1. PBF	Q64SM5	Phosphate import ATP-binding protein PstB	0.00e+00	1.82e-28	1.48e-13	0.8107
1. PBF	Q7CMM8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8096
1. PBF	Q04HV8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.33e-19	4.76e-20	0.8004
1. PBF	Q48479	O-antigen export system ATP-binding protein RfbB	1.59e-14	9.49e-15	1.93e-09	0.6007
1. PBF	Q1GBI9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.21e-16	8.23e-14	0.7583
1. PBF	Q1J6D2	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.11e-37	2.40e-17	0.8162
1. PBF	Q63R24	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.96e-08	1.65e-32	0.8781
1. PBF	Q724C0	Methionine import ATP-binding protein MetN 1	0.00e+00	4.24e-02	7.99e-28	0.8233
1. PBF	P08720	Nod factor export ATP-binding protein I	0.00e+00	2.47e-07	7.95e-26	0.8535
1. PBF	Q5XBY7	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.83e-38	2.07e-17	0.8111
1. PBF	Q88PM5	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.96e-41	7.35e-34	0.8615
1. PBF	Q52815	General L-amino acid transport ATP-binding protein AapP	0.00e+00	2.33e-27	3.63e-21	0.8201
1. PBF	Q0T8D1	Thiamine import ATP-binding protein ThiQ	0.00e+00	4.76e-33	3.41e-18	0.81
1. PBF	Q8PY27	Putative ABC transporter ATP-binding protein MM_1037	0.00e+00	1.10e-16	2.88e-15	0.7925
1. PBF	Q882S0	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.89e-35	6.15e-39	0.8589
1. PBF	Q2JPW6	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.03e-39	3.64e-33	0.8701
1. PBF	Q2FII2	Methionine import ATP-binding protein MetN 2	0.00e+00	2.03e-02	3.31e-25	0.8201
1. PBF	Q2SVP3	Nod factor export ATP-binding protein I	0.00e+00	2.84e-06	1.45e-20	0.824
1. PBF	Q6GJ33	Teichoic acids export ATP-binding protein TagH	2.90e-08	2.77e-13	7.40e-06	0.6472
1. PBF	Q1CG91	Methionine import ATP-binding protein MetN 1	0.00e+00	2.56e-04	3.40e-28	0.8527
1. PBF	Q5X9B5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	0.8138
1. PBF	P63363	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.47e-31	1.83e-13	0.8156
1. PBF	Q63TX3	Nod factor export ATP-binding protein I	0.00e+00	1.72e-05	1.28e-20	0.8228
1. PBF	P72297	Octopine permease ATP-binding protein P	0.00e+00	1.16e-29	4.89e-21	0.8218
1. PBF	Q9KU04	Phosphate import ATP-binding protein PstB 1	0.00e+00	4.77e-27	1.02e-17	0.8136
1. PBF	Q9HYL7	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.51e-32	1.35e-31	0.8808
1. PBF	Q6LV32	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.32e-39	1.77e-16	0.8187
1. PBF	Q134N9	Methionine import ATP-binding protein MetN	0.00e+00	3.66e-02	1.81e-26	0.8448
1. PBF	Q8PY26	Putative ABC transporter ATP-binding protein MM_1038	2.22e-16	1.47e-14	2.17e-21	0.7616
1. PBF	P55662	Probable amino-acid ABC transporter ATP-binding protein y4tH	0.00e+00	1.54e-40	2.21e-19	0.8202
1. PBF	Q8XXY9	Nod factor export ATP-binding protein I	0.00e+00	2.80e-06	5.73e-17	0.8197
1. PBF	P0C0E3	Lantibiotic transport ATP-binding protein SrtF	0.00e+00	8.85e-26	5.45e-16	0.8483
1. PBF	Q890R2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.60e-19	1.16e-13	0.8155
1. PBF	Q5LXJ4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.12e-15	2.33e-14	0.784
1. PBF	Q1MIN0	Phosphate import ATP-binding protein PstB 2	0.00e+00	3.66e-24	5.93e-08	0.8249
1. PBF	Q637E2	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.12e-48	1.88e-37	0.8934
1. PBF	Q1JJD0	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8109
1. PBF	Q3JYF5	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.32e-22	3.47e-19	0.7984
1. PBF	O34977	Uncharacterized ABC transporter ATP-binding protein YthP	0.00e+00	1.73e-20	4.57e-07	0.7484
1. PBF	Q3IQI3	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.68e-25	7.02e-26	0.8442
1. PBF	P44986	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.20e-33	2.65e-17	0.8277
1. PBF	P15361	Probable ABC transporter ATP-binding protein p29	0.00e+00	1.49e-53	4.46e-47	0.9221
1. PBF	Q8REG7	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.63e-55	2.95e-40	0.9072
1. PBF	Q1WUX1	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.44e-38	7.99e-15	0.8174
1. PBF	Q04F14	Methionine import ATP-binding protein MetN 1	0.00e+00	5.59e-04	2.73e-26	0.8332
1. PBF	Q8FL82	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.49e-33	8.86e-19	0.8074
1. PBF	Q5LVM5	Taurine import ATP-binding protein TauB	0.00e+00	6.30e-28	1.97e-17	0.8127
1. PBF	Q21TG3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.54e-19	2.96e-25	0.8523
1. PBF	Q8GNH6	Nod factor export ATP-binding protein I	0.00e+00	1.30e-07	6.39e-23	0.8371
1. PBF	Q1DDP4	Methionine import ATP-binding protein MetN	0.00e+00	1.57e-03	1.50e-23	0.8499
1. PBF	Q1IKM7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.40e-27	8.89e-23	0.8407
1. PBF	Q5HHK4	Methionine import ATP-binding protein MetN 2	0.00e+00	2.03e-02	3.31e-25	0.8207
1. PBF	Q5V6B8	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	3.65e-35	3.13e-31	0.781
1. PBF	Q5YTW4	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.20e-40	7.34e-26	0.882
1. PBF	O34814	Cell division ATP-binding protein FtsE	0.00e+00	4.08e-45	3.12e-32	0.9038
1. PBF	Q4L4R9	Methionine import ATP-binding protein MetN	0.00e+00	3.79e-02	1.26e-23	0.819
1. PBF	Q8E2L3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.32e-22	3.47e-19	0.8004
1. PBF	Q8ZGU5	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.97e-41	2.66e-38	0.8739
1. PBF	Q8CMU4	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.16e-52	8.66e-37	0.8948
1. PBF	Q0TLS2	Thiamine import ATP-binding protein ThiQ	0.00e+00	2.96e-33	9.14e-19	0.8156
1. PBF	Q62H59	Phosphonates import ATP-binding protein PhnC	0.00e+00	3.06e-08	1.44e-32	0.892
1. PBF	Q3IY12	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.59e-34	9.12e-14	0.8343
1. PBF	Q97N51	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.97e-19	1.73e-20	0.801
1. PBF	Q720M2	Putative ABC transporter ATP-binding protein LMOf2365_1216	0.00e+00	3.81e-23	7.08e-20	0.8158
1. PBF	P63368	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.23e-38	3.25e-16	0.8209
1. PBF	A6QJK1	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	0.8454
1. PBF	Q1BWI2	Nod factor export ATP-binding protein I	0.00e+00	3.83e-05	4.41e-21	0.8189
1. PBF	Q1M7R4	Taurine import ATP-binding protein TauB	0.00e+00	1.05e-27	9.61e-08	0.7504
1. PBF	Q5HV18	Methionine import ATP-binding protein MetN	0.00e+00	1.08e-07	2.51e-22	0.8479
1. PBF	Q02QM1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.46e-32	5.87e-32	0.8655
1. PBF	Q92CK1	Putative ABC transporter ATP-binding protein lin1170	0.00e+00	8.53e-23	7.46e-21	0.832
1. PBF	A0QQ70	Phosphate-import ATP-binding protein PhnC	0.00e+00	9.25e-47	2.05e-19	0.8785
1. PBF	Q8NSN2	Methionine import ATP-binding protein MetN	0.00e+00	8.53e-03	9.95e-24	0.8274
1. PBF	Q9HZS1	Histidine transport ATP-binding protein HisP	0.00e+00	5.01e-38	9.97e-14	0.811
1. PBF	P0A9R9	Cell division ATP-binding protein FtsE	0.00e+00	4.91e-35	2.82e-25	0.841
1. PBF	Q4KKK8	Methionine import ATP-binding protein MetN 1	0.00e+00	5.79e-03	3.44e-24	0.8299
1. PBF	Q83GE8	Phosphate import ATP-binding protein PstB	0.00e+00	1.30e-35	6.13e-22	0.8165
1. PBF	Q47RE8	Methionine import ATP-binding protein MetN	0.00e+00	1.94e-07	3.60e-27	0.8133
1. PBF	Q5M244	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.12e-15	2.33e-14	0.7842
1. PBF	Q3A9G5	Methionine import ATP-binding protein MetN	0.00e+00	2.91e-03	6.52e-29	0.8306
1. PBF	Q97EK8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	8.98e-18	1.05e-13	0.8145
1. PBF	Q55108	Bicarbonate transport ATP-binding protein CmpD	0.00e+00	4.55e-20	7.72e-15	0.7717
1. PBF	O05732	Probable iron chelatin transport ATP-binding protein HP_0888	0.00e+00	8.27e-33	7.79e-15	0.8115
1. PBF	Q1C970	Methionine import ATP-binding protein MetN 2	0.00e+00	2.56e-04	3.40e-28	0.833
1. PBF	Q3JKX3	Taurine import ATP-binding protein TauB	0.00e+00	2.04e-28	4.08e-12	0.7253
1. PBF	Q46ZU5	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.00e-12	2.87e-20	0.7874
1. PBF	Q1RGD0	Thiamine import ATP-binding protein ThiQ	0.00e+00	6.34e-33	6.92e-19	0.8156
1. PBF	Q8RHL0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.01e-23	9.78e-14	0.7758
1. PBF	Q5H002	Phosphate import ATP-binding protein PstB	0.00e+00	7.48e-28	9.28e-16	0.8185
1. PBF	Q38YC1	Phosphate import ATP-binding protein PstB 2	0.00e+00	3.35e-33	6.48e-19	0.8148
1. PBF	Q7NC40	Phosphate import ATP-binding protein PstB	0.00e+00	8.64e-08	4.86e-16	0.8209
1. PBF	Q662E6	Phosphate import ATP-binding protein PstB	0.00e+00	4.56e-33	7.68e-15	0.8202
1. PBF	Q04BY6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.21e-16	8.23e-14	0.7585
1. PBF	Q119J0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	5.87e-50	4.64e-34	0.8681
1. PBF	Q1RDS4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	8.86e-27	3.53e-16	0.784
1. PBF	Q8DB62	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	9.80e-19	5.59e-08	0.7648
1. PBF	Q834B3	Phosphate import ATP-binding protein PstB 2	0.00e+00	6.06e-30	1.41e-11	0.8197
1. PBF	P0A2U9	Oligopeptide transport ATP-binding protein AmiE	0.00e+00	4.86e-02	6.02e-11	0.8143
1. PBF	Q8KCE8	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	2.97e-16	1.05e-17	0.8101
1. PBF	Q326G9	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.15e-32	3.38e-18	0.8069
1. PBF	Q2K164	Taurine import ATP-binding protein TauB	0.00e+00	1.83e-26	2.91e-07	0.7711
1. PBF	Q05067	Uncharacterized ABC transporter ATP-binding protein all4389	0.00e+00	1.07e-04	3.04e-15	0.8174
1. PBF	Q7A713	Teichoic acids export ATP-binding protein TagH	4.33e-08	4.59e-13	6.93e-06	0.608
1. PBF	Q48476	O-antigen export system ATP-binding protein RfbB	1.79e-14	4.64e-12	4.88e-08	0.608
1. PBF	Q5PDU4	Cobalt import ATP-binding protein CbiO	0.00e+00	4.51e-22	4.18e-18	0.7983
1. PBF	Q98GF5	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.30e-22	4.08e-32	0.8672
1. PBF	Q7NAQ7	Energy-coupling factor transporter ATP-binding protein EcfA2	6.66e-16	1.11e-14	7.19e-11	0.7897
1. PBF	Q6W2B1	Taurine import ATP-binding protein TauB	0.00e+00	8.62e-24	5.10e-10	0.7541
1. PBF	Q1C9L0	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.97e-41	2.66e-38	0.8713
1. PBF	O34900	L-cystine import ATP-binding protein TcyN	0.00e+00	1.34e-26	1.06e-24	0.8036
1. PBF	Q13VD7	Methionine import ATP-binding protein MetN 1	0.00e+00	4.54e-02	2.76e-24	0.8224
1. PBF	Q1JGL3	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.11e-37	2.40e-17	0.8175
1. PBF	Q0T9T7	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.33e-50	7.00e-34	0.8821
1. PBF	Q05596	Cobalt import ATP-binding protein CbiO	0.00e+00	1.49e-20	1.03e-17	0.8086
1. PBF	Q48QM3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.57e-22	1.68e-19	0.8075
1. PBF	Q329I3	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.26e-51	1.11e-32	0.8743
1. PBF	O29527	Putative ABC transporter ATP-binding protein AF_0731	0.00e+00	4.01e-10	6.90e-15	0.8141
1. PBF	Q2YSU3	Teichoic acids export ATP-binding protein TagH	1.01e-08	4.85e-13	6.08e-06	0.6435
1. PBF	Q28K97	Taurine import ATP-binding protein TauB	0.00e+00	1.51e-27	1.89e-17	0.7822
1. PBF	Q254K9	Methionine import ATP-binding protein MetN	0.00e+00	2.18e-05	4.96e-16	0.8544
1. PBF	Q8XA06	Thiamine import ATP-binding protein ThiQ	0.00e+00	6.60e-33	1.69e-17	0.8104
1. PBF	Q73KT5	Putative ABC transporter ATP-binding protein TDE_2132	0.00e+00	9.53e-26	6.44e-15	0.7628
1. PBF	O26096	Methionine import ATP-binding protein MetN	0.00e+00	1.20e-04	7.40e-29	0.8388
1. PBF	P39456	L-cystine import ATP-binding protein TcyC	0.00e+00	5.71e-38	4.32e-26	0.8044
1. PBF	Q83LN2	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	7.50e-26	3.18e-15	0.7955
1. PBF	Q88RL5	Methionine import ATP-binding protein MetN 1	0.00e+00	5.59e-04	1.05e-26	0.8276
1. PBF	Q1GCR8	Thiamine import ATP-binding protein ThiQ	0.00e+00	3.37e-32	2.21e-17	0.8463
1. PBF	Q4ZU82	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	1.76e-34	3.43e-37	0.8641
1. PBF	Q3K199	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.23e-38	3.25e-16	0.8289
1. PBF	Q9HT70	Methionine import ATP-binding protein MetN 2	0.00e+00	1.24e-02	4.75e-25	0.8357
1. PBF	P69879	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	0.8264
1. PBF	P0CZ36	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.57e-38	2.41e-17	0.816
1. PBF	Q6WB63	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.13e-23	4.04e-36	0.8939
1. PBF	Q0HTE5	Phosphate import ATP-binding protein PstB	0.00e+00	1.54e-25	1.36e-13	0.8199
1. PBF	Q99VG8	Methionine import ATP-binding protein MetN 2	0.00e+00	1.09e-02	4.59e-25	0.8182
1. PBF	Q1BWL4	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	2.38e-06	2.36e-20	0.7752
1. PBF	A0KAV6	Taurine import ATP-binding protein TauB	0.00e+00	2.01e-26	1.18e-16	0.7871
1. PBF	P0A9R8	Cell division ATP-binding protein FtsE	0.00e+00	4.91e-35	2.82e-25	0.8362
1. PBF	Q18H36	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.24e-17	6.85e-26	0.848
1. PBF	Q9KFN9	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	2.85e-46	7.91e-42	0.8948
1. PBF	Q8YA75	Methionine import ATP-binding protein MetN 1	0.00e+00	4.86e-02	5.28e-28	0.8189
1. PBF	Q8DG84	Putative ABC transporter ATP-binding protein tll2439	0.00e+00	3.57e-16	9.49e-20	0.8067
1. PBF	Q5LZU2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.15e-39	5.96e-16	0.8218
1. PBF	O83590	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.17e-22	2.42e-20	0.8598
1. PBF	Q6RCE0	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.39e-37	1.19e-34	0.8742
1. PBF	P0CZ26	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.30e-22	2.45e-19	0.8113
1. PBF	Q4A5A5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.30e-23	1.84e-17	0.8011
1. PBF	B7VPD0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.14e-22	1.06e-12	0.7632
1. PBF	Q7A6M2	Methionine import ATP-binding protein MetN 2	0.00e+00	1.09e-02	4.59e-25	0.8167
1. PBF	Q87S48	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.88e-25	5.42e-16	0.8159
1. PBF	Q17VE0	Methionine import ATP-binding protein MetN	0.00e+00	8.25e-05	1.28e-27	0.8304
1. PBF	Q664P8	Taurine import ATP-binding protein TauB	0.00e+00	8.38e-26	6.24e-15	0.7438
1. PBF	Q8YUV1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	8.40e-47	2.23e-35	0.8633
1. PBF	P0A9U0	Uncharacterized ABC transporter ATP-binding protein YbbA	0.00e+00	4.59e-21	3.43e-21	0.8417
1. PBF	D4GSY7	Probable anion import ATP-binding protein HVO_1886	0.00e+00	8.37e-22	1.80e-26	0.8296
1. PBF	Q9Z3I3	Nod factor export ATP-binding protein I	0.00e+00	3.48e-07	2.74e-21	0.829
1. PBF	O07016	Uncharacterized ABC transporter ATP-binding protein YvfR	3.33e-16	6.45e-03	1.03e-16	0.7758
1. PBF	Q831K6	Methionine import ATP-binding protein MetN 2	0.00e+00	2.42e-02	8.72e-29	0.8382
1. PBF	Q9PBK0	Phosphate import ATP-binding protein PstB	0.00e+00	4.03e-29	1.33e-15	0.8152
1. PBF	P0AAG4	Glutamate/aspartate import ATP-binding protein GltL	0.00e+00	2.13e-38	3.81e-19	0.8324
1. PBF	Q4ZZK0	Methionine import ATP-binding protein MetN 2	0.00e+00	1.71e-03	4.09e-23	0.8339
1. PBF	Q1IEK7	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.38e-41	1.65e-35	0.8409
1. PBF	Q0TJC1	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	2.82e-28	2.40e-17	0.784
1. PBF	Q2FJ01	Teichoic acids export ATP-binding protein TagH	3.40e-08	4.85e-13	6.08e-06	0.6103
1. PBF	Q87Q38	Vitamin B12 import ATP-binding protein BtuD	4.44e-16	1.68e-30	6.99e-13	0.7596
1. PBF	Q880A6	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.65e-29	2.19e-16	0.8176
1. PBF	Q1J983	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8121
1. PBF	Q222W0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	4.52e-21	1.36e-28	0.8655
1. PBF	Q6GB18	Methionine import ATP-binding protein MetN 2	0.00e+00	2.03e-02	3.31e-25	0.8238
1. PBF	Q8FRX8	Methionine import ATP-binding protein MetN	0.00e+00	2.53e-03	1.61e-26	0.8258
1. PBF	Q11NG0	Phosphate import ATP-binding protein PstB	0.00e+00	2.36e-33	2.09e-12	0.8105
1. PBF	Q9UZU7	Phosphate import ATP-binding protein PstB	0.00e+00	1.60e-36	1.27e-13	0.825
1. PBF	Q74L61	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.58e-17	3.19e-18	0.7967
1. PBF	Q72AQ6	Phosphonates import ATP-binding protein PhnC	0.00e+00	3.71e-47	1.46e-42	0.8886
1. PBF	Q2YWP2	Methionine import ATP-binding protein MetN 2	0.00e+00	7.66e-03	3.02e-25	0.8233
1. PBF	Q3YUN6	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.77e-49	1.59e-33	0.8827
1. PBF	Q21BU8	Methionine import ATP-binding protein MetN	0.00e+00	2.30e-04	1.93e-27	0.8433
1. PBF	P44871	Cell division ATP-binding protein FtsE	0.00e+00	2.13e-26	2.22e-25	0.8834
1. PBF	Q71WT3	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.47e-31	1.83e-13	0.8158
1. PBF	Q62B84	Methionine import ATP-binding protein MetN 2	0.00e+00	1.44e-02	2.04e-23	0.8476
1. PBF	Q325N3	Taurine import ATP-binding protein TauB	0.00e+00	1.94e-26	2.10e-14	0.7451
1. PBF	Q1C2S1	Taurine import ATP-binding protein TauB	0.00e+00	1.58e-26	5.88e-15	0.7424
1. PBF	Q6MIP7	Phosphonates import ATP-binding protein PhnC	0.00e+00	5.32e-50	1.75e-37	0.8957
1. PBF	Q5HDJ6	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	0.8451
1. PBF	P46903	ABC transporter ATP-binding protein NatA	0.00e+00	2.02e-18	7.08e-20	0.7985
1. PBF	Q51546	Phosphate import ATP-binding protein PstB	0.00e+00	2.00e-21	1.65e-11	0.8115
1. PBF	Q2YLW6	Thiamine import ATP-binding protein ThiQ	0.00e+00	2.35e-39	2.51e-08	0.8301
1. PBF	Q04EY4	Energy-coupling factor transporter ATP-binding protein EcfA3	0.00e+00	1.35e-19	3.91e-21	0.8121
1. PBF	Q5HKQ8	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.16e-52	8.66e-37	0.8959
1. PBF	Q07756	Nod factor export ATP-binding protein I	0.00e+00	8.98e-07	7.39e-19	0.7995
1. PBF	P0A9X2	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	0.7627
1. PBF	Q2NHW1	Phosphate import ATP-binding protein PstB	0.00e+00	1.96e-39	6.75e-19	0.812
1. PBF	Q67JX4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.15e-20	4.60e-21	0.7862
1. PBF	P0A2U8	Oligopeptide transport ATP-binding protein AmiE	0.00e+00	4.86e-02	6.02e-11	0.8182
1. PBF	Q5PDF8	Thiamine import ATP-binding protein ThiQ	0.00e+00	2.13e-34	6.02e-20	0.8054
1. PBF	Q88XV2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.37e-17	1.43e-19	0.8149
1. PBF	Q92L31	Thiamine import ATP-binding protein ThiQ	0.00e+00	6.59e-35	1.17e-11	0.8494
1. PBF	Q66EN1	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.46e-34	1.27e-17	0.7607
1. PBF	Q4L8L7	Putative hemin import ATP-binding protein HrtA	0.00e+00	1.92e-29	1.66e-18	0.8716
1. PBF	Q2SS06	Phosphate import ATP-binding protein PstB	0.00e+00	6.88e-33	1.43e-17	0.831
1. PBF	O30506	Arginine/ornithine transport ATP-binding protein AotP	0.00e+00	1.83e-32	1.50e-11	0.8047
1. PBF	Q13LC4	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.36e-15	8.03e-29	0.8848
1. PBF	Q3ABN1	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	5.41e-23	4.65e-15	0.8009
1. PBF	Q9WY65	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	1.51e-27	6.07e-18	0.7329
1. PBF	Q3SJQ8	Phosphate import ATP-binding protein PstB	0.00e+00	8.27e-33	7.10e-16	0.8268
1. PBF	Q1GZH6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.11e-21	2.69e-20	0.8606
1. PBF	P50332	Nod factor export ATP-binding protein I	0.00e+00	1.69e-07	1.93e-24	0.8354
1. PBF	Q890D1	Nickel import ATP-binding protein LarO	0.00e+00	2.36e-33	1.06e-17	0.8244
1. PBF	Q0K2U3	Taurine import ATP-binding protein TauB	0.00e+00	1.00e-28	8.31e-18	0.7776
1. PBF	Q9HNI8	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.52e-16	1.76e-32	0.8481
1. PBF	P73265	Nitrate import ATP-binding protein NrtD	0.00e+00	5.65e-27	1.83e-10	0.7886
1. PBF	Q4QND5	Zinc import ATP-binding protein ZnuC	0.00e+00	2.37e-14	4.48e-13	0.7129
1. PBF	Q9LC44	Teichoic acids export ATP-binding protein TagH	3.97e-08	4.59e-13	6.93e-06	0.6075
1. PBF	Q5WBL0	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	2.03e-31	2.02e-19	0.7875
1. PBF	Q57TF5	Thiamine import ATP-binding protein ThiQ	0.00e+00	8.30e-35	7.40e-20	0.8402
1. PBF	Q49XC6	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.83e-55	1.12e-36	0.8939
1. PBF	Q3ATA4	Phosphate import ATP-binding protein PstB	0.00e+00	1.77e-37	1.16e-12	0.8091
1. PBF	Q21Y06	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.09e-41	1.05e-30	0.8368
1. PBF	Q2YQT8	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-27	4.10e-19	0.8168
1. PBF	Q8UBY6	Thiamine import ATP-binding protein ThiQ	0.00e+00	7.42e-38	9.55e-13	0.8405
1. PBF	Q4L459	Teichoic acids export ATP-binding protein TagH	1.18e-10	6.41e-13	0.034	0.636
1. PBF	Q07LR5	Methionine import ATP-binding protein MetN	0.00e+00	8.69e-03	1.66e-25	0.8359
1. PBF	Q8DEW5	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.18e-27	7.40e-15	0.817
1. PBF	Q0PAB6	Methionine import ATP-binding protein MetN	0.00e+00	1.08e-07	2.51e-22	0.8479
1. PBF	Q07698	ABC transporter protein AbcA	1.91e-13	6.28e-03	8.66e-08	0.611
1. PBF	P0AAF8	Arginine transport ATP-binding protein ArtP	0.00e+00	3.02e-41	1.26e-21	0.8287
1. PBF	Q1C1S0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.37e-13	1.79e-20	0.7772
1. PBF	Q8NQH4	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.97e-43	1.48e-38	0.9066
1. PBF	Q3JHC9	Methionine import ATP-binding protein MetN 2	0.00e+00	1.98e-02	2.10e-23	0.8445
1. PBF	Q8KLG1	Nod factor export ATP-binding protein I	0.00e+00	1.53e-04	5.79e-25	0.8431
1. PBF	Q1CDR0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.37e-13	1.79e-20	0.7882
1. PBF	A2RH10	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.22e-21	1.82e-19	0.8114
1. PBF	Q92UX0	Taurine import ATP-binding protein TauB	0.00e+00	7.05e-22	1.10e-12	0.7823
1. PBF	A2RH11	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	0.8133
1. PBF	Q81LW6	Phosphate import ATP-binding protein PstB	0.00e+00	4.61e-31	6.36e-19	0.8238
1. PBF	Q8Z9I6	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.70e-33	6.08e-20	0.8307
1. PBF	Q6NBX6	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.59e-32	1.46e-29	0.8715
1. PBF	Q92V71	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.44e-21	3.72e-34	0.8761
1. PBF	Q82WC8	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	3.67e-17	0.001	0.7614
1. PBF	Q13KX9	Taurine import ATP-binding protein TauB 2	0.00e+00	6.47e-22	2.47e-11	0.7864
1. PBF	Q74PI5	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.37e-13	1.79e-20	0.7895
1. PBF	Q65M34	Methionine import ATP-binding protein MetN 1	0.00e+00	3.14e-02	4.23e-27	0.8295
1. PBF	A1A9L0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	8.86e-27	3.53e-16	0.7842
1. PBF	Q3ZA58	Phosphate import ATP-binding protein PstB	0.00e+00	1.66e-37	1.37e-17	0.8308
1. PBF	Q9RYZ3	Phosphate import ATP-binding protein PstB	0.00e+00	1.74e-35	7.07e-20	0.8148
1. PBF	A0LCH8	Zinc import ATP-binding protein ZnuC	0.00e+00	3.28e-13	5.14e-16	0.734
1. PBF	P45031	Intermembrane phospholipid transport system ATP-binding protein MlaF	0.00e+00	1.04e-32	1.60e-18	0.8512
1. PBF	Q9CEW7	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.92e-27	2.21e-12	0.828
1. PBF	Q49VI3	Teichoic acids export ATP-binding protein TagH	1.26e-10	1.62e-12	3.37e-05	0.656
1. PBF	P63377	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.57e-38	2.41e-17	0.8159
1. PBF	Q1WSB8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.42e-19	7.21e-19	0.806
1. PBF	Q88C57	Phosphate import ATP-binding protein PstB 2	0.00e+00	8.09e-23	9.21e-14	0.8169
1. PBF	P75186	Phosphate import ATP-binding protein PstB	0.00e+00	2.25e-06	1.42e-12	0.7824
1. PBF	Q6F9P2	Methionine import ATP-binding protein MetN 2	0.00e+00	1.66e-03	1.38e-26	0.8262
1. PBF	Q1CMQ3	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.40e-34	1.93e-17	0.7621
1. PBF	Q032H3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.58e-15	2.44e-21	0.8045
1. PBF	Q6N798	Methionine import ATP-binding protein MetN 2	0.00e+00	2.69e-02	6.19e-27	0.8464
1. PBF	P26050	Nod factor export ATP-binding protein I	0.00e+00	4.48e-08	2.25e-23	0.8293
1. PBF	Q18CJ0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.03e-17	1.76e-15	0.8203
1. PBF	Q7NZI7	Phosphate import ATP-binding protein PstB	0.00e+00	1.11e-31	9.68e-15	0.8182
1. PBF	P46342	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.06e-32	6.02e-14	0.8051
1. PBF	Q81LM1	Petrobactin import ATP-binding protein FpuC	0.00e+00	1.33e-20	4.67e-16	0.8432
1. PBF	Q8DWR4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.32e-22	3.47e-19	0.8015
1. PBF	Q166X0	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	1.44e-28	1.38e-32	0.891
1. PBF	Q8TI15	Putative ABC transporter ATP-binding protein MA_4342	9.99e-16	4.10e-15	5.18e-19	0.7261
1. PBF	Q9PPV2	Energy-coupling factor transporter ATP-binding protein EcfA2	7.35e-07	1.24e-09	1.20e-07	0.7739
1. PBF	Q2FNX9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.48e-19	3.24e-18	0.7862
1. PBF	P0A2V2	Octopine permease ATP-binding protein P	0.00e+00	2.06e-25	6.45e-22	0.8152
1. PBF	O34338	Manganese transport system ATP-binding protein MntB	0.00e+00	4.66e-39	4.27e-29	0.7596
1. PBF	Q6RH47	Taurine import ATP-binding protein TauB	0.00e+00	1.26e-20	9.30e-14	0.7837
1. PBF	Q13ZK7	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.11e-16	3.64e-06	4.10e-19	0.7736
1. PBF	Q5PB72	Zinc import ATP-binding protein ZnuC	0.00e+00	4.16e-23	2.68e-14	0.7612
1. PBF	Q1BT84	Taurine import ATP-binding protein TauB	0.00e+00	2.01e-26	1.18e-16	0.7824
1. PBF	Q1MMZ3	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.01e-21	3.42e-35	0.8834
1. PBF	Q0K1N8	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	4.06e-28	2.81e-33	0.8707
1. PBF	Q8ZX91	Phosphate import ATP-binding protein PstB	0.00e+00	7.92e-38	4.95e-18	0.8028
1. PBF	Q9CIS8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.30e-15	2.20e-22	0.8096
1. PBF	Q3KJS6	Methionine import ATP-binding protein MetN 2	0.00e+00	3.10e-03	8.27e-25	0.8531
1. PBF	Q6N9W0	Methionine import ATP-binding protein MetN 1	0.00e+00	1.97e-03	1.84e-26	0.8353
1. PBF	Q8UI76	Phosphate import ATP-binding protein PstB	0.00e+00	1.41e-30	1.73e-16	0.8088
1. PBF	Q5FFT1	Phosphate import ATP-binding protein PstB	0.00e+00	2.16e-32	4.60e-19	0.8215
1. PBF	Q0SFY5	Methionine import ATP-binding protein MetN 1	0.00e+00	4.46e-02	2.45e-22	0.8454
1. PBF	Q4A5A4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	9.94e-24	1.60e-16	0.7555
1. PBF	Q1C1Y5	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.40e-34	1.93e-17	0.7626
1. PBF	Q8EPK1	Methionine import ATP-binding protein MetN 1	0.00e+00	3.43e-03	8.74e-30	0.8101
1. PBF	Q8D928	Vitamin B12 import ATP-binding protein BtuD	3.33e-16	1.34e-24	1.84e-11	0.7552
1. PBF	Q18C09	Methionine import ATP-binding protein MetN	0.00e+00	3.47e-04	8.13e-26	0.8416
1. PBF	Q6FFZ1	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.91e-16	1.11e-18	0.7653
1. PBF	Q9WXX8	Probable metal transport system ATP-binding protein TM_0124	0.00e+00	5.11e-28	5.07e-17	0.7951
1. PBF	A2RI02	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.19e-16	1.63e-22	0.8096
1. PBF	Q9F9B0	Fructose import ATP-binding protein FrcA	0.00e+00	2.10e-24	4.78e-14	0.8285
1. PBF	Q665B6	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.29e-13	1.26e-20	0.7844
1. PBF	Q5HR97	Teichoic acids export ATP-binding protein TagH	2.57e-10	6.70e-14	0.038	0.6379
1. PBF	Q88RB3	Methionine import ATP-binding protein MetN 2	0.00e+00	3.10e-03	6.27e-27	0.8451
1. PBF	Q87C88	Phosphate import ATP-binding protein PstB	0.00e+00	5.62e-28	1.65e-15	0.8232
1. PBF	Q30PC0	Phosphate import ATP-binding protein PstB	0.00e+00	1.91e-32	5.79e-11	0.8163
1. PBF	Q48QM2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	6.55e-19	8.54e-17	0.8142
1. PBF	Q87UN4	Methionine import ATP-binding protein MetN 2	0.00e+00	2.14e-03	1.19e-25	0.8343
2. PF	Q13I12	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	3.70e-18	NA	0.7304
2. PF	Q5PI55	Cytochrome c biogenesis ATP-binding export protein CcmA 1	1.11e-16	9.10e-20	NA	0.7677
2. PF	Q3Z006	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	8.17e-18	NA	0.7678
2. PF	Q57M97	Cytochrome c biogenesis ATP-binding export protein CcmA 1	1.11e-16	6.24e-19	NA	0.7673
2. PF	Q2Y9Q1	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-16	4.46e-13	NA	0.7707
2. PF	Q56903	O-antigen export system ATP-binding protein RfbE	2.33e-08	8.57e-09	NA	0.6074
2. PF	Q8ZKZ9	Cytochrome c biogenesis ATP-binding export protein CcmA 1	0.00e+00	8.62e-19	NA	0.7652
2. PF	Q5PKT6	Cytochrome c biogenesis ATP-binding export protein CcmA 2	1.11e-16	1.08e-20	NA	0.7697
2. PF	P61377	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	6.55e-19	NA	0.7743
2. PF	Q8GQ92	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.46e-19	NA	0.7901
3. BF	Q8Y0X3	Methionine import ATP-binding protein MetN	0.00e+00	NA	4.87e-25	0.8232
3. BF	Q8D7T7	Ribose import ATP-binding protein RbsA	2.46e-13	NA	7.67e-07	0.8012
3. BF	Q8DQY5	Putative ABC transporter ATP-binding protein spr0430	2.68e-13	NA	4.35e-24	0.7757
3. BF	Q56342	Galactose/methyl galactoside import ATP-binding protein MglA	6.59e-14	NA	1.10e-12	0.8181
3. BF	A9MZG1	Autoinducer 2 import ATP-binding protein LsrA	9.10e-15	NA	5.56e-14	0.8154
3. BF	Q81HW8	Ribose import ATP-binding protein RbsA	1.49e-13	NA	2.59e-15	0.814
3. BF	Q9Y8G2	ABC multidrug transporter atrC	1.39e-06	NA	7.15e-12	0.8112
3. BF	A0A1U8QG99	ABC multidrug transporter atrC	1.25e-06	NA	7.15e-12	0.7666
3. BF	Q5LT05	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.05e-14	0.84
3. BF	Q1MQ44	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.74e-16	0.7991
3. BF	Q325U1	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.22e-22	0.8197
3. BF	Q32HC7	Arabinose import ATP-binding protein AraG	8.43e-14	NA	6.30e-13	0.804
3. BF	Q72FW5	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.51e-12	0.8235
3. BF	Q8YD40	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.60e-26	0.8619
3. BF	Q2RWA3	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.27e-25	0.8216
3. BF	Q1R528	Xylose import ATP-binding protein XylG	5.68e-14	NA	8.20e-12	0.8337
3. BF	Q6LK34	Galactose/methyl galactoside import ATP-binding protein MglA 1	3.52e-14	NA	2.97e-09	0.8177
3. BF	Q3YVK8	Ribose import ATP-binding protein RbsA	1.84e-13	NA	8.99e-12	0.8091
3. BF	A0B297	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	3.96e-13	NA	3.46e-11	0.7916
3. BF	Q7MKU3	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	7.38e-15	0.8057
3. BF	Q3K8M7	Arabinose import ATP-binding protein AraG	1.88e-13	NA	2.11e-12	0.7978
3. BF	Q1BY14	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	3.42e-25	0.8162
3. BF	Q88CL2	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	9.08e-20	0.8199
3. BF	Q8NY21	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	9.42e-25	0.8558
3. BF	Q0TPX5	Ribose import ATP-binding protein RbsA	3.04e-13	NA	3.49e-10	0.8217
3. BF	P19844	Probable ABC transporter ATP-binding protein NosF	0.00e+00	NA	4.02e-14	0.7594
3. BF	P0AAF5	Arabinose import ATP-binding protein AraG	1.85e-13	NA	3.58e-13	0.8053
3. BF	Q1C9V1	Galactose/methyl galactoside import ATP-binding protein MglA	3.65e-13	NA	7.75e-13	0.8028
3. BF	Q92EZ6	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	2.40e-28	0.8186
3. BF	Q89UD2	Sulfate/thiosulfate import ATP-binding protein CysA	2.22e-16	NA	3.10e-16	0.8387
3. BF	Q2YJE7	Xylose import ATP-binding protein XylG	8.61e-13	NA	1.90e-11	0.8217
3. BF	Q6D201	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.34e-18	0.8463
3. BF	Q83F44	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.46e-27	0.8231
3. BF	Q30V33	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.65e-12	0.8007
3. BF	Q2FJI0	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	5.36e-24	0.8561
3. BF	Q7W6G5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	8.87e-14	0.8199
3. BF	Q82TL6	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	1.17e-12	0.8213
3. BF	O05253	Guanosine import ATP-binding protein NupO	8.00e-14	NA	1.01e-16	0.8311
3. BF	Q5ZUG5	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.02e-22	0.8353
3. BF	Q18AM3	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	9.24e-13	0.8303
3. BF	Q1C7J0	Arabinose import ATP-binding protein AraG	1.02e-13	NA	1.40e-11	0.8123
3. BF	Q0RAT5	Spermidine/putrescine import ATP-binding protein PotA	3.44e-15	NA	4.60e-15	0.8371
3. BF	Q2RGX2	Xylose import ATP-binding protein XylG	4.17e-13	NA	5.51e-09	0.7842
3. BF	Q0TBN5	Xylose import ATP-binding protein XylG	5.30e-14	NA	8.36e-12	0.8336
3. BF	Q6DB87	Ribose import ATP-binding protein RbsA	2.65e-13	NA	2.54e-12	0.8088
3. BF	Q0BQ80	Molybdenum import ATP-binding protein ModC	1.84e-12	NA	2.78e-11	0.7217
3. BF	A1SWH9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	1.47e-13	0.8237
3. BF	Q97X60	Putative ABC transporter ATP-binding protein SSO1893	4.80e-14	NA	3.92e-17	0.7635
3. BF	Q3KDW2	Xylose import ATP-binding protein XylG	7.15e-14	NA	6.05e-12	0.8268
3. BF	Q987E7	Ribose import ATP-binding protein RbsA 2	4.09e-14	NA	3.54e-11	0.8142
3. BF	Q03A07	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.92e-28	0.8276
3. BF	Q8U7G2	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.24e-19	0.8481
3. BF	Q81VM2	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.48e-24	0.8161
3. BF	Q74IV9	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.82e-24	0.8559
3. BF	Q8P4S7	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.95e-25	0.8211
3. BF	A0KE25	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	1.17e-13	NA	3.71e-16	0.773
3. BF	Q62M41	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.66e-24	0.8122
3. BF	Q48IS7	Arabinose import ATP-binding protein AraG	2.19e-13	NA	1.89e-11	0.7927
3. BF	Q2L0H5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	3.69e-13	0.8208
3. BF	Q6LUY1	Xylose import ATP-binding protein XylG	5.22e-13	NA	2.72e-11	0.8254
3. BF	Q399X3	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	3.98e-13	NA	1.40e-11	0.7876
3. BF	P94440	Linearmycin resistance ATP-binding protein LnrL	0.00e+00	NA	8.67e-16	0.8183
3. BF	Q6Q876	Multidrug resistance protein sirA	9.09e-07	NA	2.75e-17	0.7753
3. BF	Q6HBS0	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	1.01e-19	0.8192
3. BF	Q576H3	Xylose import ATP-binding protein XylG	6.86e-13	NA	1.90e-11	0.8128
3. BF	Q47T99	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	1.15e-18	0.82
3. BF	Q97WT4	Putative ABC transporter ATP-binding protein SSO2030	2.65e-14	NA	7.90e-16	0.7784
3. BF	Q0BMC9	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.11e-32	0.8307
3. BF	P0AAF4	Arabinose import ATP-binding protein AraG	1.66e-13	NA	3.58e-13	0.8043
3. BF	Q8ZKV9	Ribose import ATP-binding protein RbsA	2.37e-13	NA	7.18e-12	0.8094
3. BF	O69063	Hypophosphite import ATP-binding protein HtxD	0.00e+00	NA	3.11e-35	0.9156
3. BF	Q65UE1	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.54e-13	0.8317
3. BF	Q31V51	Xylose import ATP-binding protein XylG	5.71e-14	NA	7.97e-12	0.8336
3. BF	Q8Y843	Teichoic acids export ATP-binding protein TagH	9.31e-14	NA	2.44e-04	0.6607
3. BF	Q8FFU7	Galactose/methyl galactoside import ATP-binding protein MglA	2.66e-13	NA	9.65e-10	0.8006
3. BF	P47288	Spermidine/putrescine import ATP-binding protein PotA	9.84e-07	NA	5.32e-06	0.7965
3. BF	Q5ZZZ7	Spermidine/putrescine import ATP-binding protein PotA	4.10e-09	NA	2.20e-05	0.8163
3. BF	Q81XL3	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	1.23e-19	0.8213
3. BF	Q0KDG3	Methionine import ATP-binding protein MetN	0.00e+00	NA	4.56e-25	0.8192
3. BF	H9BZ66	ABC transporter G family member 1	2.94e-11	NA	5.86e-13	0.774
3. BF	Q92CV8	Teichoic acids export ATP-binding protein TagH	8.86e-14	NA	2.37e-05	0.6665
3. BF	Q7VM95	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.38e-24	0.8197
3. BF	Q0SFW6	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	2.58e-27	0.862
3. BF	Q57HW1	Ribose import ATP-binding protein RbsA	2.73e-13	NA	5.52e-12	0.8084
3. BF	Q609Q1	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	2.06e-18	0.828
3. BF	Q8TQW9	Putative ABC transporter ATP-binding protein MA_1418	6.68e-14	NA	6.80e-22	0.8084
3. BF	Q0BFU0	Ribose import ATP-binding protein RbsA 1	2.94e-13	NA	5.63e-09	0.8134
3. BF	Q5BAY0	ABC multidrug transporter atrD	1.93e-06	NA	1.74e-20	0.7997
3. BF	Q6HP89	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.07e-28	0.8344
3. BF	Q2IN45	Phosphonates import ATP-binding protein PhnC	0.00e+00	NA	8.61e-36	0.8987
3. BF	Q8E8K8	Sulfate/thiosulfate import ATP-binding protein CysA 2	5.55e-16	NA	1.65e-16	0.8264
3. BF	Q815Y7	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	1.01e-19	0.8218
3. BF	Q7MEV1	Ribose import ATP-binding protein RbsA	3.41e-13	NA	6.93e-07	0.8014
3. BF	A0A059JJ46	ABC multidrug transporter MDR2	1.99e-06	NA	5.78e-17	0.802
3. BF	Q8XAW7	Ribose import ATP-binding protein RbsA 1	2.12e-13	NA	3.20e-11	0.8135
3. BF	Q5H503	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.89e-26	0.8233
3. BF	Q5NFU5	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.15e-32	0.8353
3. BF	Q6LN52	Methionine import ATP-binding protein MetN	0.00e+00	NA	9.49e-26	0.8127
3. BF	Q5X484	Methionine import ATP-binding protein MetN	0.00e+00	NA	4.87e-22	0.8501
3. BF	Q4UQD2	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.95e-25	0.8211
3. BF	Q1CDC0	Xylose import ATP-binding protein XylG	6.38e-14	NA	3.85e-13	0.8293
3. BF	Q1J3P2	Ribose import ATP-binding protein RbsA	3.16e-14	NA	4.42e-13	0.8154
3. BF	Q55462	Bicarbonate transport ATP-binding protein CmpC	3.56e-13	NA	3.40e-12	0.812
3. BF	Q1QVQ7	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.09e-25	0.8267
3. BF	Q8XPK6	Xylose import ATP-binding protein XylG	5.56e-13	NA	7.56e-10	0.8226
3. BF	Q8EBC3	Sulfate/thiosulfate import ATP-binding protein CysA 1	2.00e-15	NA	1.37e-17	0.7746
3. BF	Q6LG59	Galactose/methyl galactoside import ATP-binding protein MglA 2	2.57e-13	NA	8.36e-09	0.8046
3. BF	Q630Y3	Teichoic acids export ATP-binding protein TagH	2.83e-10	NA	0.043	0.6169
3. BF	Q7VV72	Methionine import ATP-binding protein MetN	0.00e+00	NA	9.98e-28	0.7883
3. BF	Q72Y96	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	9.70e-20	0.8212
3. BF	Q87AL9	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.33e-23	0.8247
3. BF	Q32JQ8	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.92e-23	0.8186
3. BF	Q73F11	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	8.33e-25	0.8169
3. BF	Q8UAK2	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.72e-13	NA	2.95e-10	0.8021
3. BF	Q64SQ6	Spermidine/putrescine import ATP-binding protein PotA	1.29e-14	NA	9.80e-16	0.7893
3. BF	Q8FUR8	Xylose import ATP-binding protein XylG	6.75e-13	NA	1.32e-10	0.8098
3. BF	Q2NRN5	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.25e-23	0.8124
3. BF	Q9KS33	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	3.91e-17	0.8048
3. BF	Q0TLD2	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.45e-23	0.8187
3. BF	Q81IZ6	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	3.12e-23	0.8166
3. BF	Q63FX9	Ribose import ATP-binding protein RbsA	9.99e-14	NA	8.26e-15	0.8083
3. BF	Q831L8	Teichoic acids export ATP-binding protein TagH	5.98e-09	NA	0.018	0.6463
3. BF	Q12B04	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.44e-24	0.8075
3. BF	P73450	Nitrate import ATP-binding protein NrtC	7.93e-13	NA	2.70e-12	0.7698
3. BF	Q1BGC0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	1.78e-13	NA	3.71e-16	0.784
3. BF	Q882I8	Arabinose import ATP-binding protein AraG	4.13e-13	NA	2.72e-11	0.7805
3. BF	Q2YIV5	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.60e-26	0.8618
3. BF	Q8ENU2	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	1.03e-21	0.8101
3. BF	Q5PJX5	Ribose import ATP-binding protein RbsA	2.31e-13	NA	9.77e-12	0.8104
3. BF	Q2KVK2	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.70e-27	0.8222
3. BF	Q6D4W8	Arabinose import ATP-binding protein AraG	3.31e-13	NA	2.68e-12	0.7843
3. BF	Q5E586	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.16e-12	0.7977
3. BF	Q65WJ1	Arabinose import ATP-binding protein AraG	3.42e-14	NA	1.95e-15	0.8188
3. BF	Q1QE80	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	1.12e-17	0.8454
3. BF	F2T1C4	ABC multidrug transporter MDR2	1.82e-06	NA	3.78e-17	0.8007
3. BF	Q9CP06	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	5.87e-15	0.8259
3. BF	Q6GC27	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	9.42e-25	0.8238
3. BF	Q5PID0	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.36e-24	0.8185
3. BF	F2SQT8	ABC multidrug transporter MDR5	3.63e-07	NA	8.90e-16	0.7768
3. BF	A0LUE6	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	6.09e-15	0.8224
3. BF	Q8X5D9	Galactose/methyl galactoside import ATP-binding protein MglA	2.82e-13	NA	7.79e-10	0.7972
3. BF	Q7W4E1	Methionine import ATP-binding protein MetN	0.00e+00	NA	9.98e-28	0.8258
3. BF	P68188	Maltose/maltodextrin import ATP-binding protein MalK	5.55e-16	NA	1.10e-16	0.8168
3. BF	Q6HI76	Putative ABC transporter ATP-binding protein BT9727_2424	5.35e-13	NA	3.25e-17	0.7809
3. BF	Q83MC5	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.45e-22	0.819
3. BF	Q81V36	Ribose import ATP-binding protein RbsA	9.64e-14	NA	8.42e-15	0.8091
3. BF	Q2SJ99	Ribose import ATP-binding protein RbsA	1.27e-13	NA	8.32e-14	0.797
3. BF	Q7A7E3	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	6.44e-25	0.8279
3. BF	P23924	Galactose/methyl galactoside import ATP-binding protein MglA	5.47e-13	NA	8.24e-10	0.7949
3. BF	Q0TGT7	Arabinose import ATP-binding protein AraG	1.59e-13	NA	5.03e-13	0.8033
3. BF	Q5YZY9	Sulfate/thiosulfate import ATP-binding protein CysA	0.00e+00	NA	2.09e-15	0.817
3. BF	Q74I62	Putative ABC transporter ATP-binding protein LJ_1704	5.53e-13	NA	2.90e-22	0.7989
3. BF	Q322L1	Arabinose import ATP-binding protein AraG	1.66e-13	NA	3.83e-13	0.803
3. BF	Q81IN8	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	8.99e-30	0.8242
3. BF	Q6HNE7	Ribose import ATP-binding protein RbsA	2.16e-13	NA	8.42e-15	0.8079
3. BF	Q99WE1	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	6.44e-25	0.8286
3. BF	Q1RFY9	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.28e-23	0.8188
3. BF	Q4KDI2	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.31e-13	NA	5.62e-09	0.8139
3. BF	Q631Y4	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	1.17e-19	0.8238
3. BF	Q8ZRM9	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	4.10e-25	0.8187
3. BF	Q1R4I3	Ribose import ATP-binding protein RbsA	2.25e-13	NA	3.52e-11	0.8152
3. BF	Q667L9	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	6.04e-27	0.8157
3. BF	Q73DH7	Ribose import ATP-binding protein RbsA	3.33e-13	NA	1.08e-14	0.7923
3. BF	Q65VG9	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.04e-25	0.8244
3. BF	Q8RI39	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.52e-17	0.8351
3. BF	Q53I83	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.77e-25	0.8158
3. BF	Q7NQN5	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	5.44e-12	0.8256
3. BF	Q6DB03	Xylose import ATP-binding protein XylG	9.46e-14	NA	3.53e-12	0.8252
3. BF	A4WER4	Autoinducer 2 import ATP-binding protein LsrA	4.44e-16	NA	2.20e-09	0.842
3. BF	Q39AT4	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	2.08e-24	0.8372
3. BF	Q88WA5	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	6.09e-24	0.8523
3. BF	Q2SMT0	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.71e-13	NA	2.94e-09	0.8039
3. BF	Q7UC29	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	4.65e-20	0.7983
3. BF	Q4ZTW1	Arabinose import ATP-binding protein AraG	4.11e-13	NA	7.85e-12	0.7629
3. BF	Q1B8V9	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	7.25e-14	0.828
3. BF	Q92VJ2	Sulfate/thiosulfate import ATP-binding protein CysA 2	2.11e-15	NA	2.55e-19	0.8329
3. BF	Q6A6X6	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.90e-25	0.8544
3. BF	Q9K6J9	Ribose import ATP-binding protein RbsA	4.46e-14	NA	1.54e-14	0.8214
3. BF	Q9V2C0	Molybdate/tungstate import ATP-binding protein WtpC	1.33e-15	NA	3.69e-13	0.7703
3. BF	Q3KK97	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.83e-19	0.8334
3. BF	Q1C0D5	Xylose import ATP-binding protein XylG	2.69e-14	NA	3.85e-13	0.8291
3. BF	F2PRR1	ABC multidrug transporter MDR2	1.89e-06	NA	3.57e-17	0.8008
3. BF	Q50966	Fe(3+) ions import ATP-binding protein FbpC	7.88e-15	NA	1.13e-19	0.7816
3. BF	Q7VI92	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.34e-25	0.8654
3. BF	Q3JPZ4	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.66e-24	0.8127
3. BF	Q97SA3	Putative ABC transporter ATP-binding protein SP_0483	1.06e-13	NA	3.28e-25	0.7843
3. BF	Q0AU85	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.81e-29	0.8603
3. BF	Q1B677	Methionine import ATP-binding protein MetN	0.00e+00	NA	4.91e-28	0.8501
3. BF	Q73R11	Putative ABC transporter ATP-binding protein TDE_0282	2.12e-14	NA	2.39e-17	0.7998
3. BF	P26946	Uncharacterized ABC transporter ATP-binding protein BpOF4_11395	3.22e-15	NA	2.24e-07	0.7581
3. BF	Q8PSR0	Putative ABC transporter ATP-binding protein MM_3016	7.29e-14	NA	1.22e-19	0.8026
3. BF	Q2YVT7	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	2.14e-24	0.8282
3. BF	Q83J33	Xylose import ATP-binding protein XylG	6.06e-14	NA	1.10e-11	0.8311
3. BF	Q0WER5	Arabinose import ATP-binding protein AraG	3.35e-13	NA	1.40e-11	0.7866
3. BF	Q72PE5	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	5.13e-16	0.8395
3. BF	Q2SW38	Xylose import ATP-binding protein XylG	9.51e-14	NA	6.50e-11	0.8191
3. BF	Q5ZWE4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.13e-17	0.8289
3. BF	Q50863	O-antigen export system ATP-binding protein RfbB	4.97e-11	NA	1.83e-09	0.6015
3. BF	Q8Y4L8	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	3.51e-24	0.8466
3. BF	Q1BJW2	Arabinose import ATP-binding protein AraG 2	1.02e-13	NA	6.36e-11	0.811
3. BF	Q3Z5F8	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.28e-23	0.8191
3. BF	Q9YGA6	Trehalose/maltose import ATP-binding protein MalK	2.78e-15	NA	6.64e-16	0.7998
3. BF	Q5WVL8	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.37e-22	0.8348
3. BF	Q9I6L0	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.03e-19	0.8354
3. BF	Q2SJY7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.98e-13	0.8221
3. BF	P45046	Xylose import ATP-binding protein XylG	6.14e-14	NA	2.74e-12	0.8144
3. BF	Q87FK7	Arabinose import ATP-binding protein AraG	1.71e-13	NA	6.60e-11	0.7628
3. BF	Q5E715	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.48e-27	0.8139
3. BF	Q62K91	Ribose import ATP-binding protein RbsA	2.82e-14	NA	6.82e-15	0.8247
3. BF	Q5HIL5	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	5.36e-24	0.8239
3. BF	A0A0D1BUH6	ABC-type transporter atr1	9.46e-07	NA	1.53e-17	0.7915
3. BF	Q6VMN4	Xylose import ATP-binding protein XylG	2.90e-13	NA	2.21e-14	0.8139
3. BF	Q79EE4	Osmoprotective compounds uptake ATP-binding protein GgtA	3.33e-16	NA	2.12e-12	0.8154
3. BF	A0KE53	Xylose import ATP-binding protein XylG	1.09e-13	NA	2.01e-10	0.8103
3. BF	Q8RFN2	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.21e-24	0.8285
3. BF	Q2A3Z2	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.11e-32	0.8314
3. BF	Q1BR30	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	3.14e-24	0.8388
3. BF	A0A179H0T5	ABC multidrug transporter lscH	2.39e-05	NA	5.56e-07	0.7861
3. BF	Q03CA4	Ribose import ATP-binding protein RbsA	8.62e-14	NA	4.32e-09	0.8212
3. BF	P0A4W3	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.58e-13	0.8155
3. BF	Q5WKL3	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	3.63e-24	0.8241
3. BF	Q8D9J4	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	7.38e-15	0.8052
3. BF	P36947	Ribose import ATP-binding protein RbsA	9.79e-14	NA	8.89e-17	0.7902
3. BF	Q6GJL2	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.69e-24	0.8557
3. BF	Q7W9U5	Sulfate/thiosulfate import ATP-binding protein CysA	3.33e-16	NA	1.42e-15	0.8293
3. BF	Q160M2	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.14e-10	0.8183
3. BF	Q9KAG5	Putative ribose/galactose/methyl galactoside import ATP-binding protein	8.35e-14	NA	6.10e-11	0.819
3. BF	Q9A502	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.80e-23	0.8313
3. BF	Q0B7X0	Ribose import ATP-binding protein RbsA 2	2.92e-14	NA	3.23e-14	0.8168
3. BF	Q66D71	Molybdenum import ATP-binding protein ModC	6.14e-14	NA	1.58e-10	0.7898
3. BF	Q5WDP1	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	5.61e-23	0.8155
3. BF	Q8ZH38	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	7.35e-28	0.8159
3. BF	Q8FBS3	Ribose import ATP-binding protein RbsA	2.10e-13	NA	8.86e-11	0.8139
3. BF	A0B344	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	3.14e-24	0.8383
3. BF	Q9X051	Ribose import ATP-binding protein RbsA 2	5.77e-13	NA	2.42e-17	0.79
3. BF	Q8FCE2	Xylose import ATP-binding protein XylG	6.37e-14	NA	8.36e-12	0.8325
3. BF	Q1BQ82	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	3.23e-13	NA	3.46e-11	0.7964
3. BF	Q92P76	Zinc import ATP-binding protein ZnuC	1.11e-16	NA	2.11e-15	0.7438
3. BF	Q9L1C3	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.39e-23	0.8132
3. BF	Q63H29	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	9.86e-24	0.8166
3. BF	Q7WFU9	Methionine import ATP-binding protein MetN	0.00e+00	NA	9.98e-28	0.8282
3. BF	P63356	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.28e-23	0.8191
3. BF	Q0T2X5	Galactose/methyl galactoside import ATP-binding protein MglA	2.70e-13	NA	1.09e-09	0.8053
3. BF	P63299	Galactofuranose transporter ATP-binding protein YtfR	8.35e-14	NA	4.61e-09	0.8231
3. BF	Q7VYN2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	5.55e-16	NA	1.04e-14	0.8189
3. BF	Q0B775	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	4.84e-13	NA	2.98e-12	0.7814
3. BF	Q0I348	Xylose import ATP-binding protein XylG	7.15e-14	NA	3.22e-12	0.8179
3. BF	Q0SY86	Xylose import ATP-binding protein XylG	7.75e-14	NA	1.04e-11	0.8292
3. BF	P44735	Ribose import ATP-binding protein RbsA	4.10e-13	NA	1.23e-10	0.7822
3. BF	P0AAG9	Galactose/methyl galactoside import ATP-binding protein MglA	1.54e-13	NA	1.00e-09	0.8071
3. BF	Q9KTJ5	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.85e-24	0.8158
3. BF	Q720Z5	Teichoic acids export ATP-binding protein TagH	3.10e-13	NA	8.10e-05	0.632
3. BF	A0K6Q0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	2.53e-13	NA	5.51e-10	0.813
3. BF	Q5KUX3	Ribose import ATP-binding protein RbsA	1.04e-13	NA	8.32e-11	0.8286
3. BF	Q83KP2	Arabinose import ATP-binding protein AraG	1.75e-13	NA	6.01e-13	0.8053
3. BF	Q5KVK2	Methionine import ATP-binding protein MetN	0.00e+00	NA	7.61e-24	0.8234
3. BF	Q0I5E9	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.09e-26	0.8228
3. BF	Q8R9L8	Putative ABC transporter ATP-binding protein TTE1589	6.92e-14	NA	4.33e-20	0.8084
3. BF	Q1GAN9	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.28e-20	0.8449
3. BF	Q8ELQ6	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	5.88e-25	0.8214
3. BF	A1UG51	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	7.25e-14	0.8278
3. BF	Q87H79	Ribose import ATP-binding protein RbsA	3.08e-13	NA	6.56e-09	0.7726
3. BF	Q63S19	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.66e-24	0.8121
3. BF	Q827Y0	Methionine import ATP-binding protein MetN	0.00e+00	NA	6.28e-25	0.816
3. BF	A0B1M7	Ribose import ATP-binding protein RbsA 2	3.33e-14	NA	1.31e-12	0.8147
3. BF	Q9CH26	Teichoic acids export ATP-binding protein TagH	3.86e-12	NA	8.41e-05	0.6452
3. BF	Q8D653	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	5.27e-19	0.8232
3. BF	Q21XK2	Methionine import ATP-binding protein MetN	0.00e+00	NA	6.47e-24	0.824
3. BF	Q2SVU4	Ribose import ATP-binding protein RbsA 1	7.62e-14	NA	7.42e-15	0.8117
3. BF	Q13FD9	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.90e-13	NA	1.56e-11	0.7816
3. BF	Q04B25	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.58e-20	0.8503
3. BF	Q579H8	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.60e-26	0.8625
3. BF	Q8UA86	Ribose import ATP-binding protein RbsA 1	1.21e-14	NA	5.15e-11	0.8192
3. BF	Q663Y5	Xylose import ATP-binding protein XylG	5.76e-14	NA	3.85e-13	0.8292
3. BF	Q8Z2R4	Ribose import ATP-binding protein RbsA	1.99e-13	NA	7.38e-12	0.8107
3. BF	Q8XDM1	Xylose import ATP-binding protein XylG	5.34e-14	NA	7.97e-12	0.8335
3. BF	Q14H97	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.37e-32	0.8296
3. BF	O32169	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.98e-21	0.8276
3. BF	Q8Z990	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	3.63e-24	0.8183
3. BF	Q0TFU2	Galactose/methyl galactoside import ATP-binding protein MglA	2.41e-13	NA	9.65e-10	0.7945
3. BF	Q2SY12	Methionine import ATP-binding protein MetN	0.00e+00	NA	7.21e-24	0.8443
3. BF	Q65E84	Teichoic acids export ATP-binding protein TagH	5.44e-15	NA	7.86e-06	0.6433
3. BF	Q66AF5	Arabinose import ATP-binding protein AraG	1.13e-13	NA	1.40e-11	0.8116
3. BF	Q1BG93	Xylose import ATP-binding protein XylG	9.80e-14	NA	2.01e-10	0.8113
3. BF	Q5WCL2	Teichoic acids export ATP-binding protein TagH	5.13e-13	NA	2.26e-09	0.6462
3. BF	A0PY57	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.82e-12	0.8282
3. BF	Q1CIX6	Arabinose import ATP-binding protein AraG	1.13e-13	NA	1.40e-11	0.8126
3. BF	Q1M5X4	Ribose import ATP-binding protein RbsA 2	8.44e-15	NA	1.73e-08	0.8264
3. BF	Q81ZF5	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	1.04e-28	0.8349
3. BF	Q110U3	Spermidine/putrescine import ATP-binding protein PotA	5.55e-16	NA	1.50e-10	0.8234
3. BF	Q398W2	Ribose import ATP-binding protein RbsA 2	3.67e-14	NA	6.00e-16	0.819
3. BF	Q3JSI8	Ribose import ATP-binding protein RbsA 1	6.29e-10	NA	1.28e-12	0.8239
3. BF	Q832Y6	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	2.94e-31	0.832
3. BF	Q8REE1	Galactose/methyl galactoside import ATP-binding protein MglA	1.20e-13	NA	2.10e-11	0.8036
3. BF	Q93D97	Putative ABC transporter ATP-binding protein SMU_1934c	4.81e-13	NA	2.79e-21	0.7626
3. BF	Q4A5Q4	Spermidine/putrescine import ATP-binding protein PotA	6.68e-09	NA	1.60e-06	0.8147
3. BF	C0SPB4	Uncharacterized ABC transporter ATP-binding protein YhaQ	0.00e+00	NA	1.03e-09	0.7867
3. BF	P42954	Teichoic acids export ATP-binding protein TagH	3.85e-11	NA	7.97e-05	0.6505
3. BF	Q5JEB0	Molybdate/tungstate import ATP-binding protein WtpC	1.44e-15	NA	1.62e-14	0.7756
3. BF	Q1BPL3	Ribose import ATP-binding protein RbsA 2	6.13e-14	NA	1.31e-12	0.8152
3. BF	Q13RB6	Xylose import ATP-binding protein XylG	1.81e-12	NA	4.19e-09	0.7872
3. BF	Q1CGT1	Galactose/methyl galactoside import ATP-binding protein MglA	4.28e-13	NA	7.75e-13	0.8016
3. BF	A0K5N5	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	3.42e-25	0.8159
3. BF	A2RI77	Dipeptide transport ATP-binding protein DppD	0.00e+00	NA	2.89e-12	0.7886
3. BF	Q9G4F5	Sulfate/thiosulfate import ATP-binding protein cysA	4.44e-16	NA	8.41e-16	0.8263
3. BF	Q8U4K3	Molybdate/tungstate import ATP-binding protein WtpC	1.22e-15	NA	1.85e-15	0.7592
3. BF	Q1CFH7	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	7.35e-28	0.8159
3. BF	Q9CK97	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.30e-21	0.819
3. BF	Q7VZE5	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	1.71e-15	0.8262
3. BF	H6TB12	Sophorolipid transporter	8.89e-07	NA	8.65e-22	0.7996
3. BF	Q0T810	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.45e-22	0.8192
3. BF	A0A095C325	ABC multidrug transporter MDR1	3.44e-06	NA	9.99e-17	0.7799
3. BF	Q6D1C4	Methionine import ATP-binding protein MetN 3	0.00e+00	NA	1.47e-27	0.8174
3. BF	Q3Z057	Galactose/methyl galactoside import ATP-binding protein MglA	2.21e-13	NA	1.00e-09	0.7958
3. BF	F2RP52	ABC multidrug transporter MDR2	1.90e-06	NA	3.57e-17	0.8003
3. BF	Q928L8	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	3.27e-24	0.8298
3. BF	Q8XVS2	Arabinose import ATP-binding protein AraG	1.55e-13	NA	6.48e-12	0.7922
3. BF	Q48J74	Xylose import ATP-binding protein XylG	9.76e-14	NA	1.31e-10	0.8157
3. BF	Q0TAW0	Ribose import ATP-binding protein RbsA	2.60e-13	NA	3.23e-11	0.8139
3. BF	Q6NJ07	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.49e-23	0.8606
3. BF	Q6AE21	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.67e-26	0.8609
3. BF	Q38WL5	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.78e-27	0.8137
3. BF	Q1GID1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	9.30e-15	0.8144
3. BF	Q9Y8G1	ABC multidrug transporter atrD	1.87e-05	NA	1.69e-20	0.7794
3. BF	A1TAI4	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	1.72e-13	0.8267
3. BF	Q21TR5	Putative ribose/galactose/methyl galactoside import ATP-binding protein	3.15e-13	NA	1.05e-10	0.8124
3. BF	Q66C83	Galactose/methyl galactoside import ATP-binding protein MglA	3.66e-13	NA	7.75e-13	0.8034
3. BF	Q81K31	Teichoic acids export ATP-binding protein TagH	1.71e-10	NA	0.004	0.6474
3. BF	Q8G5P8	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.64e-25	0.8494
3. BF	Q8FV85	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.60e-26	0.8611
3. BF	Q13LX0	Ribose import ATP-binding protein RbsA	3.02e-14	NA	4.98e-09	0.8267
3. BF	Q7WID6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	5.55e-16	NA	1.11e-14	0.8196
3. BF	Q88UV2	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	1.25e-24	0.8238
3. BF	Q39IE7	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	9.49e-26	0.8216
3. BF	Q0SSJ0	Ribose import ATP-binding protein RbsA	2.70e-13	NA	3.83e-10	0.8229
3. BF	Q4ZSF3	Xylose import ATP-binding protein XylG	9.02e-14	NA	1.02e-10	0.804
3. BF	Q8Z2X5	Autoinducer 2 import ATP-binding protein LsrA	1.18e-14	NA	4.87e-14	0.8038
3. BF	Q7UU57	Ribose import ATP-binding protein RbsA	9.30e-14	NA	1.13e-10	0.7843
3. BF	Q8Y003	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.32e-13	NA	3.47e-11	0.8121
3. BF	Q9K7C3	L-arabinose transport ATP-binding protein AraG	6.02e-13	NA	7.21e-14	0.8171
3. BF	Q7CFR2	Xylose import ATP-binding protein XylG	6.22e-14	NA	3.85e-13	0.8226
3. BF	Q1LQF6	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.66e-27	0.8206
3. BF	Q4QMH4	Methionine import ATP-binding protein MetN	0.00e+00	NA	4.71e-24	0.8151
3. BF	Q8A883	Spermidine/putrescine import ATP-binding protein PotA	2.54e-14	NA	2.38e-17	0.8211
3. BF	J9VF33	ABC multidrug transporter MDR1	3.47e-06	NA	8.35e-17	0.79
3. BF	Q1CAK4	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	7.35e-28	0.8156
3. BF	Q03P57	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.07e-30	0.8271
3. BF	Q4QP85	Fe(3+) ions import ATP-binding protein FbpC	7.77e-16	NA	2.44e-17	0.8174
3. BF	Q0BH79	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	1.45e-24	0.8214
3. BF	Q5X627	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.08e-17	0.8308
3. BF	Q0AGF4	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	2.47e-11	0.819
3. BF	Q1GHE5	Ribose import ATP-binding protein RbsA	6.88e-14	NA	2.80e-13	0.8132
3. BF	Q5WXF0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.26e-17	0.8297
3. BF	Q13LD8	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	6.63e-21	0.8459
3. BF	Q57T09	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	6.30e-25	0.8183
3. BF	Q87RS1	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.50e-26	0.8234
3. BF	Q7NA79	Ribose import ATP-binding protein RbsA	2.04e-13	NA	1.63e-15	0.8021
3. BF	Q73P93	Putative ABC transporter ATP-binding protein TDE_0906	7.36e-14	NA	1.08e-20	0.7983
3. BF	P63355	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.28e-23	0.818
3. BF	A2RKA7	Nucleoside import ATP-binding protein NupA	4.67e-14	NA	6.45e-18	0.8154
3. BF	Q880Z2	Xylose import ATP-binding protein XylG	1.33e-13	NA	1.83e-10	0.8133
3. BF	Q8F6Z1	Sulfate/thiosulfate import ATP-binding protein CysA	9.99e-16	NA	5.13e-16	0.8061
3. BF	Q8YDN0	Xylose import ATP-binding protein XylG	6.37e-13	NA	1.39e-10	0.8192
3. BF	Q4QN44	Ribose import ATP-binding protein RbsA	2.37e-13	NA	1.58e-10	0.7816
3. BF	Q6LR20	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	7.53e-14	0.8183
3. BF	Q39BJ8	Arabinose import ATP-binding protein AraG 2	1.19e-13	NA	6.61e-12	0.8104
3. BF	Q9KXJ6	Putative ABC transporter ATP-binding protein SCO2324	4.55e-11	NA	7.99e-24	0.7769
3. BF	Q4WTT9	ABC multidrug transporter mdr1	2.04e-06	NA	2.21e-17	0.8083
3. BF	Q043Y8	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.66e-22	0.8549
3. BF	Q71X09	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	5.56e-24	0.8472
3. BF	Q7CHQ3	Galactose/methyl galactoside import ATP-binding protein MglA	4.11e-13	NA	7.75e-13	0.796
3. BF	O57896	Molybdate/tungstate import ATP-binding protein WtpC	1.33e-15	NA	4.23e-15	0.7795
3. BF	Q2NUD6	Galactose/methyl galactoside import ATP-binding protein MglA	2.10e-13	NA	5.04e-13	0.8039
3. BF	Q0B6I6	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	2.08e-23	0.8453
3. BF	Q39GY8	Ribose import ATP-binding protein RbsA 1	2.93e-13	NA	9.92e-10	0.8111
3. BF	Q5PJE7	Autoinducer 2 import ATP-binding protein LsrA	1.30e-14	NA	5.56e-14	0.8125
3. BF	Q46Y69	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.26e-26	0.8193
3. BF	Q88ZJ6	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	3.83e-16	0.7897
4. PB	Q3IM24	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.81e-35	2.86e-37	NA
4. PB	Q8XZ72	Phosphate import ATP-binding protein PstB	0.00e+00	5.91e-34	3.80e-13	NA
4. PB	A0A0H3JXA3	Metal-staphylopine import system ATP-binding protein CntD	0.00e+00	6.69e-27	8.16e-16	NA
4. PB	O66646	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.06e-28	2.95e-20	NA
4. PB	Q168E3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.13e-19	6.80e-25	NA
4. PB	Q8FUU5	Zinc import ATP-binding protein ZnuC	2.22e-16	4.73e-03	7.40e-17	NA
4. PB	A0A0H2ZH52	Di/tripeptide transport ATP-binding protein DppF	0.00e+00	1.11e-04	5.41e-14	NA
4. PB	O59479	Putative ABC transporter ATP-binding protein PH1815	0.00e+00	7.43e-18	1.61e-22	NA
4. PB	Q8YBN6	Putative peptide import ATP-binding protein BMEII0863	0.00e+00	4.40e-03	2.09e-12	NA
4. PB	Q11DN5	Phosphate import ATP-binding protein PstB	0.00e+00	3.85e-16	7.07e-16	NA
4. PB	Q9HYT0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.64e-41	7.32e-37	NA
4. PB	Q7C1M3	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q1MAL7	Cytochrome c biogenesis ATP-binding export protein CcmA	5.44e-15	4.37e-21	4.37e-10	NA
4. PB	Q5LXJ3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.10e-19	5.13e-14	NA
4. PB	P47325	Oligopeptide transport ATP-binding protein OppD	9.99e-16	1.30e-05	4.12e-08	NA
4. PB	Q58283	Uncharacterized ABC transporter ATP-binding protein MJ0873	0.00e+00	2.70e-10	3.70e-25	NA
4. PB	P54592	Uncharacterized ABC transporter ATP-binding protein YhcH	0.00e+00	1.03e-02	3.13e-17	NA
4. PB	Q92QN0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.99e-25	1.45e-20	NA
4. PB	Q58663	Probable branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	4.17e-42	3.61e-17	NA
4. PB	Q2NSR0	Hemin import ATP-binding protein HmuV	0.00e+00	4.47e-33	1.58e-19	NA
4. PB	Q73HX8	Cytochrome c biogenesis ATP-binding export protein CcmA	8.88e-16	2.96e-21	1.86e-12	NA
4. PB	Q1IGM2	Taurine import ATP-binding protein TauB	0.00e+00	1.41e-28	6.64e-17	NA
4. PB	Q1JLH6	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q4L884	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.37e-19	8.86e-22	NA
4. PB	Q2JTU3	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.62e-32	1.38e-15	NA
4. PB	Q927N8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.45e-16	2.41e-19	NA
4. PB	Q0THB9	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q8FCM9	Nickel import ATP-binding protein NikE	0.00e+00	3.65e-26	1.29e-23	NA
4. PB	Q6G7A0	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q71WH7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.88e-16	1.05e-18	NA
4. PB	B1XG16	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.14e-28	2.64e-10	NA
4. PB	Q881U6	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.22e-24	9.53e-17	NA
4. PB	P35020	Probable ATP-dependent transporter ycf16	2.22e-16	3.25e-29	1.30e-12	NA
4. PB	Q3SVB5	Phosphate import ATP-binding protein PstB	0.00e+00	4.19e-25	4.28e-15	NA
4. PB	P44692	Zinc import ATP-binding protein ZnuC	0.00e+00	9.17e-14	1.19e-13	NA
4. PB	Q68W38	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.51e-27	1.21e-26	NA
4. PB	Q035B2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.62e-17	9.50e-19	NA
4. PB	Q8UC12	Cytochrome c biogenesis ATP-binding export protein CcmA	9.21e-15	6.47e-22	2.70e-10	NA
4. PB	Q0TBX9	Nickel import ATP-binding protein NikD	3.33e-16	1.49e-26	3.10e-12	NA
4. PB	Q62L74	Phosphate import ATP-binding protein PstB	0.00e+00	1.41e-24	1.71e-17	NA
4. PB	Q3KJQ7	Taurine import ATP-binding protein TauB	0.00e+00	1.78e-24	9.22e-14	NA
4. PB	Q8VQK6	Putative peptide import ATP-binding protein BruAb2_1033	0.00e+00	1.25e-04	6.55e-14	NA
4. PB	Q2FVR1	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	NA
4. PB	Q99S48	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q6XYT0	Phosphate import ATP-binding protein PstB	0.00e+00	5.63e-31	4.84e-11	NA
4. PB	Q7MMN0	Zinc import ATP-binding protein ZnuC	1.11e-13	1.20e-07	1.87e-22	NA
4. PB	Q60AB3	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	9.27e-18	8.41e-09	NA
4. PB	P21629	High-affinity branched-chain amino acid transport ATP-binding protein BraF	0.00e+00	3.78e-31	3.43e-16	NA
4. PB	Q9K8L5	Phosphate import ATP-binding protein PstB	0.00e+00	1.08e-25	1.42e-21	NA
4. PB	Q50801	Putative ABC transporter ATP-binding protein MTBMA_c05830	0.00e+00	7.62e-21	1.96e-22	NA
4. PB	Q5LUR8	Zinc import ATP-binding protein ZnuC	0.00e+00	7.19e-14	1.04e-18	NA
4. PB	Q1RAS6	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	Q9HML8	Phosphate import ATP-binding protein PstB 2	2.22e-16	1.71e-03	5.34e-15	NA
4. PB	P75356	Putative ABC transporter ATP-binding protein MG303 homolog	1.67e-15	1.37e-09	4.18e-08	NA
4. PB	Q5L3Q9	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	6.44e-19	4.45e-20	NA
4. PB	Q5HPF5	Phosphate import ATP-binding protein PstB	0.00e+00	1.33e-18	7.37e-20	NA
4. PB	Q8FIM7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.05e-23	5.46e-24	NA
4. PB	Q1JGL2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q7W148	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.06e-50	3.15e-39	NA
4. PB	Q0SVB6	Phosphate import ATP-binding protein PstB	0.00e+00	3.39e-36	5.16e-21	NA
4. PB	O84421	Probable metal transport system ATP-binding protein CT_416	0.00e+00	3.28e-31	1.87e-15	NA
4. PB	P0AAH1	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q48KI4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.49e-25	2.86e-26	NA
4. PB	P31548	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.63e-33	8.77e-18	NA
4. PB	P51241	Probable ATP-dependent transporter ycf16	5.55e-16	2.56e-28	1.70e-07	NA
4. PB	P9WQK8	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.15e-25	2.19e-13	NA
4. PB	Q7N3Q4	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.45e-21	1.56e-10	NA
4. PB	Q47F10	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.05e-30	1.76e-31	NA
4. PB	Q0BZD8	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.72e-44	1.26e-28	NA
4. PB	P0A194	High-affinity branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	7.87e-37	4.80e-18	NA
4. PB	Q818I7	Phosphate import ATP-binding protein PstB	0.00e+00	3.16e-31	5.80e-19	NA
4. PB	Q9RKQ4	Hemin import ATP-binding protein HmuV	0.00e+00	1.57e-24	1.49e-16	NA
4. PB	Q87Z03	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.14e-15	2.49e-09	NA
4. PB	Q5E4D8	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.35e-40	9.76e-13	NA
4. PB	Q1C0Q8	Hemin import ATP-binding protein HmuV	0.00e+00	1.06e-25	2.60e-23	NA
4. PB	Q57554	Uncharacterized ABC transporter ATP-binding protein MJ0089	0.00e+00	3.35e-33	1.94e-25	NA
4. PB	Q87RE5	Zinc import ATP-binding protein ZnuC	0.00e+00	8.31e-07	1.08e-18	NA
4. PB	Q8F6L8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.35e-33	3.98e-23	NA
4. PB	B7L6I2	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	P9WQL1	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.09e-31	4.68e-08	NA
4. PB	Q57399	Molybdate import ATP-binding protein MolC	0.00e+00	1.02e-24	6.05e-22	NA
4. PB	Q07LU3	Hemin import ATP-binding protein HmuV	0.00e+00	7.37e-21	2.79e-24	NA
4. PB	Q57HY8	Phosphate import ATP-binding protein PstB	0.00e+00	3.22e-33	1.48e-16	NA
4. PB	Q6GH27	Nickel import system ATP-binding protein NikD	0.00e+00	3.24e-42	5.70e-13	NA
4. PB	P0CZ37	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.57e-38	2.41e-17	NA
4. PB	Q3BV68	Phosphate import ATP-binding protein PstB	0.00e+00	3.34e-27	7.44e-16	NA
4. PB	Q2FW34	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	9.35e-26	6.92e-21	NA
4. PB	Q473H8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.01e-21	5.10e-21	NA
4. PB	Q1RK34	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.03e-25	1.61e-27	NA
4. PB	Q9I3N7	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	9.19e-19	1.15e-11	NA
4. PB	Q2YYM4	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.76e-25	4.49e-21	NA
4. PB	Q6HHI7	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	3.93e-26	2.30e-19	NA
4. PB	Q322E8	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	P37774	L-cystine transport system ATP-binding protein TcyN	0.00e+00	2.56e-37	3.77e-27	NA
4. PB	Q57QD7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.65e-24	5.49e-25	NA
4. PB	O86311	Multidrug efflux system ATP-binding protein Rv1218c	4.44e-16	2.66e-05	1.34e-05	NA
4. PB	Q4QLJ9	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	3.76e-18	6.18e-14	NA
4. PB	Q11SW8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.78e-23	3.01e-22	NA
4. PB	Q1QSE9	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.01e-31	2.63e-14	NA
4. PB	P47705	Putative ABC transporter ATP-binding protein MG467	0.00e+00	3.99e-02	5.66e-22	NA
4. PB	Q0SZJ3	Nickel import ATP-binding protein NikE	0.00e+00	2.56e-27	3.31e-22	NA
4. PB	Q9KZW2	Phosphate import ATP-binding protein PstB	0.00e+00	3.22e-35	1.30e-15	NA
4. PB	P0AAI1	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.17e-25	3.78e-15	NA
4. PB	Q5HDY7	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	P37313	Dipeptide transport ATP-binding protein DppF	0.00e+00	3.21e-04	5.88e-15	NA
4. PB	P32010	Daunorubicin/doxorubicin resistance ATP-binding protein DrrA	0.00e+00	1.06e-02	3.29e-15	NA
4. PB	P38046	Nitrate import ATP-binding protein NrtD	0.00e+00	1.78e-24	2.54e-16	NA
4. PB	A1ABP5	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	A1WXT0	Zinc import ATP-binding protein ZnuC	0.00e+00	2.09e-23	1.10e-14	NA
4. PB	Q70GD4	Hemin import ATP-binding protein HmuV	0.00e+00	1.70e-31	1.53e-19	NA
4. PB	P0AAH6	Peptide transport system ATP-binding protein SapD	0.00e+00	2.30e-04	7.49e-15	NA
4. PB	Q0K4I1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.52e-29	2.66e-34	NA
4. PB	Q63NR0	Hemin import ATP-binding protein HmuV	0.00e+00	2.92e-23	1.41e-08	NA
4. PB	Q88HL0	Nickel import ATP-binding protein NikE	0.00e+00	8.85e-26	4.71e-21	NA
4. PB	Q8Z9T1	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.58e-31	5.42e-14	NA
4. PB	Q7VCZ3	Phosphate import ATP-binding protein PstB	0.00e+00	1.47e-26	1.44e-12	NA
4. PB	B5YPZ7	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.96e-28	1.35e-10	NA
4. PB	Q135Z8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-20	3.55e-23	NA
4. PB	Q88XV1	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.35e-13	1.49e-17	NA
4. PB	Q1LNM0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	5.45e-16	7.41e-21	NA
4. PB	Q8XHV3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.97e-17	8.65e-18	NA
4. PB	Q31GF5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.43e-26	2.59e-23	NA
4. PB	Q9HYF9	Aliphatic sulfonates import ATP-binding protein SsuB 2	2.22e-16	3.81e-27	2.54e-15	NA
4. PB	Q48C94	Taurine import ATP-binding protein TauB	0.00e+00	1.19e-25	6.45e-16	NA
4. PB	Q7MJ01	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.60e-23	1.80e-26	NA
4. PB	Q58903	Uncharacterized ABC transporter ATP-binding protein MJ1508	0.00e+00	1.02e-28	2.27e-28	NA
4. PB	Q2L219	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.25e-22	1.76e-19	NA
4. PB	Q6N6K5	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.54e-15	1.42e-16	NA
4. PB	Q8UFV7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.37e-23	1.06e-19	NA
4. PB	Q6MMH0	Phosphate import ATP-binding protein PstB	0.00e+00	1.25e-40	1.17e-14	NA
4. PB	Q2VZJ1	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	4.70e-23	9.03e-09	NA
4. PB	P36638	Peptide transport system ATP-binding protein SapF	0.00e+00	3.36e-30	2.30e-08	NA
4. PB	P63352	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.03e-26	2.69e-10	NA
4. PB	P21630	High-affinity branched-chain amino acid transport ATP-binding protein BraG	0.00e+00	1.83e-26	1.38e-07	NA
4. PB	Q2KBP5	Biotin transport ATP-binding protein BioM	0.00e+00	1.98e-36	4.09e-10	NA
4. PB	Q07LQ4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.07e-14	5.45e-16	NA
4. PB	P9WQL7	Fluoroquinolones export ATP-binding protein Rv2688c	0.00e+00	7.23e-09	4.14e-26	NA
4. PB	Q57243	Uncharacterized ABC transporter ATP-binding protein HI_1272	0.00e+00	1.15e-33	4.89e-15	NA
4. PB	Q3Z300	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.05e-23	5.46e-24	NA
4. PB	Q88RL1	Zinc import ATP-binding protein ZnuC	0.00e+00	1.28e-10	5.27e-18	NA
4. PB	Q62J04	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.59e-20	4.70e-22	NA
4. PB	Q8UCM5	Hemin import ATP-binding protein HmuV	0.00e+00	1.15e-17	2.58e-14	NA
4. PB	Q6AM16	Phosphate import ATP-binding protein PstB	0.00e+00	1.97e-16	2.47e-14	NA
4. PB	Q8P8M1	Cytochrome c biogenesis ATP-binding export protein CcmA	4.22e-15	2.26e-11	4.77e-07	NA
4. PB	Q98DT6	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	2.58e-21	3.63e-21	NA
4. PB	P46341	Phosphate import ATP-binding protein PstB 2	0.00e+00	3.25e-29	3.81e-19	NA
4. PB	Q8NV47	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	NA
4. PB	P0A191	High-affinity branched-chain amino acid transport ATP-binding protein LivF	0.00e+00	8.86e-27	2.85e-11	NA
4. PB	Q1BHS6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.60e-21	2.38e-20	NA
4. PB	O30144	Molybdate/tungstate import ATP-binding protein WtpC	0.00e+00	6.14e-25	1.23e-16	NA
4. PB	Q839D4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.10e-15	2.66e-21	NA
4. PB	A0R4C0	Phosphate import ATP-binding protein PstB	0.00e+00	1.15e-32	1.50e-06	NA
4. PB	P24693	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	3.23e-30	3.87e-17	NA
4. PB	Q9EYM2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.67e-21	3.54e-22	NA
4. PB	Q12NL5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.17e-22	7.02e-22	NA
4. PB	Q8ZDX6	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	7.78e-26	2.07e-12	NA
4. PB	Q8U242	Phosphate import ATP-binding protein PstB	0.00e+00	6.23e-38	1.87e-16	NA
4. PB	Q31DV4	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.73e-29	1.16e-30	NA
4. PB	Q1GFI8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.95e-27	3.39e-22	NA
4. PB	Q3K506	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	2.50e-20	1.57e-21	NA
4. PB	Q2FTF8	Phosphate import ATP-binding protein PstB	0.00e+00	3.37e-32	9.72e-14	NA
4. PB	Q4ZV73	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.23e-24	3.08e-26	NA
4. PB	Q8E9I8	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.22e-37	1.61e-15	NA
4. PB	Q48IB9	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	4.81e-26	2.34e-14	NA
4. PB	A1U776	Zinc import ATP-binding protein ZnuC	0.00e+00	1.15e-12	5.98e-15	NA
4. PB	Q4QKQ9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.07e-26	1.43e-21	NA
4. PB	Q8NVB5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.69e-25	5.57e-21	NA
4. PB	O32188	Probable siderophore transport system ATP-binding protein YusV	0.00e+00	1.37e-22	5.22e-27	NA
4. PB	P45094	Dipeptide transport ATP-binding protein DppF	0.00e+00	7.84e-04	6.48e-13	NA
4. PB	Q82HA2	Putative ABC transporter ATP-binding protein SAV_3608	0.00e+00	3.22e-31	2.10e-14	NA
4. PB	Q7NNG3	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.35e-30	2.90e-14	NA
4. PB	Q6F1W4	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	8.31e-15	3.52e-11	NA
4. PB	P0A9X3	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	P0AAH7	Peptide transport system ATP-binding protein SapD	0.00e+00	2.30e-04	7.49e-15	NA
4. PB	Q00830	Probable ATP-dependent transporter ycf16	5.55e-16	2.96e-35	1.51e-09	NA
4. PB	Q1R4L0	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q8R7Y4	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.18e-21	1.80e-19	NA
4. PB	Q2YNH6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-21	3.30e-23	NA
4. PB	Q66AT7	Zinc import ATP-binding protein ZnuC	0.00e+00	6.62e-17	1.69e-16	NA
4. PB	Q3B3H7	Phosphate import ATP-binding protein PstB	0.00e+00	9.12e-22	5.71e-17	NA
4. PB	Q1C812	Zinc import ATP-binding protein ZnuC	0.00e+00	9.44e-17	1.48e-16	NA
4. PB	P0CZ29	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	NA
4. PB	Q1JBJ4	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q7Z991	ABC transporter domain-containing protein C20G4.01	1.63e-14	3.79e-08	2.23e-04	NA
4. PB	Q6GEL4	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.22e-19	1.36e-21	NA
4. PB	Q2FH57	Nickel import system ATP-binding protein NikD	0.00e+00	6.98e-41	2.69e-14	NA
4. PB	Q215F6	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	3.69e-21	1.97e-20	NA
4. PB	Q8YYE2	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.80e-35	5.86e-15	NA
4. PB	Q5SLN1	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-19	5.01e-13	NA
4. PB	Q1GH74	Phosphate import ATP-binding protein PstB	0.00e+00	5.28e-30	4.65e-16	NA
4. PB	Q3IS07	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.66e-15	3.30e-20	NA
4. PB	Q2LY16	Cobalt import ATP-binding protein CbiO	0.00e+00	2.61e-18	1.03e-14	NA
4. PB	Q0VTB6	Zinc import ATP-binding protein ZnuC	0.00e+00	1.32e-09	1.09e-12	NA
4. PB	Q7MIR0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.37e-18	6.16e-08	NA
4. PB	Q57CD8	Putative ABC transporter ATP-binding protein BruAb1_1365	3.33e-16	3.69e-36	8.22e-17	NA
4. PB	B5QVV9	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	8.54e-28	3.24e-10	NA
4. PB	P40735	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	6.32e-17	1.30e-16	NA
4. PB	Q7V7P0	Phosphate import ATP-binding protein PstB	0.00e+00	1.14e-27	9.14e-16	NA
4. PB	Q895Y0	Phosphate import ATP-binding protein PstB	0.00e+00	2.57e-40	3.01e-15	NA
4. PB	Q4L9P7	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.25e-53	5.15e-35	NA
4. PB	Q8A1M1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.53e-26	7.58e-21	NA
4. PB	Q3A558	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.27e-22	8.67e-22	NA
4. PB	P77279	Probable iron export ATP-binding protein FetA	0.00e+00	3.01e-29	3.67e-16	NA
4. PB	Q28QF9	Hemin import ATP-binding protein HmuV	1.11e-16	4.70e-24	3.75e-12	NA
4. PB	Q38YC2	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.17e-33	9.50e-10	NA
4. PB	Q12I82	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	1.39e-13	3.96e-11	NA
4. PB	Q49XI8	Phosphate import ATP-binding protein PstB	0.00e+00	1.75e-19	1.17e-18	NA
4. PB	Q81P94	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	4.55e-26	2.12e-19	NA
4. PB	Q3SQ65	Hemin import ATP-binding protein HmuV	0.00e+00	1.91e-23	1.90e-26	NA
4. PB	P0A2V9	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.22e-37	6.80e-19	NA
4. PB	Q8X8E3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.63e-23	1.07e-23	NA
4. PB	O31711	Uncharacterized ABC transporter ATP-binding protein YknY	0.00e+00	3.88e-27	7.14e-28	NA
4. PB	Q8RPP4	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	1.27e-17	1.74e-07	NA
4. PB	Q8NMK1	Phosphate import ATP-binding protein PstB	0.00e+00	9.52e-34	2.43e-06	NA
4. PB	B2U358	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	8.87e-28	5.69e-10	NA
4. PB	B5FJ99	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.03e-26	2.69e-10	NA
4. PB	P33593	Nickel import ATP-binding protein NikD	2.22e-16	1.22e-26	3.89e-12	NA
4. PB	Q5NN23	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.22e-30	5.30e-26	NA
4. PB	Q6G475	Hemin import ATP-binding protein HmuV	0.00e+00	1.00e-28	1.48e-15	NA
4. PB	Q31I88	Phosphate import ATP-binding protein PstB	0.00e+00	4.44e-21	7.33e-11	NA
4. PB	P44656	Uncharacterized ABC transporter ATP-binding protein HI_0354	1.11e-16	1.75e-28	1.57e-14	NA
4. PB	Q93DX8	Sulfate/thiosulfate import ATP-binding protein CysA (Fragment)	0.00e+00	8.17e-18	5.48e-18	NA
4. PB	Q58967	Putative ABC transporter ATP-binding protein MJ1572	9.44e-15	5.21e-28	3.10e-30	NA
4. PB	Q72PP0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.04e-32	4.11e-23	NA
4. PB	Q74L62	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.51e-16	5.55e-13	NA
4. PB	Q32EX7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.22e-23	1.01e-23	NA
4. PB	Q8ETV6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.85e-17	1.23e-17	NA
4. PB	Q0VL18	Phosphate import ATP-binding protein PstB	0.00e+00	1.32e-12	5.36e-19	NA
4. PB	Q2IWV8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.43e-20	5.14e-22	NA
4. PB	Q6WB51	Phosphate import ATP-binding protein PstB	0.00e+00	1.10e-18	2.58e-12	NA
4. PB	Q6F1N1	Phosphate import ATP-binding protein PstB	0.00e+00	7.92e-25	7.38e-14	NA
4. PB	Q03PY6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	4.56e-17	3.56e-14	NA
4. PB	A0KE71	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.52e-26	1.09e-17	NA
4. PB	Q8P2L5	Oligopeptide transport ATP-binding protein OppF	0.00e+00	8.78e-09	1.80e-20	NA
4. PB	P63361	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-27	4.10e-19	NA
4. PB	Q2G9A9	Cytochrome c biogenesis ATP-binding export protein CcmA	1.35e-14	1.25e-17	3.46e-08	NA
4. PB	Q97JB8	Putative ABC transporter ATP-binding protein CA_C1368	0.00e+00	1.88e-16	3.37e-22	NA
4. PB	A0B3E2	Hemin import ATP-binding protein HmuV	0.00e+00	3.21e-20	5.71e-12	NA
4. PB	P47545	Putative ABC transporter ATP-binding protein MG303	2.66e-15	2.17e-10	1.62e-07	NA
4. PB	Q3JHM1	Hemin import ATP-binding protein HmuV	0.00e+00	1.85e-23	1.41e-08	NA
4. PB	Q04CG8	Phosphonates import ATP-binding protein PhnC	0.00e+00	5.92e-52	1.74e-44	NA
4. PB	Q9ZKW3	Probable iron chelatin transport ATP-binding protein jhp_0821	0.00e+00	5.27e-33	7.63e-15	NA
4. PB	Q9A1G5	Probable ABC transporter ATP-binding protein SPy_0285/M5005_Spy0242	9.99e-16	1.59e-34	5.26e-06	NA
4. PB	P07821	Iron(3+)-hydroxamate import ATP-binding protein FhuC	0.00e+00	1.14e-21	1.83e-20	NA
4. PB	Q2JUA1	Phosphate import ATP-binding protein PstB 1	0.00e+00	4.60e-30	5.19e-19	NA
4. PB	Q2SNX4	Phosphate import ATP-binding protein PstB	0.00e+00	5.79e-16	2.06e-12	NA
4. PB	Q8TSA8	Phosphate import ATP-binding protein PstB	0.00e+00	2.09e-30	2.66e-15	NA
4. PB	Q82VL9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.49e-23	7.91e-24	NA
4. PB	Q4KFA2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.52e-22	3.66e-23	NA
4. PB	Q577J5	Putative peptide import ATP-binding protein BruAb2_0796	0.00e+00	2.24e-03	1.23e-11	NA
4. PB	Q1CJG3	Zinc import ATP-binding protein ZnuC	0.00e+00	9.44e-17	1.48e-16	NA
4. PB	P77268	Probable D,D-dipeptide transport ATP-binding protein DdpD	0.00e+00	1.03e-03	4.91e-19	NA
4. PB	Q3BTD3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.04e-19	5.97e-23	NA
4. PB	Q49ZE0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.08e-28	2.56e-19	NA
4. PB	Q32AY3	Hemin import ATP-binding protein HmuV	0.00e+00	3.93e-26	8.03e-20	NA
4. PB	Q1R155	Zinc import ATP-binding protein ZnuC	0.00e+00	3.31e-25	2.02e-18	NA
4. PB	O51236	Phosphate import ATP-binding protein PstB	0.00e+00	1.96e-34	1.12e-14	NA
4. PB	A2RI78	Dipeptide transport ATP-binding protein DppF	0.00e+00	3.86e-07	3.92e-16	NA
4. PB	Q8Y454	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.23e-16	1.46e-18	NA
4. PB	P0AAI0	Peptide transport system ATP-binding protein SapF	0.00e+00	1.71e-29	6.93e-10	NA
4. PB	Q1B3B4	Phosphate import ATP-binding protein PstB	0.00e+00	7.94e-33	2.38e-08	NA
4. PB	Q8ESM5	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	3.61e-51	2.14e-44	NA
4. PB	Q8YDJ8	Zinc import ATP-binding protein ZnuC	1.11e-16	1.84e-03	2.13e-14	NA
4. PB	Q8RHK9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	5.53e-16	2.12e-13	NA
4. PB	Q57855	Uncharacterized ABC transporter ATP-binding protein MJ0412	0.00e+00	8.71e-28	6.86e-16	NA
4. PB	Q45593	Probable peptide export ATP-binding protein YydI	3.33e-15	3.10e-20	6.22e-07	NA
4. PB	Q9X1Z1	Energy-coupling factor transporter ATP-binding protein EcfA1	4.44e-16	2.08e-20	2.95e-17	NA
4. PB	Q16BC5	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	2.69e-40	1.49e-35	NA
4. PB	Q99X73	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	Q31J97	Hemin import ATP-binding protein HmuV	0.00e+00	1.86e-30	1.34e-09	NA
4. PB	Q87EF4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.35e-21	3.41e-22	NA
4. PB	Q04DA7	Methionine import ATP-binding protein MetN 2	0.00e+00	6.75e-03	9.50e-28	NA
4. PB	Q3IL62	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.51e-25	1.55e-27	NA
4. PB	Q15TB1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.78e-29	1.22e-24	NA
4. PB	Q7UX73	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	2.64e-31	1.20e-25	NA
4. PB	Q65TB7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.85e-25	6.89e-22	NA
4. PB	P72477	Putative ABC transporter ATP-binding protein	0.00e+00	1.43e-29	5.09e-10	NA
4. PB	Q5M243	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	7.10e-19	5.13e-14	NA
4. PB	Q5WY52	Cytochrome c biogenesis ATP-binding export protein CcmA	7.77e-16	8.30e-18	1.24e-07	NA
4. PB	Q8FMN9	Phosphate import ATP-binding protein PstB	0.00e+00	2.34e-35	7.58e-05	NA
4. PB	Q50294	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.04e-19	1.41e-19	NA
4. PB	Q5WET8	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.92e-30	1.55e-14	NA
4. PB	Q5M5Z2	Methionine import ATP-binding protein MetN	0.00e+00	2.27e-04	2.18e-24	NA
4. PB	Q63JZ3	Taurine import ATP-binding protein TauB	0.00e+00	1.08e-28	9.31e-12	NA
4. PB	Q88HL1	Nickel import ATP-binding protein NikD	0.00e+00	4.61e-31	4.35e-13	NA
4. PB	Q8TYV9	Putative ABC transporter ATP-binding protein MK0182	0.00e+00	8.95e-15	4.68e-14	NA
4. PB	Q0HH38	Phosphate import ATP-binding protein PstB	0.00e+00	1.54e-25	1.36e-13	NA
4. PB	Q217B2	Hemin import ATP-binding protein HmuV	0.00e+00	1.49e-24	1.39e-24	NA
4. PB	Q2P3E1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.59e-21	6.35e-23	NA
4. PB	Q6CYU2	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	3.54e-22	5.09e-20	NA
4. PB	P57403	Zinc import ATP-binding protein ZnuC	0.00e+00	3.79e-26	4.98e-15	NA
4. PB	Q46ZA5	Phosphate import ATP-binding protein PstB	0.00e+00	5.83e-32	2.40e-13	NA
4. PB	Q7M9G3	Phosphate import ATP-binding protein PstB	0.00e+00	1.76e-27	1.44e-14	NA
4. PB	Q21PQ7	Zinc import ATP-binding protein ZnuC	2.22e-16	9.88e-17	1.40e-19	NA
4. PB	Q8RD07	Putative ABC transporter ATP-binding protein TTE0246	0.00e+00	1.29e-44	4.63e-20	NA
4. PB	Q47L96	Phosphate import ATP-binding protein PstB	0.00e+00	5.01e-37	4.36e-16	NA
4. PB	P76909	Uncharacterized ABC transporter ATP-binding protein YnjD	1.22e-15	1.98e-26	1.47e-09	NA
4. PB	Q8PVF6	Phosphate import ATP-binding protein PstB	0.00e+00	4.95e-27	2.77e-13	NA
4. PB	Q180A5	Phosphate import ATP-binding protein PstB	0.00e+00	3.16e-38	1.71e-17	NA
4. PB	Q3MBW2	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.02e-22	2.26e-17	NA
4. PB	Q3ILC5	Phosphate import ATP-binding protein PstB	0.00e+00	6.49e-25	3.74e-15	NA
4. PB	Q839D5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.95e-15	7.01e-21	NA
4. PB	Q0A9K1	Phosphate import ATP-binding protein PstB	0.00e+00	5.73e-20	9.42e-17	NA
4. PB	Q92GP5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.00e-26	5.41e-28	NA
4. PB	Q5HG40	Nickel import system ATP-binding protein NikD	0.00e+00	6.98e-41	2.69e-14	NA
4. PB	Q3YW48	Nickel import ATP-binding protein NikE	0.00e+00	4.08e-26	6.50e-24	NA
4. PB	Q93SS1	Hemin import ATP-binding protein HmuV	0.00e+00	9.39e-28	4.32e-21	NA
4. PB	Q3IWB5	Zinc import ATP-binding protein ZnuC	0.00e+00	5.08e-18	2.92e-21	NA
4. PB	Q5PCG9	Methionine import ATP-binding protein MetN 2	0.00e+00	3.05e-05	2.74e-27	NA
4. PB	Q9PJX9	Probable metal transport system ATP-binding protein TC_0697	0.00e+00	3.58e-32	9.27e-16	NA
4. PB	Q58488	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	2.07e-21	9.54e-27	NA
4. PB	P18813	Maltose/maltodextrin import ATP-binding protein MalK (Fragment)	0.00e+00	2.53e-07	1.26e-11	NA
4. PB	Q0WJE4	Thiamine import ATP-binding protein ThiQ	0.00e+00	1.40e-34	1.93e-17	NA
4. PB	P15031	Fe(3+) dicitrate transport ATP-binding protein FecE	0.00e+00	2.20e-35	1.68e-27	NA
4. PB	Q88KY4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.88e-24	5.79e-26	NA
4. PB	Q1BJA5	Hemin import ATP-binding protein HmuV	0.00e+00	3.21e-20	5.71e-12	NA
4. PB	B7MV91	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q4K441	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	2.05e-20	8.30e-22	NA
4. PB	Q3ZWN4	Phosphate import ATP-binding protein PstB	0.00e+00	1.06e-36	3.45e-18	NA
4. PB	Q7VMV4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.23e-22	1.28e-24	NA
4. PB	P36636	Peptide transport system ATP-binding protein SapD	0.00e+00	3.68e-04	1.44e-14	NA
4. PB	Q1C5N7	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.04e-22	3.72e-12	NA
4. PB	P0DTT6	Xylose/arabinose import ATP-binding protein XylG	0.00e+00	2.29e-26	1.35e-16	NA
4. PB	Q8YQ88	Putative ABC transporter ATP-binding protein alr3946	0.00e+00	1.45e-25	4.51e-24	NA
4. PB	P63369	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.16e-29	3.20e-13	NA
4. PB	Q8R7Y5	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.42e-17	4.55e-19	NA
4. PB	Q2IGQ6	Phosphate import ATP-binding protein PstB	0.00e+00	7.82e-30	3.30e-15	NA
4. PB	Q3YSK9	Zinc import ATP-binding protein ZnuC	0.00e+00	2.98e-30	1.34e-14	NA
4. PB	Q8G358	Cytochrome c biogenesis ATP-binding export protein CcmA	5.00e-15	4.46e-23	7.94e-14	NA
4. PB	Q7A5Q8	Nickel import system ATP-binding protein NikD	0.00e+00	5.77e-40	2.88e-14	NA
4. PB	Q0T3U8	Zinc import ATP-binding protein ZnuC	0.00e+00	5.97e-16	1.22e-17	NA
4. PB	Q6LU82	Phosphate import ATP-binding protein PstB 1	0.00e+00	8.83e-25	3.22e-16	NA
4. PB	Q2G7G7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.55e-27	2.85e-21	NA
4. PB	P0AAH3	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q46BM0	Phosphate import ATP-binding protein PstB	0.00e+00	2.67e-28	4.18e-15	NA
4. PB	Q0C1C3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.05e-26	4.53e-29	NA
4. PB	Q6GEL3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.08e-25	1.32e-21	NA
4. PB	Q9K619	Bacitracin export ATP-binding protein BceA	0.00e+00	2.40e-36	3.94e-20	NA
4. PB	Q38UU0	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	9.21e-15	1.52e-19	NA
4. PB	Q9KQE3	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	8.34e-17	1.23e-09	NA
4. PB	Q7VZ66	Phosphate import ATP-binding protein PstB	0.00e+00	4.35e-31	2.12e-12	NA
4. PB	Q8YEM5	Cytochrome c biogenesis ATP-binding export protein CcmA	6.00e-15	1.09e-23	8.03e-14	NA
4. PB	Q63H61	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.95e-16	7.38e-14	NA
4. PB	P0CZ42	Probable ABC transporter ATP-binding protein SpyM3_0208	1.09e-11	1.59e-34	5.26e-06	NA
4. PB	P47546	Putative ABC transporter ATP-binding protein MG304	0.00e+00	5.04e-23	2.44e-14	NA
4. PB	B1IPL8	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q7A088	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q92G36	Zinc import ATP-binding protein ZnuC	0.00e+00	2.16e-28	1.47e-12	NA
4. PB	Q8DGZ3	Phosphate import ATP-binding protein PstB	0.00e+00	7.36e-26	2.62e-18	NA
4. PB	Q47MA5	Hemin import ATP-binding protein HmuV	0.00e+00	1.05e-21	8.59e-21	NA
4. PB	Q3J8J2	Phosphate import ATP-binding protein PstB 2	0.00e+00	3.39e-21	7.30e-14	NA
4. PB	Q6LX68	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	5.17e-21	7.71e-22	NA
4. PB	Q1JII9	Methionine import ATP-binding protein MetN	0.00e+00	2.59e-02	1.33e-21	NA
4. PB	P44662	Probable iron transport system ATP-binding protein HI_0361	0.00e+00	2.77e-12	1.36e-25	NA
4. PB	Q89LP2	Methionine import ATP-binding protein MetN	0.00e+00	3.80e-03	3.90e-25	NA
4. PB	Q1J8E4	Methionine import ATP-binding protein MetN	0.00e+00	1.56e-02	2.87e-22	NA
4. PB	Q0SWH9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.41e-14	1.64e-21	NA
4. PB	Q3JYF4	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	8.54e-14	1.28e-15	NA
4. PB	Q2NU23	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.53e-26	1.41e-23	NA
4. PB	Q5H0W2	Cytochrome c biogenesis ATP-binding export protein CcmA	8.77e-15	3.13e-12	2.03e-07	NA
4. PB	P9WQK4	Uncharacterized ABC transporter ATP-binding protein MT0079	7.77e-16	6.22e-03	5.61e-23	NA
4. PB	Q5E6M2	Zinc import ATP-binding protein ZnuC 1	0.00e+00	2.02e-14	6.84e-18	NA
4. PB	Q98FA5	Thiamine import ATP-binding protein ThiQ	0.00e+00	4.42e-35	8.22e-11	NA
4. PB	Q1M7A6	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	4.43e-27	8.71e-16	NA
4. PB	Q48FT0	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.79e-20	2.96e-13	NA
4. PB	Q1J982	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.29e-18	5.11e-17	NA
4. PB	Q7NNW9	Putative ABC transporter ATP-binding protein gll0289	0.00e+00	1.11e-43	2.95e-13	NA
4. PB	Q5HVF4	Phosphate import ATP-binding protein PstB	0.00e+00	1.44e-36	7.59e-17	NA
4. PB	Q0S736	Phosphate import ATP-binding protein PstB	0.00e+00	2.90e-33	4.84e-06	NA
4. PB	Q7VR29	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.72e-17	1.87e-22	NA
4. PB	P9WQI5	Uncharacterized ABC transporter ATP-binding protein Rv2564	0.00e+00	1.90e-02	1.22e-24	NA
4. PB	Q13RD3	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.36e-18	2.29e-16	NA
4. PB	Q2FW35	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q045Z8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.48e-19	7.98e-14	NA
4. PB	Q8G7F4	Phosphate import ATP-binding protein PstB	0.00e+00	9.03e-35	4.83e-13	NA
4. PB	Q0VQQ0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.14e-21	2.96e-19	NA
4. PB	O34510	Fe(3+)-citrate import ATP-binding protein YfmF	0.00e+00	8.83e-25	5.24e-21	NA
4. PB	Q5YYR7	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	8.99e-25	8.87e-19	NA
4. PB	Q8FVM9	Nickel import ATP-binding protein NikD	0.00e+00	4.76e-33	1.30e-07	NA
4. PB	Q138A9	Hemin import ATP-binding protein HmuV	0.00e+00	1.35e-27	1.70e-26	NA
4. PB	Q2G2L1	Teichoic acids export ATP-binding protein TagH	4.26e-08	4.85e-13	6.08e-06	NA
4. PB	Q83J77	Nickel import ATP-binding protein NikE	0.00e+00	1.19e-26	1.39e-22	NA
4. PB	Q9K9G7	Formylaminopyrimidine import ATP-binding protein ThiZ	0.00e+00	7.37e-25	2.41e-09	NA
4. PB	Q8D3S8	Hemin import ATP-binding protein HmuV	0.00e+00	7.27e-34	2.57e-20	NA
4. PB	Q7U172	Phosphate import ATP-binding protein PstB 1	0.00e+00	5.83e-32	2.52e-08	NA
4. PB	Q823C4	Methionine import ATP-binding protein MetN	0.00e+00	2.28e-06	2.45e-20	NA
4. PB	Q8FUN3	Putative ATP-binding protein BRA1187/BS1330_II1178	0.00e+00	4.81e-26	9.68e-15	NA
4. PB	Q0S0X2	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	3.11e-19	6.94e-21	NA
4. PB	Q0BWF7	Cytochrome c biogenesis ATP-binding export protein CcmA	1.33e-15	6.03e-17	3.86e-07	NA
4. PB	Q39HM4	Phosphate import ATP-binding protein PstB	0.00e+00	1.85e-24	3.28e-16	NA
4. PB	Q5XBY6	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q0A8P9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.20e-24	2.03e-26	NA
4. PB	Q5HDY6	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	9.35e-26	6.92e-21	NA
4. PB	Q56993	Hemin import ATP-binding protein HmuV	0.00e+00	1.06e-25	2.60e-23	NA
4. PB	Q5FFC0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.70e-30	7.94e-23	NA
4. PB	A1BC20	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.42e-28	2.76e-13	NA
4. PB	Q73L25	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.69e-21	4.15e-11	NA
4. PB	Q71WT2	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.03e-23	1.86e-11	NA
4. PB	Q7A5Q9	Nickel import system ATP-binding protein NikE	0.00e+00	4.61e-40	9.40e-22	NA
4. PB	Q5WUF8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.86e-27	2.69e-25	NA
4. PB	Q6GH28	Nickel import system ATP-binding protein NikE	0.00e+00	2.30e-41	7.63e-22	NA
4. PB	Q6LQC0	Hemin import ATP-binding protein HmuV	0.00e+00	3.28e-31	1.83e-19	NA
4. PB	Q6LSC4	Phosphate import ATP-binding protein PstB 2	0.00e+00	5.45e-35	2.72e-13	NA
4. PB	Q8YNJ3	Phosphate import ATP-binding protein PstB 3	0.00e+00	2.57e-29	1.62e-18	NA
4. PB	Q32AQ2	Nickel import ATP-binding protein NikD	2.22e-16	5.55e-27	1.18e-12	NA
4. PB	Q88YK8	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.84e-29	2.63e-09	NA
4. PB	Q55740	Putative ABC transporter ATP-binding protein sll0385	0.00e+00	1.51e-17	2.88e-19	NA
4. PB	Q8TUR7	Phosphate import ATP-binding protein PstB	0.00e+00	6.23e-38	3.92e-15	NA
4. PB	Q9LZ98	ABC transporter I family member 20	9.79e-14	1.28e-07	0.045	NA
4. PB	Q81J16	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.54e-18	1.71e-17	NA
4. PB	Q8PK53	Cytochrome c biogenesis ATP-binding export protein CcmA	3.66e-15	2.95e-11	1.82e-07	NA
4. PB	Q7A471	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q4ZYK8	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	9.31e-45	2.83e-38	NA
4. PB	Q0T4R9	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	P49938	Iron(3+)-hydroxamate import ATP-binding protein FhuC	0.00e+00	8.53e-26	3.01e-27	NA
4. PB	P0A9R7	Cell division ATP-binding protein FtsE	0.00e+00	4.91e-35	2.82e-25	NA
4. PB	P94420	Petrobactin import ATP-binding protein YclP	0.00e+00	1.09e-36	5.92e-24	NA
4. PB	Q9XF19	ABC transporter I family member 21	8.88e-15	9.61e-11	8.95e-08	NA
4. PB	Q9ZCC4	Zinc import ATP-binding protein ZnuC	0.00e+00	7.48e-28	1.21e-10	NA
4. PB	D5AQY6	Nickel import ATP-binding protein NikO	0.00e+00	1.37e-40	6.84e-19	NA
4. PB	Q5FHB0	Zinc import ATP-binding protein ZnuC	1.11e-16	3.62e-28	4.16e-12	NA
4. PB	P80866	Vegetative protein 296	2.89e-15	2.29e-35	9.28e-08	NA
4. PB	Q8LEF6	ABC transporter I family member 11, chloroplastic	3.09e-14	7.69e-05	8.66e-07	NA
4. PB	Q46RX0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.63e-09	8.21e-09	NA
4. PB	P36879	Uncharacterized ABC transporter ATP-binding protein YadG	0.00e+00	1.61e-05	6.26e-15	NA
4. PB	Q2NHA1	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	1.49e-19	1.03e-24	NA
4. PB	Q53193	Probable peptide ABC transporter ATP-binding protein y4tR	0.00e+00	9.86e-04	1.16e-12	NA
4. PB	Q88R93	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.57e-20	9.21e-24	NA
4. PB	P0AAG0	Dipeptide transport ATP-binding protein DppD	0.00e+00	5.89e-03	2.37e-13	NA
4. PB	Q8GDV4	Phosphate import ATP-binding protein PstB (Fragment)	0.00e+00	1.44e-36	1.26e-17	NA
4. PB	Q8FCN0	Nickel import ATP-binding protein NikD	3.33e-16	9.03e-27	3.43e-12	NA
4. PB	Q8YDH1	Putative peptide import ATP-binding protein BMEII0205	0.00e+00	2.23e-05	2.24e-15	NA
4. PB	Q55196	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.85e-24	3.93e-16	NA
4. PB	Q3MA91	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.22e-30	2.59e-16	NA
4. PB	Q04BY7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.41e-18	2.97e-14	NA
4. PB	P96605	Uncharacterized ABC transporter ATP-binding protein YdbJ	0.00e+00	9.40e-04	3.68e-14	NA
4. PB	Q2JKC2	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.94e-33	4.98e-13	NA
4. PB	P77737	Oligopeptide transport ATP-binding protein OppF	0.00e+00	8.26e-06	9.96e-18	NA
4. PB	Q7CMM7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	NA
4. PB	P45769	Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ	0.00e+00	1.09e-27	5.12e-19	NA
4. PB	Q6KHL1	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	9.63e-23	9.21e-23	NA
4. PB	Q2S3A3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.77e-19	1.71e-23	NA
4. PB	O28882	Probable branched-chain amino acid transport ATP-binding protein LivF	0.00e+00	2.29e-29	9.48e-10	NA
4. PB	Q2NIT5	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	3.10e-17	6.33e-21	NA
4. PB	Q60350	Uncharacterized ABC transporter ATP-binding protein MJ0035	0.00e+00	1.01e-38	3.48e-13	NA
4. PB	Q890R3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.01e-15	8.65e-18	NA
4. PB	Q1R0Z6	Phosphonates import ATP-binding protein PhnC	0.00e+00	8.53e-27	1.33e-35	NA
4. PB	Q99UA2	Nickel import system ATP-binding protein NikD	0.00e+00	5.77e-40	2.88e-14	NA
4. PB	P0A2V8	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.22e-37	6.80e-19	NA
4. PB	Q0BV49	Cytochrome c biogenesis ATP-binding export protein CcmA	7.66e-15	1.66e-10	8.89e-09	NA
4. PB	Q7A1Z1	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	P0AAH5	Peptide transport system ATP-binding protein SapD	0.00e+00	2.30e-04	7.49e-15	NA
4. PB	Q0B697	Hemin import ATP-binding protein HmuV	0.00e+00	6.12e-21	2.97e-10	NA
4. PB	Q57PU4	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.03e-26	2.69e-10	NA
4. PB	Q1Q8K4	Phosphate import ATP-binding protein PstB	0.00e+00	4.46e-39	8.90e-13	NA
4. PB	Q927N9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.79e-17	1.89e-19	NA
4. PB	Q8EUF1	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	3.03e-22	1.69e-21	NA
4. PB	Q8FUW8	Putative peptide import ATP-binding protein BRA1094/BS1330_II1086	0.00e+00	1.25e-04	6.55e-14	NA
4. PB	Q1C0A2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.58e-31	5.42e-14	NA
4. PB	Q4K3K9	Phosphate import ATP-binding protein PstB	0.00e+00	2.25e-21	1.35e-13	NA
4. PB	P57030	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.49e-25	1.21e-20	NA
4. PB	P06611	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.14e-28	2.64e-10	NA
4. PB	Q2YXY2	Phosphate import ATP-binding protein PstB	0.00e+00	1.05e-21	5.74e-23	NA
4. PB	Q57FS7	Cytochrome c biogenesis ATP-binding export protein CcmA	5.66e-15	4.46e-23	7.94e-14	NA
4. PB	Q9PHQ1	Phosphate import ATP-binding protein PstB	0.00e+00	4.77e-36	1.04e-16	NA
4. PB	Q0I074	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	4.48e-15	3.52e-11	NA
4. PB	Q8Y455	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	6.76e-18	1.91e-19	NA
4. PB	P26905	Dipeptide transport ATP-binding protein DppD	0.00e+00	5.55e-06	6.11e-17	NA
4. PB	Q3JDJ6	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.42e-30	9.49e-15	NA
4. PB	Q57AC2	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-27	4.10e-19	NA
4. PB	Q13X01	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.46e-20	6.08e-23	NA
4. PB	Q2IF17	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.55e-26	3.48e-26	NA
4. PB	Q7MFE8	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.26e-20	6.83e-16	NA
4. PB	Q30YR3	Phosphate import ATP-binding protein PstB	0.00e+00	8.46e-30	1.43e-15	NA
4. PB	O67154	Phosphate import ATP-binding protein PstB	0.00e+00	1.64e-36	3.57e-16	NA
4. PB	Q5LI72	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.51e-25	6.89e-25	NA
4. PB	Q12ES3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.92e-21	5.04e-22	NA
4. PB	Q2IYS5	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	3.09e-22	4.97e-37	NA
4. PB	Q5F8K2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.72e-27	7.70e-23	NA
4. PB	O26236	Putative ABC transporter ATP-binding protein MTH_133	0.00e+00	1.39e-23	1.88e-23	NA
4. PB	Q50046	Phosphate import ATP-binding protein PstB	0.00e+00	5.53e-36	1.35e-05	NA
4. PB	P63378	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q4L691	Phosphate import ATP-binding protein PstB	0.00e+00	1.95e-18	2.69e-20	NA
4. PB	Q6YR39	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	1.67e-18	2.11e-20	NA
4. PB	Q8VQK7	Putative peptide import ATP-binding protein BruAb2_1034	0.00e+00	1.19e-04	9.97e-16	NA
4. PB	Q6LTL7	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-16	1.54e-19	5.66e-10	NA
4. PB	Q8XMP8	Phosphate import ATP-binding protein PstB	0.00e+00	3.39e-36	5.16e-21	NA
4. PB	B5BA33	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.47e-26	2.77e-10	NA
4. PB	Q7W8T0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.68e-23	1.99e-22	NA
4. PB	Q5H0G3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.59e-21	6.35e-23	NA
4. PB	Q578S8	Nickel import ATP-binding protein NikD	1.11e-16	6.74e-33	1.25e-07	NA
4. PB	Q63SP4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.59e-20	4.70e-22	NA
4. PB	Q28VN1	Zinc import ATP-binding protein ZnuC	0.00e+00	1.45e-21	7.57e-21	NA
4. PB	P33594	Nickel import ATP-binding protein NikE	0.00e+00	1.09e-26	7.36e-24	NA
4. PB	P0CZ38	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q7WK40	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.68e-23	1.99e-22	NA
4. PB	Q99S47	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.76e-25	4.58e-21	NA
4. PB	P24586	Polysialic acid transport ATP-binding protein KpsT	2.65e-08	4.12e-20	6.23e-05	NA
4. PB	Q8R9I2	Phosphate import ATP-binding protein PstB 2	0.00e+00	8.43e-40	1.74e-16	NA
4. PB	Q6MSQ1	Energy-coupling factor transporter ATP-binding protein EcfA1	1.11e-16	2.41e-03	1.09e-16	NA
4. PB	Q7U6R4	Phosphate import ATP-binding protein PstB	0.00e+00	8.38e-27	1.45e-14	NA
4. PB	B7N547	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q7A470	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.76e-25	4.58e-21	NA
4. PB	Q1AXT9	Phosphate import ATP-binding protein PstB	0.00e+00	1.97e-22	1.29e-16	NA
4. PB	Q329R2	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q1R5D9	Nickel import ATP-binding protein NikD	2.22e-16	1.49e-26	3.10e-12	NA
4. PB	Q0TMS8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	3.97e-17	8.65e-18	NA
4. PB	Q1CCI2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.58e-31	5.42e-14	NA
4. PB	P61481	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.83e-24	8.26e-25	NA
4. PB	Q1BG75	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.52e-26	1.09e-17	NA
4. PB	P0A9V1	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	3.23e-30	2.42e-15	NA
4. PB	Q48BP8	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.93e-22	1.40e-12	NA
4. PB	Q2J534	Phosphate import ATP-binding protein PstB	0.00e+00	1.36e-28	5.01e-15	NA
4. PB	Q1GTY0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.87e-24	1.69e-21	NA
4. PB	P42064	Oligopeptide transport ATP-binding protein AppD	0.00e+00	1.32e-05	6.21e-13	NA
4. PB	P0CZ31	Methionine import ATP-binding protein MetN	0.00e+00	1.90e-02	4.88e-21	NA
4. PB	P0A9V2	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	3.23e-30	2.42e-15	NA
4. PB	P45051	Oligopeptide transport ATP-binding protein OppF	0.00e+00	8.86e-05	1.65e-18	NA
4. PB	Q63A38	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.69e-24	7.82e-19	NA
4. PB	P9WQL5	Probable ribonucleotide transport ATP-binding protein mkl	0.00e+00	2.93e-02	1.59e-18	NA
4. PB	Q9HYG4	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	1.09e-19	3.06e-22	NA
4. PB	O05779	Cell division ATP-binding protein FtsE	0.00e+00	4.41e-40	4.32e-30	NA
4. PB	Q9A9P4	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	8.67e-25	6.90e-30	NA
4. PB	P0A192	High-affinity branched-chain amino acid transport ATP-binding protein LivF	0.00e+00	8.86e-27	2.85e-11	NA
4. PB	Q81VQ2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.07e-19	3.94e-17	NA
4. PB	Q89AJ0	Zinc import ATP-binding protein ZnuC	0.00e+00	7.41e-23	1.98e-23	NA
4. PB	Q7V1X3	Phosphate import ATP-binding protein PstB	0.00e+00	2.25e-26	1.96e-16	NA
4. PB	Q6G0V9	Cytochrome c biogenesis ATP-binding export protein CcmA	9.21e-15	1.20e-20	1.33e-10	NA
4. PB	B6I8R4	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q1CI46	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.48e-26	4.86e-23	NA
4. PB	P0CZ39	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q6G6W1	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	NA
4. PB	Q66FK0	Hemin import ATP-binding protein HmuV	0.00e+00	1.06e-25	2.60e-23	NA
4. PB	Q5FQN4	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-15	6.08e-12	1.63e-08	NA
4. PB	Q9Z8J5	Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355	0.00e+00	1.70e-33	1.04e-25	NA
4. PB	Q492R2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.12e-21	1.77e-19	NA
4. PB	Q0SIB7	Hemin import ATP-binding protein HmuV	0.00e+00	2.63e-14	1.86e-15	NA
4. PB	Q8DFQ4	Zinc import ATP-binding protein ZnuC	1.56e-13	1.20e-07	1.87e-22	NA
4. PB	P0AAH0	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q2YXY9	Nickel import system ATP-binding protein NikD	0.00e+00	1.53e-41	1.82e-13	NA
4. PB	Q03PY5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.40e-18	2.41e-16	NA
4. PB	Q3M4H5	Phosphate import ATP-binding protein PstB 5	0.00e+00	3.15e-35	5.69e-15	NA
4. PB	Q47087	Achromobactin transport ATP-binding protein CbrD	0.00e+00	2.47e-26	3.56e-27	NA
4. PB	Q7M8M4	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.06e-29	1.09e-34	NA
4. PB	Q6D4A8	Zinc import ATP-binding protein ZnuC	0.00e+00	1.51e-18	3.93e-17	NA
4. PB	Q71WH8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.55e-18	1.93e-19	NA
4. PB	Q1CFV9	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.97e-41	2.66e-38	NA
4. PB	Q12XW6	Phosphate import ATP-binding protein PstB	0.00e+00	2.41e-34	9.61e-18	NA
4. PB	Q2YZ26	Putative hemin import ATP-binding protein HrtA	0.00e+00	1.96e-28	2.13e-14	NA
4. PB	O54187	Putative ABC transporter ATP-binding protein SCO5958	0.00e+00	2.30e-22	8.29e-12	NA
4. PB	Q5Z0P5	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	1.14e-27	2.13e-09	NA
4. PB	B7US48	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q1GHY4	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-14	5.53e-12	1.49e-07	NA
4. PB	Q1B8U4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	4.43e-27	1.87e-18	NA
4. PB	Q48GL0	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-16	9.57e-14	8.93e-11	NA
4. PB	Q6GKG3	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.40e-55	4.56e-37	NA
4. PB	Q9XBG1	Phosphate import ATP-binding protein PstB	0.00e+00	1.66e-27	3.19e-12	NA
4. PB	Q2GFZ6	Zinc import ATP-binding protein ZnuC	2.22e-16	5.10e-31	6.28e-15	NA
4. PB	Q31ZH4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.33e-23	4.81e-24	NA
4. PB	Q12R52	Hemin import ATP-binding protein HmuV	0.00e+00	2.82e-28	6.91e-24	NA
4. PB	Q7W359	Hemin import ATP-binding protein HmuV	0.00e+00	4.14e-28	2.18e-20	NA
4. PB	Q0TBX8	Nickel import ATP-binding protein NikE	0.00e+00	3.65e-26	1.29e-23	NA
4. PB	Q04FM1	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.37e-16	4.20e-15	NA
4. PB	P9WQL8	Doxorubicin resistance ATP-binding protein DrrA	0.00e+00	8.55e-04	3.39e-09	NA
4. PB	A0KPH6	Zinc import ATP-binding protein ZnuC	1.11e-16	1.71e-12	8.78e-22	NA
4. PB	Q8FWP1	Putative peptide import ATP-binding protein BRA0405/BS1330_II0402	0.00e+00	3.56e-03	3.16e-12	NA
4. PB	Q668E1	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.04e-22	3.72e-12	NA
4. PB	P0C0E9	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	4.97e-19	8.45e-17	NA
4. PB	Q2SI12	Zinc import ATP-binding protein ZnuC 2	3.72e-12	1.02e-22	5.13e-14	NA
4. PB	Q2K396	Cytochrome c biogenesis ATP-binding export protein CcmA	6.00e-15	1.01e-20	1.52e-08	NA
4. PB	Q5XDV5	Probable ABC transporter ATP-binding protein M6_Spy0273	9.99e-16	1.59e-34	5.26e-06	NA
4. PB	P16679	Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL	1.11e-16	1.43e-30	2.24e-15	NA
4. PB	Q55195	Phosphate import ATP-binding protein PstB 2	0.00e+00	6.29e-29	1.97e-17	NA
4. PB	Q5XDU4	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.17e-08	2.01e-20	NA
4. PB	Q49ZD9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	5.57e-19	5.87e-18	NA
4. PB	Q39T41	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.66e-27	1.28e-29	NA
4. PB	Q1H377	Phosphate import ATP-binding protein PstB	0.00e+00	5.91e-34	3.85e-13	NA
4. PB	Q8YCN7	Nickel import ATP-binding protein NikE	0.00e+00	2.20e-31	4.69e-23	NA
4. PB	Q578S7	Nickel import ATP-binding protein NikE	0.00e+00	2.20e-31	4.69e-23	NA
4. PB	Q927Z7	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.16e-23	1.99e-11	NA
4. PB	Q2GJA5	Zinc import ATP-binding protein ZnuC	2.22e-16	1.68e-25	1.56e-12	NA
4. PB	Q4ZQZ7	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	2.69e-13	2.34e-11	NA
4. PB	Q73GK9	Zinc import ATP-binding protein ZnuC	0.00e+00	7.27e-34	2.69e-12	NA
4. PB	Q7NPP4	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.71e-27	3.08e-15	NA
4. PB	Q18K56	Phosphate import ATP-binding protein PstB	0.00e+00	1.63e-15	3.71e-15	NA
4. PB	P50980	Oligopeptide transport ATP-binding protein OppD	0.00e+00	9.71e-05	2.07e-16	NA
4. PB	Q7CIC2	Zinc import ATP-binding protein ZnuC	0.00e+00	9.44e-17	1.48e-16	NA
4. PB	Q0C0L5	Phosphate import ATP-binding protein PstB	0.00e+00	3.55e-28	7.52e-15	NA
4. PB	Q6FCW7	Phosphate import ATP-binding protein PstB	0.00e+00	4.35e-14	5.64e-17	NA
4. PB	Q2FYQ0	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	NA
4. PB	Q1D320	Phosphate import ATP-binding protein PstB	0.00e+00	4.80e-35	1.56e-10	NA
4. PB	Q1LFZ8	Cytochrome c biogenesis ATP-binding export protein CcmA 2	0.00e+00	5.25e-18	3.50e-10	NA
4. PB	Q5LBQ4	Phosphate import ATP-binding protein PstB	0.00e+00	1.82e-28	1.48e-13	NA
4. PB	Q5PBP5	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	2.69e-22	8.13e-06	NA
4. PB	Q3JYY5	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.14e-41	3.03e-17	NA
4. PB	Q576E0	Putative ATP-binding protein BruAb2_1123	0.00e+00	2.05e-26	7.02e-15	NA
4. PB	Q6G9I1	Nickel import system ATP-binding protein NikE	0.00e+00	1.50e-40	2.74e-21	NA
4. PB	Q5V0G3	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.27e-14	6.18e-17	NA
4. PB	Q66D26	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.97e-41	2.66e-38	NA
4. PB	Q5Z293	Phosphate import ATP-binding protein PstB	0.00e+00	1.41e-33	1.74e-06	NA
4. PB	O83078	Probable metal transport system ATP-binding protein TP_0035	0.00e+00	7.73e-32	8.87e-10	NA
4. PB	Q4QK92	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-34	1.47e-13	NA
4. PB	Q5E5I1	Hemin import ATP-binding protein HmuV	0.00e+00	1.13e-29	5.81e-21	NA
4. PB	Q1J6D1	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	O34979	Uncharacterized ABC transporter ATP-binding protein YvrO	0.00e+00	6.55e-30	3.92e-32	NA
4. PB	P07109	Histidine transport ATP-binding protein HisP	0.00e+00	2.04e-27	1.58e-14	NA
4. PB	Q13GD4	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	1.13e-19	4.16e-14	NA
4. PB	Q8EK40	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	3.32e-13	1.91e-09	NA
4. PB	Q8D3A0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.14e-26	1.64e-21	NA
4. PB	Q5NZT6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.42e-20	1.79e-20	NA
4. PB	Q7VLS9	Zinc import ATP-binding protein ZnuC	0.00e+00	8.70e-18	8.06e-13	NA
4. PB	P16677	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.62e-49	3.27e-33	NA
4. PB	Q8KFD6	Putative ABC transporter ATP-binding protein CT0391	0.00e+00	9.44e-17	2.53e-18	NA
4. PB	P0AAH4	Putrescine export system ATP-binding protein SapD	0.00e+00	2.30e-04	7.49e-15	NA
4. PB	Q8E2L2	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	8.54e-14	1.28e-15	NA
4. PB	Q6G9H4	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	NA
4. PB	Q6CYN3	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.84e-31	4.08e-13	NA
4. PB	Q5QU46	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.09e-23	3.51e-20	NA
4. PB	P0CZ30	Methionine import ATP-binding protein MetN	0.00e+00	1.90e-02	4.88e-21	NA
4. PB	Q8L1U3	Hemin import ATP-binding protein HmuV	0.00e+00	2.35e-30	2.88e-22	NA
4. PB	P71009	Putative ABC transporter ATP-binding protein AlbC	0.00e+00	6.12e-23	1.21e-09	NA
4. PB	Q5FMM1	Phosphonates import ATP-binding protein PhnC	0.00e+00	3.21e-54	3.75e-43	NA
4. PB	O06980	Uncharacterized ABC transporter ATP-binding protein YvcR	0.00e+00	1.35e-36	2.38e-22	NA
4. PB	Q3K198	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.16e-29	3.20e-13	NA
4. PB	Q8Z8R5	Methionine import ATP-binding protein MetN 2	0.00e+00	3.05e-05	2.45e-28	NA
4. PB	Q7N3S7	Hemin import ATP-binding protein HmuV	0.00e+00	1.21e-25	1.36e-19	NA
4. PB	Q1GL85	Zinc import ATP-binding protein ZnuC	0.00e+00	1.12e-15	3.84e-16	NA
4. PB	Q3AXX4	Phosphate import ATP-binding protein PstB	0.00e+00	4.14e-28	4.26e-16	NA
4. PB	P75355	Putative ABC transporter ATP-binding protein MG304 homolog	0.00e+00	7.61e-24	7.42e-11	NA
4. PB	Q604C1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.14e-20	2.50e-18	NA
4. PB	A0PXX7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.20e-21	4.19e-14	NA
4. PB	Q44613	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.59e-32	1.81e-15	NA
4. PB	Q8FVN0	Nickel import ATP-binding protein NikE	0.00e+00	1.76e-31	1.82e-23	NA
4. PB	Q28VL7	Thiamine import ATP-binding protein ThiQ	0.00e+00	5.72e-33	1.02e-20	NA
4. PB	Q67JX3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.09e-19	9.83e-14	NA
4. PB	P76027	Oligopeptide transport ATP-binding protein OppD	0.00e+00	3.37e-08	8.83e-11	NA
4. PB	Q1GC08	Phosphonates import ATP-binding protein PhnC	0.00e+00	3.76e-52	5.11e-45	NA
4. PB	Q9Z651	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	3.37e-20	5.83e-14	NA
4. PB	Q5M4F2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.15e-39	5.96e-16	NA
4. PB	Q8XNY7	Putative ABC transporter ATP-binding protein CPE0195	0.00e+00	3.72e-14	1.82e-21	NA
4. PB	Q87R20	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.07e-24	1.57e-24	NA
4. PB	Q9Z810	Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563	0.00e+00	5.48e-32	3.12e-14	NA
4. PB	Q92N13	Hemin import ATP-binding protein HmuV	0.00e+00	5.34e-27	3.59e-21	NA
4. PB	Q81V82	Petrobactin import ATP-binding protein FpuD	0.00e+00	1.87e-26	2.80e-29	NA
4. PB	Q13W55	Phosphate import ATP-binding protein PstB	0.00e+00	4.94e-25	7.91e-16	NA
4. PB	Q4ZQE3	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	2.34e-17	4.37e-14	NA
4. PB	Q07PZ0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.17e-23	6.14e-38	NA
4. PB	Q0TUN8	Energy-coupling factor transporter ATP-binding protein EcfA3	0.00e+00	4.68e-14	1.39e-21	NA
4. PB	O69051	Phosphite import ATP-binding protein PxtA	0.00e+00	4.71e-31	1.89e-38	NA
4. PB	Q6N7Y6	Hemin import ATP-binding protein HmuV	0.00e+00	1.75e-24	8.08e-24	NA
4. PB	Q5LR15	Cytochrome c biogenesis ATP-binding export protein CcmA	3.44e-15	1.76e-17	6.52e-08	NA
4. PB	Q8CRI7	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	4.75e-22	1.18e-20	NA
4. PB	Q8X5N2	Hemin import ATP-binding protein HmuV	0.00e+00	1.91e-25	3.75e-19	NA
4. PB	A5F1V0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.11e-30	4.94e-11	NA
4. PB	Q4ZZS2	Zinc import ATP-binding protein ZnuC	0.00e+00	1.47e-10	2.83e-18	NA
4. PB	Q2RZ08	Hemin import ATP-binding protein HmuV	0.00e+00	4.96e-24	7.44e-20	NA
4. PB	A0K739	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	2.38e-06	2.36e-20	NA
4. PB	Q8G195	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-21	3.30e-23	NA
4. PB	Q48CA0	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	7.82e-19	5.03e-22	NA
4. PB	Q3ATY5	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	6.71e-32	9.04e-23	NA
4. PB	P0A9T9	Uncharacterized ABC transporter ATP-binding protein YbbA	0.00e+00	4.59e-21	3.43e-21	NA
4. PB	Q98DW6	Taurine import ATP-binding protein TauB	0.00e+00	6.03e-25	3.89e-10	NA
4. PB	Q02QE8	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	2.89e-41	8.06e-37	NA
4. PB	Q4JXC5	Phosphate import ATP-binding protein PstB	0.00e+00	1.06e-32	2.72e-08	NA
4. PB	Q3YVL7	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	P18766	Oligopeptide transport ATP-binding protein AmiF	0.00e+00	7.87e-08	6.66e-18	NA
4. PB	Q89KN0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.93e-21	6.26e-22	NA
4. PB	Q48TC2	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.88e-28	3.12e-10	NA
4. PB	Q21XJ9	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	4.83e-16	1.86e-20	NA
4. PB	Q0I4A9	Zinc import ATP-binding protein ZnuC	9.15e-14	1.85e-11	6.65e-16	NA
4. PB	Q7MNI7	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.18e-27	7.40e-15	NA
4. PB	C0SP98	Putative oligopeptide transport ATP-binding protein YkfD	0.00e+00	1.39e-04	6.00e-19	NA
4. PB	P95487	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	8.07e-15	1.70e-12	NA
4. PB	Q3B276	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	2.91e-31	2.98e-24	NA
4. PB	Q0RKH4	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.11e-23	3.86e-16	NA
4. PB	Q3KDI1	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.91e-43	3.90e-33	NA
4. PB	Q4L885	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	6.06e-28	3.46e-16	NA
4. PB	A1B9H9	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	1.48e-25	8.93e-16	NA
4. PB	Q6G0L7	Phosphate import ATP-binding protein PstB	0.00e+00	1.64e-39	4.15e-13	NA
4. PB	Q88YN5	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.81e-44	8.08e-40	NA
4. PB	P0A2V4	Oligopeptide transport ATP-binding protein OppF	0.00e+00	9.49e-10	2.59e-19	NA
4. PB	D5ARH0	Biotin transport ATP-binding protein BioM	1.11e-16	1.38e-35	1.47e-05	NA
4. PB	P9WQK0	Uncharacterized ABC transporter ATP-binding protein MT1014	0.00e+00	2.72e-28	1.31e-25	NA
4. PB	Q2SXD1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.86e-21	8.77e-22	NA
4. PB	P57032	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.37e-20	2.65e-22	NA
4. PB	Q0AUL1	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	2.91e-21	2.06e-10	NA
4. PB	P57013	Capsule polysaccharide export ATP-binding protein CtrD	7.18e-13	4.51e-19	7.29e-06	NA
4. PB	P56344	Probable sulfate/thiosulfate import ATP-binding protein CysA	0.00e+00	2.16e-27	5.25e-16	NA
4. PB	Q82MV1	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	1.02e-16	6.41e-19	NA
4. PB	Q5P1F3	Phosphate import ATP-binding protein PstB	0.00e+00	8.09e-17	8.43e-16	NA
4. PB	Q2P3U8	Cytochrome c biogenesis ATP-binding export protein CcmA	5.66e-15	3.13e-12	2.03e-07	NA
4. PB	P9WQL9	Doxorubicin resistance ATP-binding protein DrrA	0.00e+00	8.55e-04	3.39e-09	NA
4. PB	Q87UN0	Zinc import ATP-binding protein ZnuC	0.00e+00	7.38e-10	1.53e-17	NA
4. PB	P23878	Ferric enterobactin transport ATP-binding protein FepC	0.00e+00	1.19e-28	6.26e-24	NA
4. PB	A0QFE1	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	8.47e-24	3.65e-20	NA
4. PB	Q2FER7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	9.35e-26	6.92e-21	NA
4. PB	P63362	Phosphate import ATP-binding protein PstB	0.00e+00	1.09e-27	4.10e-19	NA
4. PB	Q62K56	Aliphatic sulfonates import ATP-binding protein SsuB	1.11e-16	4.56e-05	2.31e-22	NA
4. PB	Q5PKW4	Phosphate import ATP-binding protein PstB	0.00e+00	9.27e-31	3.20e-17	NA
4. PB	Q1LPJ9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.23e-16	1.06e-22	NA
4. PB	P33982	Probable ABC transporter ATP-binding protein AZC_3926	0.00e+00	1.92e-13	1.23e-16	NA
4. PB	Q8YYE3	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.99e-39	1.98e-16	NA
4. PB	Q6MD10	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.37e-23	4.02e-23	NA
4. PB	Q0TIV6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.05e-23	5.46e-24	NA
4. PB	Q1D382	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.68e-29	1.06e-21	NA
4. PB	Q87U31	Phosphate import ATP-binding protein PstB 2	0.00e+00	6.87e-20	1.54e-13	NA
4. PB	Q2SPI3	Zinc import ATP-binding protein ZnuC 1	1.11e-16	1.49e-10	3.97e-13	NA
4. PB	P05529	Protein McbF	2.11e-15	5.39e-19	3.66e-05	NA
4. PB	P75552	Oligopeptide transport ATP-binding protein OppD	2.22e-15	2.32e-02	2.08e-08	NA
4. PB	Q83KR7	Zinc import ATP-binding protein ZnuC	0.00e+00	5.97e-16	1.22e-17	NA
4. PB	P0AAF6	Arginine transport ATP-binding protein ArtP	0.00e+00	3.02e-41	1.26e-21	NA
4. PB	Q1WSB9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.15e-17	2.21e-21	NA
4. PB	Q31BF6	Phosphate import ATP-binding protein PstB	0.00e+00	6.71e-26	1.11e-14	NA
4. PB	Q7UP21	Phosphate import ATP-binding protein PstB	0.00e+00	4.54e-24	5.20e-16	NA
4. PB	P0AAG3	Glutamate/aspartate import ATP-binding protein GltL	0.00e+00	2.13e-38	3.81e-19	NA
4. PB	P0C0E8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	6.55e-19	8.54e-17	NA
4. PB	Q5X6P7	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	1.08e-17	2.82e-07	NA
4. PB	A3DJK5	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.88e-16	2.21e-22	NA
4. PB	Q3IZT1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.27e-23	1.19e-22	NA
4. PB	Q166A0	Phosphate import ATP-binding protein PstB	0.00e+00	1.18e-30	7.02e-16	NA
4. PB	Q2W8B4	Phosphate import ATP-binding protein PstB 1	0.00e+00	9.62e-29	3.92e-16	NA
4. PB	F8DT93	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.92e-24	5.47e-22	NA
4. PB	A0ALT7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	5.62e-16	2.14e-19	NA
4. PB	A0PXX8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.09e-13	4.69e-14	NA
4. PB	A0A0H2ZGN6	Di/tripeptide transport ATP-binding protein DppD	0.00e+00	5.58e-03	4.78e-15	NA
4. PB	Q93SH7	Hemin import ATP-binding protein HmuV	0.00e+00	2.04e-27	7.76e-28	NA
4. PB	Q080S4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.33e-21	1.44e-19	NA
4. PB	Q81J15	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	3.11e-16	1.27e-16	NA
4. PB	Q7U0Z9	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.15e-25	2.19e-13	NA
4. PB	Q8RLB6	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	5.65e-27	3.60e-14	NA
4. PB	Q8FWP2	Putative peptide import ATP-binding protein BRA0404/BS1330_II0401	0.00e+00	3.60e-05	1.43e-16	NA
4. PB	P9WQK5	Uncharacterized ABC transporter ATP-binding protein Rv0073	8.88e-16	6.22e-03	5.61e-23	NA
4. PB	Q160G4	Hemin import ATP-binding protein HmuV	1.11e-16	2.87e-26	1.30e-14	NA
4. PB	Q5QXD0	Hemin import ATP-binding protein HmuV	0.00e+00	9.53e-26	1.10e-13	NA
4. PB	Q221H2	Phosphate import ATP-binding protein PstB	0.00e+00	8.07e-28	2.28e-14	NA
4. PB	Q8KZQ6	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.98e-20	6.68e-23	NA
4. PB	Q5X2Z8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.19e-25	6.93e-26	NA
4. PB	Q5E3S7	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	3.11e-19	2.19e-12	NA
4. PB	Q49588	Phosphate import ATP-binding protein PstB	1.11e-16	4.26e-20	4.66e-17	NA
4. PB	Q7A3X3	Putative hemin import ATP-binding protein HrtA	0.00e+00	7.20e-29	1.86e-15	NA
4. PB	P75370	Probable ABC transporter ATP-binding protein p29	0.00e+00	1.37e-56	1.24e-35	NA
4. PB	Q8Y0C6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.54e-20	1.67e-22	NA
4. PB	Q3Z2L6	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	Q9A6Z7	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	1.65e-28	1.65e-28	NA
4. PB	Q5WCI1	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	8.53e-27	2.10e-16	NA
4. PB	Q634R8	Phosphate import ATP-binding protein PstB	0.00e+00	4.61e-31	6.36e-19	NA
4. PB	P9WQL0	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.09e-31	4.68e-08	NA
4. PB	Q4ZLA7	Phosphate import ATP-binding protein PstB 2	0.00e+00	5.72e-21	2.70e-13	NA
4. PB	Q58664	Probable branched-chain amino acid transport ATP-binding protein LivF	0.00e+00	6.58e-32	3.41e-13	NA
4. PB	Q68Y13	Zinc import ATP-binding protein ZnuC	0.00e+00	4.00e-26	1.63e-10	NA
4. PB	Q9ZB70	Putative ABC transporter ATP-binding protein MG468.1	0.00e+00	1.22e-08	8.72e-14	NA
4. PB	Q2A4V5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.70e-30	2.05e-21	NA
4. PB	Q6LQ77	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	6.05e-29	3.37e-13	NA
4. PB	Q7N8V0	Thiamine import ATP-binding protein ThiQ	0.00e+00	9.16e-33	3.51e-16	NA
4. PB	P9WQK9	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.15e-25	2.19e-13	NA
4. PB	Q2YQP3	Putative ABC transporter ATP-binding protein BAB1_1388	4.11e-15	3.69e-36	8.22e-17	NA
4. PB	Q2YL69	Nickel import ATP-binding protein NikE	0.00e+00	2.20e-31	4.69e-23	NA
4. PB	B7NTS2	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	P69878	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	NA
4. PB	Q3K9F9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.93e-22	5.17e-23	NA
4. PB	Q6HDP8	Phosphate import ATP-binding protein PstB	0.00e+00	4.61e-31	6.36e-19	NA
4. PB	Q6G3A6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.38e-25	9.09e-23	NA
4. PB	Q4FQ27	Zinc import ATP-binding protein ZnuC	4.00e-15	6.18e-28	9.49e-18	NA
4. PB	Q1R597	Hemin import ATP-binding protein HmuV	0.00e+00	2.29e-26	4.75e-20	NA
4. PB	Q5PIA5	Zinc import ATP-binding protein ZnuC	0.00e+00	1.10e-16	2.76e-18	NA
4. PB	Q2RU16	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	1.09e-22	3.36e-22	NA
4. PB	Q0ASG3	Phosphate import ATP-binding protein PstB	0.00e+00	8.62e-30	2.79e-14	NA
4. PB	Q0HJG0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.70e-23	1.10e-23	NA
4. PB	Q5HJM6	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	Q62A98	Hemin import ATP-binding protein HmuV	0.00e+00	2.92e-23	1.41e-08	NA
4. PB	Q6D645	Hemin import ATP-binding protein HmuV	0.00e+00	1.69e-27	1.13e-21	NA
4. PB	Q2YJJ9	Putative peptide import ATP-binding protein BAB2_1052	0.00e+00	1.25e-04	6.55e-14	NA
4. PB	Q6D664	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.89e-29	5.46e-24	NA
4. PB	P45275	Uncharacterized ABC transporter ATP-binding protein HI_1618	0.00e+00	4.56e-17	2.03e-07	NA
4. PB	Q2FZZ2	Methionine import ATP-binding protein MetN 2	0.00e+00	2.03e-02	3.31e-25	NA
4. PB	Q659V4	Hemin import ATP-binding protein HmuV	0.00e+00	3.78e-31	3.39e-20	NA
4. PB	Q3IM36	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.62e-22	7.34e-19	NA
4. PB	Q2S081	Phosphate import ATP-binding protein PstB	0.00e+00	2.28e-38	4.20e-15	NA
4. PB	Q0TMS7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.75e-21	1.19e-08	NA
4. PB	O34392	ABC transporter ATP-binding protein YtrE	0.00e+00	6.17e-29	5.52e-29	NA
4. PB	Q5E3B8	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.37e-25	1.37e-19	NA
4. PB	Q5XDS8	Methionine import ATP-binding protein MetN	0.00e+00	2.05e-02	1.10e-21	NA
4. PB	Q13IS7	Taurine import ATP-binding protein TauB 3	0.00e+00	1.54e-25	2.88e-14	NA
4. PB	Q5JEP9	Phosphate import ATP-binding protein PstB	0.00e+00	2.28e-38	7.35e-14	NA
4. PB	Q4FQD1	Phosphate import ATP-binding protein PstB	0.00e+00	2.82e-40	1.58e-13	NA
4. PB	Q576K0	Zinc import ATP-binding protein ZnuC	1.11e-16	9.76e-03	4.17e-16	NA
4. PB	Q89VF2	Phosphate import ATP-binding protein PstB	0.00e+00	1.36e-26	3.65e-14	NA
4. PB	Q0I3C2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.06e-24	2.78e-24	NA
4. PB	Q9V1Q4	Putative ABC transporter ATP-binding protein PYRAB03730	0.00e+00	9.01e-21	1.25e-20	NA
4. PB	P24136	Oligopeptide transport ATP-binding protein OppD	0.00e+00	4.06e-02	5.98e-15	NA
4. PB	Q5NHP2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.70e-30	2.05e-21	NA
4. PB	Q9C9W0	ABC transporter I family member 17	0.00e+00	4.64e-26	4.46e-17	NA
4. PB	Q2RQQ0	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	2.47e-26	3.20e-25	NA
4. PB	P0A9S7	High-affinity branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	2.11e-37	3.65e-19	NA
4. PB	Q24PY8	Phosphate import ATP-binding protein PstB	0.00e+00	3.22e-35	4.45e-14	NA
4. PB	Q748K0	Putative ABC transporter ATP-binding protein GSU3001	0.00e+00	2.92e-15	2.21e-17	NA
4. PB	Q5PGR6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.83e-24	8.26e-25	NA
4. PB	Q3BSL0	Cytochrome c biogenesis ATP-binding export protein CcmA	4.88e-15	9.37e-12	1.04e-07	NA
4. PB	Q885N4	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	6.22e-17	1.74e-14	NA
4. PB	Q7N545	Zinc import ATP-binding protein ZnuC	0.00e+00	1.39e-14	2.50e-16	NA
4. PB	Q0IAC3	Phosphate import ATP-binding protein PstB	0.00e+00	8.38e-26	7.04e-15	NA
4. PB	P9WQL6	Fluoroquinolones export ATP-binding protein MT2762	0.00e+00	9.05e-08	5.59e-26	NA
4. PB	Q1DCP5	Hemin import ATP-binding protein HmuV	0.00e+00	7.50e-26	3.94e-18	NA
4. PB	Q9KFL0	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.76e-50	2.18e-38	NA
4. PB	Q9AE30	Hemin import ATP-binding protein HmuV	2.22e-16	3.25e-25	2.24e-16	NA
4. PB	Q9CIQ6	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.42e-57	3.72e-45	NA
4. PB	Q5HM28	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	2.83e-22	7.60e-21	NA
4. PB	P42065	Oligopeptide transport ATP-binding protein AppF	0.00e+00	2.14e-05	1.91e-19	NA
4. PB	A1B9K8	Zinc import ATP-binding protein ZnuC	0.00e+00	4.22e-15	7.68e-20	NA
4. PB	Q31I51	Zinc import ATP-binding protein ZnuC	0.00e+00	6.25e-22	5.48e-21	NA
4. PB	Q6G799	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.69e-25	5.57e-21	NA
4. PB	Q3MH62	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.50e-28	1.13e-17	NA
4. PB	Q8X5U1	Nickel import ATP-binding protein NikD	3.33e-16	5.34e-27	4.84e-12	NA
4. PB	Q5LUD0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.60e-24	8.67e-22	NA
4. PB	Q9M0D0	ABC transporter E family member 3	2.05e-10	6.67e-10	6.72e-06	NA
4. PB	Q6D654	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.47e-26	1.21e-13	NA
4. PB	Q74DN5	Putative ABC transporter ATP-binding protein GSU1281	0.00e+00	3.02e-35	9.69e-21	NA
4. PB	P45247	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.07e-26	1.43e-21	NA
4. PB	Q2YJB5	Putative ATP-binding protein BAB2_1147	0.00e+00	4.81e-26	9.68e-15	NA
4. PB	Q035E0	Phosphonates import ATP-binding protein PhnC	0.00e+00	8.30e-50	2.98e-34	NA
4. PB	Q5ZX76	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	1.08e-17	2.82e-07	NA
4. PB	Q2SB47	Hemin import ATP-binding protein HmuV	0.00e+00	1.46e-32	8.56e-23	NA
4. PB	Q6MMY0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.93e-24	6.66e-25	NA
4. PB	Q8KDZ5	Phosphate import ATP-binding protein PstB	0.00e+00	4.12e-20	9.64e-16	NA
4. PB	P0A2U7	Zinc transport system ATP-binding protein AdcC	9.99e-16	4.48e-32	1.05e-18	NA
4. PB	Q1QLB0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.29e-21	1.18e-22	NA
4. PB	Q1IGY7	Zinc import ATP-binding protein ZnuC	0.00e+00	1.61e-10	1.38e-18	NA
4. PB	Q8H1R4	ABC transporter I family member 10	0.00e+00	8.95e-15	1.17e-15	NA
4. PB	Q6XYZ3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.50e-15	1.01e-15	NA
4. PB	P63366	Phosphate import ATP-binding protein PstB	0.00e+00	9.27e-31	3.20e-17	NA
4. PB	Q11JI6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.37e-22	4.51e-19	NA
4. PB	P94411	Uncharacterized ABC transporter ATP-binding protein YclH	0.00e+00	1.69e-34	1.95e-21	NA
4. PB	Q6GCY2	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	P45032	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	2.29e-18	2.39e-15	NA
4. PB	P0AAH2	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q0S6U9	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.19e-25	1.91e-18	NA
4. PB	Q0BUR6	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.77e-26	1.92e-21	NA
4. PB	P10346	Glutamine transport ATP-binding protein GlnQ	0.00e+00	4.76e-39	3.73e-29	NA
4. PB	Q65UG3	Zinc import ATP-binding protein ZnuC	5.57e-13	1.71e-12	7.41e-14	NA
4. PB	Q2W450	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.55e-26	1.06e-23	NA
4. PB	P0A9T8	Uncharacterized ABC transporter ATP-binding protein YbbA	0.00e+00	4.59e-21	3.43e-21	NA
4. PB	P61482	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.83e-24	8.26e-25	NA
4. PB	Q9KSL1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	6.55e-30	1.02e-11	NA
4. PB	Q1GUY1	Phosphate import ATP-binding protein PstB	0.00e+00	3.17e-32	1.47e-11	NA
4. PB	Q8FH28	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q0I2G0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.65e-22	3.96e-14	NA
4. PB	Q2FYQ8	Nickel import system ATP-binding protein NikE	0.00e+00	1.88e-40	7.71e-22	NA
4. PB	Q81C68	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.55e-24	7.03e-22	NA
4. PB	Q8KF76	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	7.05e-22	2.48e-25	NA
4. PB	Q2RM86	Phosphate import ATP-binding protein PstB	0.00e+00	4.59e-37	4.71e-19	NA
4. PB	Q9TLX1	Probable ATP-dependent transporter ycf16	1.11e-16	2.92e-30	6.10e-09	NA
4. PB	Q20ZP0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	8.73e-31	2.79e-37	NA
4. PB	Q9PPV1	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.77e-18	1.83e-15	NA
4. PB	Q6N999	Lipoprotein-releasing system ATP-binding protein LolD 1	0.00e+00	2.68e-29	2.61e-24	NA
4. PB	Q8P2K6	Methionine import ATP-binding protein MetN	0.00e+00	1.30e-02	2.16e-21	NA
4. PB	Q20ZS6	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	1.31e-24	3.96e-24	NA
4. PB	Q8TIX0	Putative ABC transporter ATP-binding protein MA_4020	0.00e+00	1.64e-11	2.65e-21	NA
4. PB	O34697	Bacitracin export ATP-binding protein BceA	0.00e+00	2.64e-32	1.00e-22	NA
4. PB	Q5HG41	Nickel import system ATP-binding protein NikE	0.00e+00	1.88e-40	7.71e-22	NA
4. PB	Q5FM18	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.01e-29	1.17e-07	NA
4. PB	Q6G4Q8	Putative ABC transporter ATP-binding protein BH02760	0.00e+00	2.34e-43	1.93e-10	NA
4. PB	A0ALT6	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.05e-17	7.54e-19	NA
4. PB	Q1IMC7	Phosphate import ATP-binding protein PstB	0.00e+00	5.72e-33	5.94e-17	NA
4. PB	Q0SNU4	Phosphate import ATP-binding protein PstB	0.00e+00	2.57e-33	4.61e-15	NA
4. PB	Q3YW49	Nickel import ATP-binding protein NikD	3.33e-16	1.98e-26	5.89e-12	NA
4. PB	P97027	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	2.87e-27	1.17e-17	NA
4. PB	Q1JEC8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.97e-19	8.45e-17	NA
4. PB	P45052	Oligopeptide transport ATP-binding protein OppD	0.00e+00	1.07e-06	1.09e-10	NA
4. PB	Q73YZ5	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	8.47e-24	3.65e-20	NA
4. PB	Q981Y8	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	2.61e-25	3.49e-14	NA
4. PB	Q1GMA8	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.20e-49	5.59e-34	NA
4. PB	Q8EB59	Hemin import ATP-binding protein HmuV	0.00e+00	1.16e-29	7.29e-21	NA
4. PB	Q8YGM0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-21	3.30e-23	NA
4. PB	Q0BN75	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.17e-29	7.61e-21	NA
4. PB	Q9X0Y8	Phosphate import ATP-binding protein PstB	0.00e+00	1.84e-39	1.48e-19	NA
4. PB	Q74KF9	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.13e-26	8.56e-08	NA
4. PB	P0AAG2	Dipeptide transport ATP-binding protein DppD	0.00e+00	5.89e-03	2.37e-13	NA
4. PB	O31723	Uncharacterized ABC transporter ATP-binding protein YlmA	0.00e+00	9.42e-24	7.56e-14	NA
4. PB	Q72D73	Putative ABC transporter ATP-binding protein DVU_1056	1.11e-16	3.81e-15	1.11e-12	NA
4. PB	Q4ZTG9	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	3.14e-26	1.55e-12	NA
4. PB	Q9XDA6	Zinc uptake system ATP-binding protein ZurA	0.00e+00	1.46e-34	5.79e-29	NA
4. PB	Q1J255	Hemin import ATP-binding protein HmuV	0.00e+00	2.43e-26	1.29e-13	NA
4. PB	Q6LPK2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.10e-24	2.38e-21	NA
4. PB	Q2FED7	Putative hemin import ATP-binding protein HrtA	0.00e+00	2.04e-28	1.84e-15	NA
4. PB	Q2SRI2	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	1.08e-17	7.83e-09	NA
4. PB	Q5HM27	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.17e-26	2.48e-20	NA
4. PB	Q2K9R2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.79e-24	1.43e-23	NA
4. PB	Q21E72	Phosphate import ATP-binding protein PstB	0.00e+00	2.16e-17	9.19e-16	NA
4. PB	Q8D3X4	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.03e-39	4.56e-16	NA
4. PB	Q5YRK2	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	7.48e-24	4.89e-16	NA
4. PB	Q0BSM2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.63e-23	6.96e-22	NA
4. PB	A3DJK3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.31e-11	7.65e-16	NA
4. PB	Q884I3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.01e-25	3.14e-26	NA
4. PB	Q8CPA1	Phosphate import ATP-binding protein PstB	0.00e+00	1.29e-17	5.43e-20	NA
4. PB	Q9PKX1	Probable metal transport system ATP-binding protein TC_0339	3.53e-13	1.15e-30	1.89e-25	NA
4. PB	Q032D0	Phosphonates import ATP-binding protein PhnC	0.00e+00	7.31e-57	5.99e-47	NA
4. PB	Q2YL70	Nickel import ATP-binding protein NikD	1.11e-16	6.74e-33	1.25e-07	NA
4. PB	Q8VNL9	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	9.88e-17	8.81e-18	NA
4. PB	Q11CZ6	Cytochrome c biogenesis ATP-binding export protein CcmA	8.88e-15	8.98e-18	6.38e-11	NA
4. PB	Q0RT43	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	3.57e-16	1.19e-11	NA
4. PB	Q0TAY4	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	Q5UW69	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	2.51e-33	1.05e-36	NA
4. PB	Q2K551	Hemin import ATP-binding protein HmuV	0.00e+00	3.93e-24	4.22e-17	NA
4. PB	P63402	Uncharacterized ABC transporter ATP-binding protein Mb2593	0.00e+00	1.90e-02	1.22e-24	NA
4. PB	Q84EY8	Hemin import ATP-binding protein HmuV	0.00e+00	2.38e-26	3.04e-22	NA
4. PB	Q47C66	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-25	2.59e-23	NA
4. PB	Q7WMC3	Phosphate import ATP-binding protein PstB	0.00e+00	2.43e-31	1.40e-12	NA
4. PB	Q89ER4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.09e-12	7.95e-15	NA
4. PB	Q58418	Phosphate import ATP-binding protein PstB	0.00e+00	7.92e-38	1.71e-18	NA
4. PB	O68877	Hemin import ATP-binding protein HmuV	0.00e+00	1.02e-34	8.14e-20	NA
4. PB	Q9A1E3	Methionine import ATP-binding protein MetN	0.00e+00	1.81e-02	1.23e-21	NA
4. PB	Q1GS38	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.10e-17	2.44e-06	NA
4. PB	Q81A96	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.06e-49	9.39e-38	NA
4. PB	A0R8K8	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.07e-19	3.94e-17	NA
4. PB	Q1BXC3	Phosphate import ATP-binding protein PstB	0.00e+00	1.05e-22	6.16e-16	NA
4. PB	Q2YK62	Putative peptide import ATP-binding protein BAB2_0818	0.00e+00	3.60e-05	1.43e-16	NA
4. PB	Q9KGD6	Energy-coupling factor transporter ATP-binding protein EcfA2	7.77e-16	8.06e-10	4.41e-14	NA
4. PB	P0A2V6	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.17e-08	2.01e-20	NA
4. PB	Q98KS7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.54e-22	4.60e-23	NA
4. PB	Q3SRG8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.63e-21	1.52e-21	NA
4. PB	Q2YUY7	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.73e-54	7.91e-38	NA
4. PB	P39459	Nitrate transport protein NasD	0.00e+00	5.44e-27	8.32e-18	NA
4. PB	O34314	Uncharacterized ABC transporter ATP-binding protein YtlC	0.00e+00	1.79e-27	3.91e-18	NA
4. PB	Q2T3B8	Hemin import ATP-binding protein HmuV	0.00e+00	1.33e-29	6.18e-12	NA
4. PB	Q8U648	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.81e-27	1.27e-17	NA
4. PB	Q11B53	Zinc import ATP-binding protein ZnuC	0.00e+00	7.93e-05	2.71e-14	NA
4. PB	P77499	Probable ATP-dependent transporter SufC	1.33e-15	1.18e-36	1.39e-06	NA
4. PB	Q3JTS8	Phosphate import ATP-binding protein PstB	0.00e+00	1.82e-24	1.96e-17	NA
4. PB	Q8X4L6	Nickel import ATP-binding protein NikE	0.00e+00	1.80e-26	1.17e-23	NA
4. PB	P0CZ33	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.17e-08	2.01e-20	NA
4. PB	Q1R5D8	Nickel import ATP-binding protein NikE	0.00e+00	3.65e-26	1.29e-23	NA
4. PB	Q3YSY7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.26e-26	9.40e-21	NA
4. PB	Q50316	Putative ABC transporter ATP-binding protein MG468.1 homolog	0.00e+00	2.01e-09	2.83e-14	NA
4. PB	Q6LTB1	Zinc import ATP-binding protein ZnuC	0.00e+00	2.74e-10	1.28e-16	NA
4. PB	Q5HBR8	Zinc import ATP-binding protein ZnuC	0.00e+00	3.62e-28	4.16e-12	NA
4. PB	Q0K9I2	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	9.61e-10	3.47e-21	NA
4. PB	P0A2U6	Zinc transport system ATP-binding protein AdcC	7.77e-16	4.48e-32	1.05e-18	NA
4. PB	Q28M30	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.01e-23	2.43e-19	NA
4. PB	Q8YCN8	Nickel import ATP-binding protein NikD	1.11e-16	6.74e-33	1.25e-07	NA
4. PB	Q31KE8	Phosphate import ATP-binding protein PstB	0.00e+00	1.60e-31	2.11e-19	NA
4. PB	Q4KG27	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	5.93e-15	1.14e-11	NA
4. PB	Q6F1W5	Energy-coupling factor transporter ATP-binding protein EcfA1	2.22e-16	2.44e-02	1.67e-16	NA
4. PB	Q4UT63	Phosphate import ATP-binding protein PstB	0.00e+00	1.19e-28	1.43e-15	NA
4. PB	Q02151	Uncharacterized ABC transporter ATP-binding protein YmeB	0.00e+00	4.00e-26	1.17e-07	NA
4. PB	Q55463	Bicarbonate transport ATP-binding protein CmpD	0.00e+00	8.87e-17	2.99e-14	NA
4. PB	Q2RS21	Nickel import ATP-binding protein NikD	0.00e+00	5.96e-33	2.72e-14	NA
4. PB	Q5QVB0	Phosphate import ATP-binding protein PstB	0.00e+00	1.10e-28	8.60e-15	NA
4. PB	P43569	CCR4-associated factor 16	1.99e-14	4.42e-14	3.13e-06	NA
4. PB	Q6MSQ2	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	5.57e-19	3.18e-09	NA
4. PB	P0A9X1	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	P0AAH8	Putrescine export system ATP-binding protein SapF	0.00e+00	1.71e-29	6.93e-10	NA
4. PB	Q8NWT5	Nickel import system ATP-binding protein NikD	0.00e+00	3.23e-41	2.03e-14	NA
4. PB	P0A2V5	Oligopeptide transport ATP-binding protein OppF	0.00e+00	9.49e-10	2.59e-19	NA
4. PB	Q97IE0	Phosphate import ATP-binding protein PstB	0.00e+00	2.60e-38	4.95e-20	NA
4. PB	Q9HX79	Taurine import ATP-binding protein TauB	0.00e+00	4.31e-26	1.74e-13	NA
4. PB	Q089M3	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-16	9.52e-16	1.51e-08	NA
4. PB	P77622	Probable D,D-dipeptide transport ATP-binding protein DdpF	0.00e+00	5.18e-07	1.13e-14	NA
4. PB	Q5YVL8	Hemin import ATP-binding protein HmuV	0.00e+00	2.68e-23	2.30e-19	NA
4. PB	Q0APW8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.04e-30	4.15e-23	NA
4. PB	Q7W025	Hemin import ATP-binding protein HmuV	0.00e+00	2.99e-28	2.02e-19	NA
4. PB	Q66A01	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	7.78e-26	2.07e-12	NA
4. PB	Q02QT6	Aliphatic sulfonates import ATP-binding protein SsuB 1	1.11e-16	3.81e-27	2.54e-15	NA
4. PB	Q2G1L8	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	Q2NSG3	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.61e-18	2.59e-11	NA
4. PB	Q9KL34	Hemin import ATP-binding protein HmuV	0.00e+00	4.39e-32	3.33e-17	NA
4. PB	Q2YXZ0	Nickel import system ATP-binding protein NikE	0.00e+00	3.15e-40	2.92e-21	NA
4. PB	Q21JQ9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.58e-29	2.90e-22	NA
4. PB	Q2FVF0	Metal-staphylopine import system ATP-binding protein CntD	0.00e+00	1.06e-25	3.94e-15	NA
4. PB	P45289	Peptide transport system ATP-binding protein SapF	0.00e+00	2.33e-28	1.57e-04	NA
4. PB	Q8RFV0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.85e-17	3.17e-18	NA
4. PB	Q65HB9	Phosphate import ATP-binding protein PstB 2	0.00e+00	3.74e-27	6.17e-16	NA
4. PB	Q2J220	Phosphate import ATP-binding protein PstB	0.00e+00	5.70e-23	2.29e-14	NA
4. PB	P9WQK1	Uncharacterized ABC transporter ATP-binding protein Rv0986	0.00e+00	2.72e-28	1.31e-25	NA
4. PB	Q83CV2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.98e-23	1.60e-22	NA
4. PB	O70014	Hemin import ATP-binding protein HmuV	0.00e+00	4.55e-28	8.37e-20	NA
4. PB	Q6G098	Hemin import ATP-binding protein HmuV	0.00e+00	1.68e-28	2.08e-13	NA
4. PB	Q1JBJ5	Phosphate import ATP-binding protein PstB 1	0.00e+00	6.77e-37	2.38e-17	NA
4. PB	Q9RZU5	Hemin import ATP-binding protein HmuV	0.00e+00	1.38e-29	2.74e-14	NA
4. PB	Q14J44	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.70e-30	2.05e-21	NA
4. PB	P0A9V3	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	3.23e-30	2.42e-15	NA
4. PB	Q88RA1	Taurine import ATP-binding protein TauB	0.00e+00	2.34e-26	2.58e-16	NA
4. PB	Q2SUW7	Phosphate import ATP-binding protein PstB	0.00e+00	3.08e-25	1.96e-17	NA
4. PB	Q0SZJ4	Nickel import ATP-binding protein NikD	2.22e-16	1.29e-26	1.97e-12	NA
4. PB	Q98FL5	Phosphate import ATP-binding protein PstB	0.00e+00	2.29e-26	1.02e-14	NA
4. PB	Q39S52	Phosphate import ATP-binding protein PstB	0.00e+00	1.11e-34	4.31e-16	NA
4. PB	O34946	High-affinity zinc uptake system ATP-binding protein ZnuC	0.00e+00	3.89e-32	8.29e-24	NA
4. PB	Q7NN36	Hemin import ATP-binding protein HmuV	0.00e+00	1.52e-22	7.33e-24	NA
4. PB	A0RFA4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	2.61e-26	8.57e-19	NA
4. PB	Q2FKB7	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	Q3KKA1	Zinc import ATP-binding protein ZnuC	1.11e-16	8.24e-08	9.81e-19	NA
4. PB	Q9ZCM4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.21e-25	9.64e-25	NA
4. PB	A3CRB9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.27e-15	2.49e-14	NA
4. PB	Q5HAV5	Phosphate import ATP-binding protein PstB	0.00e+00	2.16e-32	4.60e-19	NA
4. PB	Q5N1G5	Phosphate import ATP-binding protein PstB	0.00e+00	4.86e-32	8.05e-20	NA
4. PB	Q57213	Uncharacterized ABC transporter ATP-binding protein HI_1474	0.00e+00	1.11e-27	3.53e-13	NA
4. PB	Q9CPN2	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	4.92e-18	6.49e-09	NA
4. PB	Q02DK9	Zinc import ATP-binding protein ZnuC	1.11e-16	2.99e-06	6.78e-21	NA
4. PB	Q8XZQ4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	9.86e-13	6.05e-18	NA
4. PB	Q2YJJ8	Putative peptide import ATP-binding protein BAB2_1053	0.00e+00	1.19e-04	9.97e-16	NA
4. PB	Q9AML4	Phosphate import ATP-binding protein PstB	0.00e+00	3.87e-29	1.03e-13	NA
4. PB	P10640	ATP-binding protein BexA	7.27e-13	5.94e-17	1.20e-04	NA
4. PB	Q6LY93	Phosphate import ATP-binding protein PstB	0.00e+00	5.81e-39	4.90e-14	NA
4. PB	Q97Q34	Phosphate import ATP-binding protein PstB 2	0.00e+00	5.49e-30	2.14e-09	NA
4. PB	Q87UH7	Taurine import ATP-binding protein TauB	0.00e+00	1.40e-25	2.57e-13	NA
4. PB	Q729H7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.59e-25	9.49e-23	NA
4. PB	Q47YG8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	9.43e-29	8.96e-27	NA
4. PB	Q87J32	Hemin import ATP-binding protein HmuV	0.00e+00	3.17e-32	1.23e-24	NA
4. PB	Q81VQ1	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	4.41e-16	1.42e-16	NA
4. PB	Q8RCU0	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.62e-45	4.84e-17	NA
4. PB	Q82VR4	Phosphate import ATP-binding protein PstB	0.00e+00	2.61e-26	1.56e-12	NA
4. PB	O34756	Putative ABC transporter ATP-binding protein YjkB	0.00e+00	1.66e-37	4.16e-18	NA
4. PB	P0DJA1	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.75e-24	6.01e-22	NA
4. PB	Q10YP7	Phosphate import ATP-binding protein PstB	0.00e+00	1.00e-31	1.02e-13	NA
4. PB	Q65V02	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.79e-20	2.86e-10	NA
4. PB	Q99RR8	Putative hemin import ATP-binding protein HrtA	0.00e+00	7.20e-29	1.86e-15	NA
4. PB	Q11ID5	Hemin import ATP-binding protein HmuV	0.00e+00	2.13e-26	3.71e-16	NA
4. PB	Q88DY1	Hemin import ATP-binding protein HmuV	0.00e+00	3.78e-31	6.69e-22	NA
4. PB	Q5FT15	Phosphate import ATP-binding protein PstB	0.00e+00	8.29e-30	6.89e-12	NA
4. PB	Q6G4T6	Phosphate import ATP-binding protein PstB	0.00e+00	2.57e-40	1.63e-12	NA
4. PB	Q47538	Taurine import ATP-binding protein TauB	0.00e+00	1.47e-26	2.10e-14	NA
4. PB	P24137	Oligopeptide transport ATP-binding protein OppF	0.00e+00	9.48e-08	1.94e-19	NA
4. PB	Q8YDH0	Putative peptide import ATP-binding protein BMEII0206	0.00e+00	1.50e-04	2.31e-13	NA
4. PB	Q39LW7	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	8.67e-25	4.44e-18	NA
4. PB	Q2SRI1	Energy-coupling factor transporter ATP-binding protein EcfA1	1.11e-16	2.93e-02	9.86e-18	NA
4. PB	Q889G0	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	4.18e-46	2.30e-37	NA
4. PB	Q2YNU0	Cytochrome c biogenesis ATP-binding export protein CcmA	7.11e-15	4.46e-23	7.94e-14	NA
4. PB	Q55791	Probable ATP-dependent transporter slr0075	1.45e-11	3.98e-34	2.85e-05	NA
4. PB	Q4UVG2	Cytochrome c biogenesis ATP-binding export protein CcmA	5.22e-15	2.26e-11	4.77e-07	NA
4. PB	Q51719	Putative ABC transporter ATP-binding protein in cobA 5'region	0.00e+00	1.17e-08	1.03e-12	NA
4. PB	Q04EY5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.27e-14	1.26e-17	NA
4. PB	Q8DRF9	Methionine import ATP-binding protein MetN	0.00e+00	7.45e-03	8.32e-20	NA
4. PB	Q20WP4	Phosphate import ATP-binding protein PstB	0.00e+00	4.23e-26	4.46e-13	NA
4. PB	P94374	Uncharacterized ABC transporter ATP-binding protein YxlF	0.00e+00	1.36e-03	3.77e-19	NA
4. PB	Q48NM1	Phosphonates import ATP-binding protein PhnC 1	0.00e+00	1.13e-42	6.73e-38	NA
4. PB	Q2J3T0	Hemin import ATP-binding protein HmuV	0.00e+00	1.03e-29	2.95e-28	NA
4. PB	Q58429	Uncharacterized ABC transporter ATP-binding protein MJ1023	0.00e+00	2.00e-13	4.32e-15	NA
4. PB	Q8ZR89	Methionine import ATP-binding protein MetN 2	0.00e+00	3.18e-05	4.43e-28	NA
4. PB	Q6HFB5	Phosphonates import ATP-binding protein PhnC	0.00e+00	3.54e-48	1.09e-37	NA
4. PB	Q2W4W1	Zinc import ATP-binding protein ZnuC	0.00e+00	1.09e-08	1.05e-14	NA
4. PB	Q98QE1	Spermidine/putrescine import ATP-binding protein PotA	8.53e-09	1.15e-02	3.99e-06	NA
4. PB	Q1C6Q8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.48e-26	4.86e-23	NA
4. PB	Q5M4F3	Phosphate import ATP-binding protein PstB 1	0.00e+00	7.97e-30	6.62e-11	NA
4. PB	Q87BH8	Cytochrome c biogenesis ATP-binding export protein CcmA	5.11e-15	1.33e-17	1.79e-11	NA
4. PB	Q8DU23	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.37e-30	6.32e-13	NA
4. PB	Q5WET7	Phosphate import ATP-binding protein PstB 2	0.00e+00	8.56e-31	1.10e-16	NA
4. PB	A0A0H3JT74	Metal-staphylopine import system ATP-binding protein CntF	0.00e+00	2.06e-35	9.11e-12	NA
4. PB	P0A9V4	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	3.23e-30	2.42e-15	NA
4. PB	Q7MFA1	Hemin import ATP-binding protein HmuV	0.00e+00	2.41e-34	2.12e-20	NA
4. PB	Q6XYZ4	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.69e-18	9.38e-18	NA
4. PB	Q74LQ3	Phosphonates import ATP-binding protein PhnC	0.00e+00	6.92e-51	5.81e-44	NA
4. PB	Q5LZU3	Phosphate import ATP-binding protein PstB 1	0.00e+00	7.97e-30	6.62e-11	NA
4. PB	Q8RDH4	Dipeptide transport ATP-binding protein DppD	0.00e+00	6.67e-06	1.52e-09	NA
4. PB	Q47A37	Phosphate import ATP-binding protein PstB	0.00e+00	4.77e-36	6.40e-15	NA
4. PB	P0C560	Phosphate import ATP-binding protein PstB	0.00e+00	1.15e-32	1.50e-06	NA
4. PB	Q1GBJ0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.49e-18	9.47e-15	NA
4. PB	Q8DRR9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.09e-15	5.07e-17	NA
4. PB	Q1LC89	Hemin import ATP-binding protein HmuV	0.00e+00	1.89e-29	8.97e-18	NA
4. PB	Q8U8D6	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	2.76e-16	3.53e-23	NA
4. PB	Q39B28	Hemin import ATP-binding protein HmuV	0.00e+00	7.97e-20	5.72e-10	NA
4. PB	Q2FH58	Nickel import system ATP-binding protein NikE	0.00e+00	1.88e-40	7.71e-22	NA
4. PB	Q1IGL4	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	6.24e-19	3.54e-22	NA
4. PB	P42423	ABC transporter ATP-binding protein YxdL	0.00e+00	3.38e-38	2.19e-25	NA
4. PB	Q8K9M6	Zinc import ATP-binding protein ZnuC	6.94e-14	2.24e-28	2.43e-15	NA
4. PB	Q9Z8Q8	Methionine import ATP-binding protein MetN	0.00e+00	5.13e-04	1.58e-17	NA
4. PB	P70970	Energy-coupling factor transporter ATP-binding protein EcfA2	3.33e-16	8.08e-12	2.66e-20	NA
4. PB	Q2KUC0	Hemin import ATP-binding protein HmuV	0.00e+00	2.35e-30	2.88e-22	NA
4. PB	Q38UT9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.40e-11	1.69e-17	NA
4. PB	Q7WNT8	Phosphonates import ATP-binding protein PhnC	0.00e+00	9.62e-50	9.48e-39	NA
4. PB	Q7N3A6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.56e-25	1.14e-23	NA
4. PB	Q0TTG6	Phosphate import ATP-binding protein PstB	0.00e+00	3.39e-36	5.16e-21	NA
4. PB	P63351	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.03e-26	2.69e-10	NA
4. PB	Q7VZ31	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.68e-23	1.99e-22	NA
4. PB	B7M1B8	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q5PH81	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.47e-26	2.77e-10	NA
4. PB	P0CAT6	Phosphate import ATP-binding protein PstB	0.00e+00	6.03e-25	4.68e-14	NA
4. PB	Q9HZL7	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.97e-25	1.47e-23	NA
4. PB	P0AAH9	Peptide transport system ATP-binding protein SapF	0.00e+00	1.71e-29	6.93e-10	NA
4. PB	Q2JGF5	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.79e-04	6.94e-12	NA
4. PB	P75444	Putative ABC transporter ATP-binding protein MPN_334	0.00e+00	4.06e-02	6.54e-20	NA
4. PB	O32487	Phosphate import ATP-binding protein PstB	0.00e+00	4.52e-31	1.51e-15	NA
4. PB	A5VU87	Putative peptide import ATP-binding protein BOV_A0348	0.00e+00	2.53e-03	7.48e-13	NA
4. PB	Q2KVN7	Phosphate import ATP-binding protein PstB	0.00e+00	9.54e-33	1.71e-12	NA
4. PB	Q98QH5	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	5.84e-28	1.02e-21	NA
4. PB	Q6AAX3	Phosphate import ATP-binding protein PstB	0.00e+00	2.05e-33	8.98e-11	NA
4. PB	Q6FZX3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.79e-24	1.13e-22	NA
4. PB	P57066	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.60e-23	7.22e-24	NA
4. PB	Q8PP41	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	9.65e-32	2.96e-21	NA
4. PB	Q8DWR3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	8.54e-14	1.28e-15	NA
4. PB	Q7NAQ6	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	3.55e-20	1.18e-20	NA
4. PB	Q5V225	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.77e-14	1.69e-15	NA
4. PB	Q4KGX6	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	9.40e-20	4.22e-18	NA
4. PB	Q57DS9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.86e-21	3.30e-23	NA
4. PB	P48255	Probable ATP-dependent transporter ycf16	1.42e-11	1.80e-32	1.36e-08	NA
4. PB	Q58206	Uncharacterized ABC transporter ATP-binding protein MJ0796	0.00e+00	1.43e-37	9.80e-28	NA
4. PB	P52218	Cytochrome c biogenesis ATP-binding export protein CcmA	6.55e-15	2.29e-16	2.20e-06	NA
4. PB	Q6G529	Cytochrome c biogenesis ATP-binding export protein CcmA	4.55e-15	2.15e-20	2.29e-09	NA
4. PB	Q6KIP2	Spermidine/putrescine import ATP-binding protein PotA	1.37e-08	4.17e-02	5.31e-08	NA
4. PB	Q83J78	Nickel import ATP-binding protein NikD	2.22e-16	1.19e-26	2.18e-12	NA
4. PB	P63371	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.78e-36	2.91e-17	NA
4. PB	P55339	ABC-type transporter ATP-binding protein EcsA	0.00e+00	1.31e-24	1.49e-09	NA
4. PB	P74981	Hemin import ATP-binding protein HmuV	0.00e+00	2.97e-26	1.96e-18	NA
4. PB	Q609Z8	Phosphate import ATP-binding protein PstB	0.00e+00	7.25e-39	4.70e-15	NA
4. PB	Q98L75	Hemin import ATP-binding protein HmuV	0.00e+00	1.07e-29	2.36e-13	NA
4. PB	Q32AQ1	Nickel import ATP-binding protein NikE	0.00e+00	1.12e-25	4.24e-24	NA
4. PB	Q2YK63	Putative peptide import ATP-binding protein BAB2_0817	0.00e+00	2.24e-03	1.23e-11	NA
4. PB	Q9C8T1	ABC transporter I family member 1	1.11e-16	6.12e-20	5.76e-04	NA
4. PB	Q5FUV5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.18e-21	1.08e-16	NA
4. PB	Q9PAP0	Cytochrome c biogenesis ATP-binding export protein CcmA	2.51e-14	1.53e-12	2.62e-12	NA
4. PB	Q4KKK4	Zinc import ATP-binding protein ZnuC	1.11e-16	6.09e-09	9.81e-19	NA
4. PB	Q70YG7	Hemin import ATP-binding protein HmuV	0.00e+00	4.30e-24	4.34e-21	NA
4. PB	Q99UA3	Nickel import system ATP-binding protein NikE	0.00e+00	4.61e-40	9.40e-22	NA
4. PB	Q88EX5	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.08e-14	1.73e-12	NA
4. PB	Q8EEV5	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.79e-23	1.08e-23	NA
4. PB	Q8DAV6	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.60e-23	1.80e-26	NA
4. PB	Q8U3E0	Putative ABC transporter ATP-binding protein PF0528	0.00e+00	1.10e-21	1.83e-15	NA
4. PB	Q7WEH6	Hemin import ATP-binding protein HmuV	0.00e+00	4.82e-28	4.75e-20	NA
4. PB	B4TGI0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.03e-26	2.69e-10	NA
4. PB	Q6D5H7	Methionine import ATP-binding protein MetN 1	0.00e+00	2.36e-02	1.17e-29	NA
4. PB	P0A193	High-affinity branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	7.87e-37	4.80e-18	NA
4. PB	Q2LVM2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.71e-26	3.24e-25	NA
4. PB	Q0TBU8	Hemin import ATP-binding protein HmuV	0.00e+00	1.52e-26	4.90e-20	NA
4. PB	A1JRI2	Zinc import ATP-binding protein ZnuC	0.00e+00	2.96e-15	3.66e-17	NA
4. PB	Q6D3Q6	Methionine import ATP-binding protein MetN 2	0.00e+00	9.59e-04	3.05e-28	NA
4. PB	Q74E68	Phosphate import ATP-binding protein PstB	0.00e+00	7.35e-27	2.10e-13	NA
4. PB	Q5E284	Zinc import ATP-binding protein ZnuC 2	1.11e-16	3.88e-23	5.83e-19	NA
4. PB	Q9WYI7	Uncharacterized ABC transporter ATP-binding protein TM_0352	0.00e+00	4.48e-32	9.45e-32	NA
4. PB	Q1CK45	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.04e-22	3.72e-12	NA
4. PB	Q084V3	Phosphate import ATP-binding protein PstB	0.00e+00	2.29e-26	2.30e-15	NA
4. PB	Q8FCJ1	Hemin import ATP-binding protein HmuV	0.00e+00	1.52e-26	4.90e-20	NA
4. PB	Q02FW7	Hemin import ATP-binding protein HmuV	0.00e+00	1.02e-34	8.14e-20	NA
4. PB	Q2FVF1	Metal-staphylopine import system ATP-binding protein CntF	0.00e+00	2.67e-37	2.38e-12	NA
4. PB	Q6G1D9	Putative ABC transporter ATP-binding protein BQ02700	0.00e+00	4.79e-43	2.44e-10	NA
4. PB	Q669P3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.38e-25	2.15e-23	NA
4. PB	Q743D1	Phosphate import ATP-binding protein PstB	0.00e+00	5.58e-37	1.54e-06	NA
4. PB	Q7NU46	Taurine import ATP-binding protein TauB	0.00e+00	8.83e-23	3.66e-09	NA
4. PB	Q5ZT78	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.67e-26	3.26e-25	NA
4. PB	Q8ETV7	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.64e-19	9.16e-20	NA
4. PB	Q9Z411	Phosphate import ATP-binding protein PstB	0.00e+00	3.94e-23	7.41e-14	NA
4. PB	Q47Y12	Phosphate import ATP-binding protein PstB	0.00e+00	1.18e-24	1.05e-13	NA
4. PB	Q312H8	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.69e-23	1.02e-24	NA
4. PB	Q9HT73	Zinc import ATP-binding protein ZnuC	1.11e-16	2.99e-06	6.78e-21	NA
4. PB	Q6GH21	Phosphate import ATP-binding protein PstB	0.00e+00	7.18e-22	6.24e-23	NA
4. PB	Q1GJU0	Hemin import ATP-binding protein HmuV	0.00e+00	3.65e-26	1.89e-17	NA
4. PB	Q73F66	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	6.15e-16	3.03e-17	NA
4. PB	Q3M4H6	Phosphate import ATP-binding protein PstB 4	0.00e+00	2.79e-37	4.77e-15	NA
4. PB	Q1QQH1	Phosphate import ATP-binding protein PstB	0.00e+00	3.19e-22	5.38e-15	NA
4. PB	Q8TI16	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	9.88e-17	3.84e-16	NA
4. PB	Q3ICT8	Hemin import ATP-binding protein HmuV	0.00e+00	4.39e-32	2.29e-18	NA
4. PB	Q57NA5	Zinc import ATP-binding protein ZnuC	0.00e+00	1.10e-16	2.76e-18	NA
4. PB	Q8PKT0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.89e-21	1.59e-22	NA
4. PB	Q12BB2	Phosphate import ATP-binding protein PstB	0.00e+00	7.62e-33	2.04e-16	NA
4. PB	A8A0Q1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q2W7J9	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.03e-36	2.59e-19	NA
4. PB	Q82G23	Phosphate import ATP-binding protein PstB	0.00e+00	1.50e-35	7.33e-15	NA
4. PB	Q8P0V3	Phosphate import ATP-binding protein PstB 2	0.00e+00	1.53e-28	6.07e-10	NA
4. PB	P45095	Dipeptide transport ATP-binding protein DppD	0.00e+00	1.86e-03	5.50e-16	NA
4. PB	Q2YA30	Phosphate import ATP-binding protein PstB	0.00e+00	2.05e-26	2.34e-13	NA
4. PB	A0R8K9	Energy-coupling factor transporter ATP-binding protein EcfA2	1.11e-16	5.70e-16	1.02e-16	NA
4. PB	Q2YJH4	Zinc import ATP-binding protein ZnuC	0.00e+00	9.76e-03	4.17e-16	NA
4. PB	A1AC19	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	Q8PM59	Phosphate import ATP-binding protein PstB	0.00e+00	7.06e-29	8.30e-16	NA
4. PB	P42332	Bacitracin transport ATP-binding protein BcrA	0.00e+00	2.53e-02	8.49e-16	NA
4. PB	Q045Z7	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.44e-18	1.31e-17	NA
4. PB	Q2FH51	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	NA
4. PB	Q31VE6	Nickel import ATP-binding protein NikE	0.00e+00	5.24e-27	8.25e-24	NA
4. PB	Q1QXH6	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.11e-32	1.91e-17	NA
4. PB	Q3AJS9	Phosphate import ATP-binding protein PstB	0.00e+00	1.59e-25	2.19e-13	NA
4. PB	Q02856	Probable ATP-dependent transporter ycf16	5.55e-16	2.54e-32	1.24e-04	NA
4. PB	Q65P76	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.89e-18	4.35e-21	NA
4. PB	P33360	Glycine betaine uptake system ATP-binding protein YehX	0.00e+00	1.97e-03	1.11e-12	NA
4. PB	Q8YK28	Phosphonates import ATP-binding protein PhnC 3	0.00e+00	1.84e-40	4.09e-39	NA
4. PB	Q663R5	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.58e-31	5.42e-14	NA
4. PB	Q2YYM5	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	5.57e-19	6.32e-21	NA
4. PB	Q8NWT6	Nickel import system ATP-binding protein NikE	0.00e+00	1.50e-40	2.74e-21	NA
4. PB	P57031	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.59e-25	1.48e-20	NA
4. PB	Q2RFS8	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	1.15e-17	3.17e-11	NA
4. PB	Q87G59	Phosphate import ATP-binding protein PstB 2	0.00e+00	9.63e-38	1.65e-15	NA
4. PB	Q3SI20	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.17e-26	2.84e-22	NA
4. PB	P45073	Lipopolysaccharide export system ATP-binding protein LptB	0.00e+00	4.76e-32	1.49e-15	NA
4. PB	Q6G9I0	Nickel import system ATP-binding protein NikD	0.00e+00	6.98e-41	2.69e-14	NA
4. PB	Q0HNQ5	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	2.96e-15	6.65e-11	NA
4. PB	Q3K6R9	Hemin import ATP-binding protein HmuV	0.00e+00	1.44e-32	8.89e-19	NA
4. PB	Q7A848	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.68e-54	7.19e-38	NA
4. PB	Q487I2	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	1.03e-21	4.31e-08	NA
4. PB	Q2SJK0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.17e-24	5.82e-19	NA
4. PB	Q3M5J9	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	7.10e-25	1.10e-19	NA
4. PB	P9WQI4	Uncharacterized ABC transporter ATP-binding protein MT2640	0.00e+00	1.90e-02	1.22e-24	NA
4. PB	Q81Y10	Phosphonates import ATP-binding protein PhnC	0.00e+00	9.25e-47	1.14e-37	NA
4. PB	Q9EUS2	Phosphate import ATP-binding protein PstB	0.00e+00	1.86e-35	7.33e-15	NA
4. PB	Q9ZCF9	Cytochrome c biogenesis ATP-binding export protein CcmA	5.11e-15	7.45e-12	0.003	NA
4. PB	P63370	Phosphate import ATP-binding protein PstB 2	0.00e+00	2.16e-29	3.20e-13	NA
4. PB	Q8Y4E9	Phosphate import ATP-binding protein PstB 2	0.00e+00	6.70e-22	2.07e-11	NA
4. PB	Q1J0N0	Phosphate import ATP-binding protein PstB	0.00e+00	1.90e-36	3.40e-18	NA
4. PB	Q31UX2	Phosphate import ATP-binding protein PstB	0.00e+00	9.84e-31	2.19e-16	NA
4. PB	A3CVD3	Energy-coupling factor transporter ATP-binding protein EcfA	0.00e+00	1.47e-20	8.15e-17	NA
4. PB	Q9KN92	Phosphate import ATP-binding protein PstB 2	0.00e+00	4.19e-36	2.54e-15	NA
4. PB	P73788	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.22e-32	1.48e-15	NA
4. PB	Q7VN12	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-16	3.00e-12	9.22e-12	NA
4. PB	Q92L55	Cytochrome c biogenesis ATP-binding export protein CcmA	1.40e-14	9.21e-15	1.96e-12	NA
4. PB	Q5FKL2	Methionine import ATP-binding protein MetN	0.00e+00	1.78e-02	2.92e-21	NA
4. PB	P0A9S8	High-affinity branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	2.11e-37	3.65e-19	NA
4. PB	Q7MU65	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	8.53e-26	8.12e-24	NA
4. PB	Q67RE7	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.36e-26	4.32e-16	NA
4. PB	Q1JJC9	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	6.55e-19	8.54e-17	NA
4. PB	Q6D2D5	Phosphate import ATP-binding protein PstB 1	0.00e+00	4.39e-26	6.93e-14	NA
4. PB	Q9RRL9	Putative ABC transporter ATP-binding protein DR_2469	0.00e+00	8.45e-38	2.46e-11	NA
4. PB	Q97EK9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	1.61e-15	2.27e-15	NA
4. PB	Q1CE65	Hemin import ATP-binding protein HmuV	0.00e+00	1.06e-25	2.60e-23	NA
4. PB	P63386	Intermembrane phospholipid transport system ATP-binding protein MlaF	0.00e+00	1.35e-27	2.05e-14	NA
4. PB	Q3A6U0	Phosphate import ATP-binding protein PstB	0.00e+00	6.57e-27	4.04e-11	NA
4. PB	Q2JLH7	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	3.78e-31	1.52e-37	NA
4. PB	Q3MGT2	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.71e-52	3.45e-27	NA
4. PB	Q8ZCX5	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.04e-22	3.72e-12	NA
4. PB	Q7N0N3	Putative ABC transporter ATP-binding protein plu3849	0.00e+00	4.18e-44	1.10e-14	NA
4. PB	Q8YBN5	Putative peptide import ATP-binding protein BMEII0864	0.00e+00	3.60e-05	1.43e-16	NA
4. PB	Q577J4	Putative peptide import ATP-binding protein BruAb2_0797	0.00e+00	3.60e-05	1.43e-16	NA
4. PB	Q98EA4	Cytochrome c biogenesis ATP-binding export protein CcmA	2.22e-15	5.80e-14	6.06e-12	NA
4. PB	A1JPQ1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	3.63e-25	3.55e-11	NA
4. PB	B8GYG4	Phosphate import ATP-binding protein PstB	0.00e+00	6.03e-25	4.68e-14	NA
4. PB	Q2VYP7	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.33e-33	9.39e-18	NA
4. PB	P75957	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.31e-23	8.47e-24	NA
4. PB	Q6N5P8	Lipoprotein-releasing system ATP-binding protein LolD 2	0.00e+00	1.30e-20	5.04e-22	NA
4. PB	A5VU86	Putative peptide import ATP-binding protein BOV_A0347	0.00e+00	3.60e-05	1.43e-16	NA
4. PB	Q6NA00	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	1.10e-28	1.53e-25	NA
4. PB	Q8PHQ3	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	3.23e-13	3.95e-17	NA
4. PB	Q07733	Oligopeptide transport ATP-binding protein OppD	0.00e+00	3.95e-05	7.52e-16	NA
4. PB	Q5FM63	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.54e-15	2.24e-16	NA
4. PB	Q1WUX2	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.81e-29	2.73e-10	NA
4. PB	Q4UV71	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.91e-23	1.48e-23	NA
4. PB	Q8CUY0	Phosphonates import ATP-binding protein PhnC 2	0.00e+00	6.07e-52	3.13e-47	NA
4. PB	O78474	Probable ATP-dependent transporter ycf16	7.77e-16	2.20e-28	5.13e-05	NA
4. PB	Q4UJW5	Zinc import ATP-binding protein ZnuC	0.00e+00	1.20e-30	1.06e-11	NA
4. PB	P08007	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.14e-06	2.10e-17	NA
4. PB	Q7N9U4	Phosphate import ATP-binding protein PstB	0.00e+00	3.32e-29	1.19e-12	NA
4. PB	Q5NQX0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.37e-14	8.98e-18	2.83e-06	NA
4. PB	Q02QT1	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.54e-20	5.74e-22	NA
4. PB	Q4FTM3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.05e-19	3.20e-20	NA
4. PB	Q3Z257	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q1MCZ1	Hemin import ATP-binding protein HmuV	0.00e+00	2.98e-23	7.67e-17	NA
4. PB	Q9CP24	Zinc import ATP-binding protein ZnuC	6.68e-14	3.49e-12	9.41e-12	NA
4. PB	Q2JMJ0	Phosphate import ATP-binding protein PstB 1	0.00e+00	1.03e-26	8.67e-18	NA
4. PB	Q83RS0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.09e-23	2.04e-23	NA
4. PB	P63372	Phosphate import ATP-binding protein PstB 3	0.00e+00	1.78e-36	2.91e-17	NA
4. PB	Q8P2M5	Probable ABC transporter ATP-binding protein spyM18_0273	9.99e-16	1.16e-34	6.77e-06	NA
4. PB	Q52733	Cytochrome c biogenesis ATP-binding export protein CcmA	7.22e-15	1.01e-20	1.52e-08	NA
4. PB	P0A9S9	High-affinity branched-chain amino acid transport ATP-binding protein LivG	0.00e+00	2.11e-37	3.65e-19	NA
4. PB	Q15QL7	Phosphate import ATP-binding protein PstB	0.00e+00	9.56e-18	2.90e-21	NA
4. PB	Q9CN78	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.22e-25	3.53e-26	NA
4. PB	Q5M1F6	Methionine import ATP-binding protein MetN	0.00e+00	2.48e-04	1.65e-24	NA
4. PB	P54591	Uncharacterized ABC transporter ATP-binding protein YhcG	1.11e-16	2.41e-21	1.48e-13	NA
4. PB	Q8PYH5	Putative ABC transporter ATP-binding protein MM_0887	0.00e+00	5.66e-09	1.94e-25	NA
4. PB	Q9RKC6	Putative ABC transporter ATP-binding protein SCO3161	0.00e+00	9.74e-33	2.26e-13	NA
4. PB	Q18CI9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	4.56e-17	2.57e-14	NA
4. PB	Q6ADG4	Phosphate import ATP-binding protein PstB	0.00e+00	3.98e-34	4.28e-14	NA
4. PB	Q0TGX4	Zinc import ATP-binding protein ZnuC	0.00e+00	4.09e-16	1.30e-17	NA
4. PB	Q3KFY6	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	4.62e-16	6.94e-12	NA
4. PB	Q03ZL6	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	9.09e-24	2.88e-19	NA
4. PB	Q7W8Q6	Phosphate import ATP-binding protein PstB	0.00e+00	2.43e-31	1.40e-12	NA
4. PB	Q2FYQ7	Nickel import system ATP-binding protein NikD	0.00e+00	6.98e-41	2.69e-14	NA
4. PB	Q5PBX2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.50e-25	2.29e-28	NA
4. PB	Q32FJ0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q48PV0	Zinc import ATP-binding protein ZnuC	1.11e-16	1.63e-09	7.03e-18	NA
4. PB	Q8YDR7	Putative ATP-binding protein BMEII0108	0.00e+00	1.04e-15	5.21e-15	NA
4. PB	Q5HC57	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.70e-30	7.94e-23	NA
4. PB	Q93KD4	Tungstate uptake system ATP-binding protein TupC	0.00e+00	3.24e-36	2.67e-11	NA
4. PB	Q046T0	Phosphonates import ATP-binding protein PhnC	0.00e+00	2.45e-52	3.49e-45	NA
4. PB	Q64Z80	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	7.78e-25	8.60e-25	NA
4. PB	Q321G6	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	6.42e-28	6.78e-10	NA
4. PB	Q73F67	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	4.62e-20	2.69e-17	NA
4. PB	Q0AKQ2	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	5.51e-15	4.16e-08	NA
4. PB	P22731	High-affinity branched-chain amino acid transport ATP-binding protein LivF	0.00e+00	1.55e-30	6.84e-11	NA
4. PB	P0AAG1	Dipeptide transport ATP-binding protein DppD	0.00e+00	5.89e-03	2.37e-13	NA
4. PB	Q1H0W2	Hemin import ATP-binding protein HmuV	0.00e+00	6.84e-24	1.54e-20	NA
4. PB	Q2GHT4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.03e-32	7.20e-21	NA
4. PB	Q5E0B3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.76e-27	3.59e-23	NA
4. PB	Q1QCN2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.55e-21	5.61e-20	NA
4. PB	Q97T09	Methionine import ATP-binding protein MetN	0.00e+00	7.94e-03	1.06e-19	NA
4. PB	Q1Q889	Zinc import ATP-binding protein ZnuC	6.11e-15	1.60e-27	3.90e-19	NA
4. PB	Q8DPB4	Phosphate import ATP-binding protein PstB 2	0.00e+00	7.30e-31	8.08e-09	NA
4. PB	Q8ZFR4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	5.48e-26	4.86e-23	NA
4. PB	Q63H62	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.90e-19	7.44e-17	NA
4. PB	Q0A9E2	Zinc import ATP-binding protein ZnuC	1.11e-16	4.00e-24	1.54e-15	NA
4. PB	P48334	Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region	0.00e+00	2.62e-33	8.80e-27	NA
4. PB	Q1MFL8	Aliphatic sulfonates import ATP-binding protein SsuB 1	0.00e+00	7.26e-16	1.43e-20	NA
4. PB	Q736E0	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	7.21e-27	3.23e-19	NA
4. PB	Q5QZP7	Cytochrome c biogenesis ATP-binding export protein CcmA	5.55e-16	2.71e-15	6.18e-07	NA
4. PB	Q2Y624	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	3.97e-25	3.17e-20	NA
4. PB	P0CE69	Putative uncharacterized protein YKR104W	1.11e-16	5.73e-09	3.88e-08	NA
4. PB	Q5L3R0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.27e-17	7.11e-24	NA
4. PB	Q2FER8	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	7.82e-19	7.44e-21	NA
4. PB	Q5NNN6	Phosphate import ATP-binding protein PstB	1.11e-16	1.87e-26	5.64e-13	NA
4. PB	P72479	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.63e-09	9.42e-14	NA
4. PB	Q1MEG2	Zinc import ATP-binding protein ZnuC	1.11e-16	3.94e-03	3.06e-13	NA
4. PB	Q2LTG0	Phosphate import ATP-binding protein PstB	0.00e+00	1.48e-27	8.26e-17	NA
4. PB	O28437	Putative ABC transporter ATP-binding protein AF_1841	0.00e+00	6.54e-45	2.89e-24	NA
4. PB	Q2NTI7	Zinc import ATP-binding protein ZnuC	0.00e+00	2.55e-12	1.27e-11	NA
4. PB	Q8NR42	Aliphatic sulfonates import ATP-binding protein SsuB	0.00e+00	1.33e-29	3.18e-15	NA
4. PB	Q1RGL1	Zinc import ATP-binding protein ZnuC	0.00e+00	7.37e-30	6.92e-11	NA
4. PB	Q49ZT6	Putative hemin import ATP-binding protein HrtA	0.00e+00	3.51e-29	3.31e-15	NA
4. PB	P0CZ32	Oligopeptide transport ATP-binding protein OppF	0.00e+00	1.17e-08	2.01e-20	NA
4. PB	Q2P2Y5	Phosphate import ATP-binding protein PstB	0.00e+00	7.48e-28	9.28e-16	NA
4. PB	P47532	Probable ABC transporter ATP-binding protein p29	0.00e+00	1.03e-54	1.46e-31	NA
4. PB	P16678	Putative phosphonates utilization ATP-binding protein PhnK	0.00e+00	3.38e-41	6.22e-20	NA
4. PB	C4ZYH1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.14e-28	2.64e-10	NA
4. PB	P63365	Phosphate import ATP-binding protein PstB	0.00e+00	9.27e-31	3.20e-17	NA
4. PB	Q0HVQ0	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	4.62e-23	9.29e-23	NA
4. PB	Q73P71	Phosphonates import ATP-binding protein PhnC	0.00e+00	4.20e-51	1.16e-40	NA
4. PB	Q2RS22	Nickel import ATP-binding protein NikE	0.00e+00	1.38e-25	4.30e-18	NA
4. PB	Q88JJ0	Phosphate import ATP-binding protein PstB 1	0.00e+00	4.23e-23	4.79e-11	NA
4. PB	Q8X5W0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.96e-28	1.35e-10	NA
4. PB	Q03Z27	Methionine import ATP-binding protein MetN	0.00e+00	6.67e-05	4.23e-23	NA
4. PB	Q74AT2	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.23e-25	2.01e-26	NA
4. PB	Q733D6	Phosphonates import ATP-binding protein PhnC	0.00e+00	1.11e-47	1.11e-37	NA
4. PB	Q6HPM9	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	4.41e-16	1.42e-16	NA
4. PB	Q13CR0	Phosphate import ATP-binding protein PstB	0.00e+00	5.53e-21	7.44e-13	NA
4. PB	Q63V79	Phosphate import ATP-binding protein PstB	0.00e+00	1.82e-24	1.96e-17	NA
4. PB	Q92G95	Cytochrome c biogenesis ATP-binding export protein CcmA	7.55e-15	1.97e-13	1.91e-06	NA
4. PB	P32016	Capsule polysaccharide export ATP-binding protein CtrD	6.12e-13	3.06e-18	3.67e-05	NA
4. PB	A7ZMH7	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	Q31VE7	Nickel import ATP-binding protein NikD	2.22e-16	1.74e-26	6.25e-12	NA
4. PB	Q46L27	Phosphate import ATP-binding protein PstB	0.00e+00	1.36e-26	9.46e-16	NA
4. PB	Q82CD3	Aliphatic sulfonates import ATP-binding protein SsuB 2	0.00e+00	1.30e-23	8.84e-16	NA
4. PB	Q6GE75	Putative hemin import ATP-binding protein HrtA	0.00e+00	3.76e-28	1.48e-14	NA
4. PB	Q035B3	Energy-coupling factor transporter ATP-binding protein EcfA2	0.00e+00	5.13e-16	2.67e-16	NA
4. PB	Q72GX5	Phosphate import ATP-binding protein PstB	0.00e+00	4.55e-20	8.45e-14	NA
4. PB	Q9HS13	Phosphate import ATP-binding protein PstB 1	0.00e+00	3.27e-21	8.57e-15	NA
4. PB	Q3J376	Phosphate import ATP-binding protein PstB	0.00e+00	2.12e-28	9.12e-16	NA
4. PB	Q4KK16	Taurine import ATP-binding protein TauB	0.00e+00	8.67e-25	2.25e-15	NA
4. PB	Q12L15	Phosphate import ATP-binding protein PstB	0.00e+00	2.95e-24	1.27e-14	NA
4. PB	Q48TC3	Phosphate import ATP-binding protein PstB 1	0.00e+00	2.11e-37	2.40e-17	NA
4. PB	Q8FZV2	Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363	7.77e-16	1.50e-35	7.13e-17	NA
4. PB	Q9Z9J3	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.42e-20	3.76e-19	NA
4. PB	P69880	Phosphate import ATP-binding protein PstB	0.00e+00	7.05e-22	6.24e-23	NA
4. PB	A8AHA1	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	3.74e-27	4.51e-10	NA
4. PB	Q8CRI6	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	2.17e-26	2.48e-20	NA
4. PB	Q28Q03	Phosphate import ATP-binding protein PstB	0.00e+00	6.77e-21	8.98e-14	NA
4. PB	Q39EV3	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.42e-21	4.67e-21	NA
4. PB	P04285	Oligopeptide transport ATP-binding protein OppD	0.00e+00	1.50e-06	6.95e-12	NA
4. PB	Q8KZR4	Taurine import ATP-binding protein TauB	0.00e+00	5.87e-27	5.23e-15	NA
4. PB	P0CZ43	Probable ABC transporter ATP-binding protein SPs0214	1.09e-11	1.59e-34	5.26e-06	NA
4. PB	Q1RB86	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q4ZLS1	Aliphatic sulfonates import ATP-binding protein SsuB 3	0.00e+00	2.39e-19	5.75e-22	NA
4. PB	Q6HPN0	Energy-coupling factor transporter ATP-binding protein EcfA1	0.00e+00	1.07e-19	3.94e-17	NA
4. PB	Q6MTC1	Phosphate import ATP-binding protein PstB	0.00e+00	2.18e-22	3.07e-10	NA
4. PB	Q1MIJ4	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	6.60e-24	1.90e-25	NA
4. PB	Q9K8N1	Phosphonates import ATP-binding protein PhnC 3	0.00e+00	6.66e-48	2.62e-46	NA
4. PB	Q4K5Z7	Hemin import ATP-binding protein HmuV	0.00e+00	4.48e-32	9.17e-19	NA
4. PB	Q1I4Q5	Hemin import ATP-binding protein HmuV	0.00e+00	4.76e-32	2.91e-19	NA
4. PB	B1LE21	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	2.33e-28	5.32e-10	NA
4. PB	P45288	Peptide transport system ATP-binding protein SapD	1.11e-16	7.25e-03	3.44e-13	NA
4. PB	Q1RD37	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	2.05e-23	5.46e-24	NA
4. PB	Q32HA3	Zinc import ATP-binding protein ZnuC	0.00e+00	8.83e-16	1.47e-17	NA
4. PB	Q6D606	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	4.68e-15	9.25e-09	NA
4. PB	Q1JDG6	Methionine import ATP-binding protein MetN	0.00e+00	2.12e-02	1.37e-21	NA
4. PB	B7MAS0	Vitamin B12 import ATP-binding protein BtuD	0.00e+00	1.18e-27	5.53e-10	NA
4. PB	Q8P8V9	Lipoprotein-releasing system ATP-binding protein LolD	0.00e+00	1.91e-23	1.48e-23	NA
5. P	Q2RYF0	Cytochrome c biogenesis ATP-binding export protein CcmA	7.77e-16	3.60e-20	NA	NA
5. P	Q21CV6	Cytochrome c biogenesis ATP-binding export protein CcmA	9.99e-15	2.29e-16	NA	NA
5. P	O33570	Cytochrome c biogenesis ATP-binding export protein CcmA	1.43e-14	2.09e-16	NA	NA
5. P	Q5P3L0	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	2.67e-14	NA	NA
5. P	Q32I01	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.37e-18	NA	NA
5. P	O50312	Magnesium-chelatase 38 kDa subunit	1.75e-01	2.05e-02	NA	NA
5. P	Q2J3F7	Cytochrome c biogenesis ATP-binding export protein CcmA	4.55e-15	1.74e-17	NA	NA
5. P	Q2KDX0	DNA replication and repair protein RecF	1.87e-03	2.36e-02	NA	NA
5. P	Q0TFP1	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.31e-17	NA	NA
5. P	Q1QR47	Cytochrome c biogenesis ATP-binding export protein CcmA	3.89e-15	2.86e-17	NA	NA
5. P	Q68VV5	Cytochrome c biogenesis ATP-binding export protein CcmA	8.22e-15	2.00e-14	NA	NA
5. P	Q4UK25	Cytochrome c biogenesis ATP-binding export protein CcmA	4.22e-15	5.35e-15	NA	NA
5. P	P43110	Vi polysaccharide export ATP-binding protein VexC	2.25e-12	4.03e-19	NA	NA
5. P	P29959	Cytochrome c biogenesis ATP-binding export protein CcmA	1.58e-14	4.82e-15	NA	NA
5. P	B0BRG1	DNA replication and repair protein RecF	1.65e-04	4.35e-02	NA	NA
5. P	Q8YED7	DNA replication and repair protein RecF	2.56e-03	3.22e-02	NA	NA
5. P	Q7WIP8	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	2.86e-19	NA	NA
5. P	Q13DS7	Cytochrome c biogenesis ATP-binding export protein CcmA	3.00e-15	1.07e-19	NA	NA
5. P	P33931	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.31e-17	NA	NA
5. P	Q8UJ65	DNA replication and repair protein RecF	2.19e-03	2.95e-02	NA	NA
5. P	Q7WXC1	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	2.11e-07	NA	NA
5. P	Q3SVV2	Cytochrome c biogenesis ATP-binding export protein CcmA	1.78e-15	6.42e-17	NA	NA
5. P	Q0VR80	Cytochrome c biogenesis ATP-binding export protein CcmA	1.67e-15	2.07e-15	NA	NA
5. P	Q6NDA6	Cytochrome c biogenesis ATP-binding export protein CcmA	5.88e-15	6.65e-20	NA	NA
5. P	Q28NZ8	Cytochrome c biogenesis ATP-binding export protein CcmA	1.30e-14	1.73e-14	NA	NA
5. P	P30963	Cytochrome c biogenesis ATP-binding export protein CcmA	2.00e-15	2.87e-18	NA	NA
5. P	Q8G3E5	DNA replication and repair protein RecF	3.13e-03	3.22e-02	NA	NA
5. P	Q478L3	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	8.83e-16	NA	NA
5. P	Q3EDJ0	ABC transporter I family member 19	3.33e-15	1.50e-06	NA	NA
5. P	Q9A298	Cytochrome c biogenesis ATP-binding export protein CcmA	5.55e-16	6.60e-12	NA	NA
5. P	Q2SE49	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	2.90e-20	NA	NA
5. P	Q166I9	Cytochrome c biogenesis ATP-binding export protein CcmA	8.22e-15	2.63e-16	NA	NA
5. P	Q1R9L8	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	5.68e-18	NA	NA
5. P	Q7W736	Cytochrome c biogenesis ATP-binding export protein CcmA	4.44e-16	2.00e-19	NA	NA
5. P	Q31Z24	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.31e-17	NA	NA
5. P	Q3JCI7	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.39e-12	NA	NA
5. P	Q83KD5	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	4.36e-17	NA	NA
5. P	P61378	Cytochrome c biogenesis ATP-binding export protein CcmA 2	0.00e+00	6.55e-19	NA	NA
5. P	Q21QL9	Cytochrome c biogenesis ATP-binding export protein CcmA	1.11e-16	1.33e-14	NA	NA
5. P	P24718	DNA replication and repair protein RecF	1.50e-04	4.77e-02	NA	NA
5. P	P23888	Polysialic acid transport ATP-binding protein KpsT	3.26e-08	4.86e-17	NA	NA
5. P	Q57G08	DNA replication and repair protein RecF	2.61e-03	3.22e-02	NA	NA
5. P	Q2YPM3	DNA replication and repair protein RecF	2.61e-03	3.22e-02	NA	NA
5. P	Q0A808	Cytochrome c biogenesis ATP-binding export protein CcmA	3.33e-16	4.94e-20	NA	NA
5. P	B9JGW1	DNA replication and repair protein RecF	1.93e-03	3.30e-02	NA	NA
5. P	Q21JK3	Cytochrome c biogenesis ATP-binding export protein CcmA	7.66e-15	3.14e-22	NA	NA
5. P	Q1RKE4	Cytochrome c biogenesis ATP-binding export protein CcmA	5.55e-16	4.92e-13	NA	NA
5. P	Q1LKR4	Cytochrome c biogenesis ATP-binding export protein CcmA 1	0.00e+00	1.97e-19	NA	NA
5. P	Q57585	Uncharacterized ABC transporter ATP-binding protein MJ0121	5.73e-08	1.39e-12	NA	NA
5. P	Q8XE58	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	1.74e-17	NA	NA
5. P	Q8FFR2	Cytochrome c biogenesis ATP-binding export protein CcmA	0.00e+00	7.31e-18	NA	NA
6. F	Q88ZH4	Teichoic acids export ATP-binding protein TagH	1.33e-12	NA	NA	0.65
6. F	Q03SI5	Teichoic acids export ATP-binding protein TagH	1.60e-12	NA	NA	0.6156
7. B	Q8Z8A4	Molybdenum import ATP-binding protein ModC	2.25e-14	NA	1.69e-04	NA
7. B	Q81GC1	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.41e-18	NA
7. B	P75095	Putative ABC transporter ATP-binding protein MG014 homolog	5.48e-10	NA	1.13e-05	NA
7. B	O31151	UvrABC system protein A	1.16e-02	NA	5.07e-04	NA
7. B	Q2SU77	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.22e-15	NA	1.16e-13	NA
7. B	Q2J0F4	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.13e-11	NA	2.32e-15	NA
7. B	Q21NS8	ATP-dependent lipid A-core flippase	1.79e-11	NA	1.37e-13	NA
7. B	Q00449	Multidrug resistance protein homolog 49	5.35e-07	NA	1.16e-17	NA
7. B	A1URR2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	0.00e+00	NA	9.76e-15	NA
7. B	Q02Z10	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	6.28e-13	NA
7. B	Q8U9B0	Putative ribose/galactose/methyl galactoside import ATP-binding protein 3	4.88e-15	NA	3.23e-12	NA
7. B	Q1RC47	Uncharacterized ABC transporter ATP-binding protein YcjV	2.22e-16	NA	9.94e-12	NA
7. B	Q8FJB1	ATP-dependent lipid A-core flippase	4.11e-11	NA	9.78e-17	NA
7. B	P32721	D-allose import ATP-binding protein AlsA	1.16e-13	NA	1.47e-14	NA
7. B	A0LM36	Macrolide export ATP-binding/permease protein MacB	1.95e-11	NA	2.52e-25	NA
7. B	A0A1U8QKX8	ABC multidrug transporter atrB	1.98e-05	NA	4.63e-04	NA
7. B	Q9KLQ5	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	5.78e-15	NA
7. B	Q0HFA0	Molybdenum import ATP-binding protein ModC	3.82e-14	NA	1.87e-10	NA
7. B	Q92UV5	Fe(3+) ions import ATP-binding protein FbpC 2	3.55e-15	NA	3.88e-14	NA
7. B	O65934	ABC transporter ATP-binding/permease protein Rv1747	1.10e-10	NA	3.76e-13	NA
7. B	Q89EW7	Molybdenum import ATP-binding protein ModC 2	3.77e-07	NA	4.32e-12	NA
7. B	Q608V9	Molybdenum import ATP-binding protein ModC	5.80e-13	NA	8.12e-10	NA
7. B	Q63Q62	sn-glycerol-3-phosphate import ATP-binding protein UgpC	6.66e-16	NA	8.13e-14	NA
7. B	Q8GU83	ABC transporter G family member 41	2.69e-06	NA	3.09e-09	NA
7. B	A1AA20	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	9.87e-11	NA
7. B	Q1GIE5	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.24e-18	NA
7. B	Q5F364	Multidrug resistance-associated protein 1	2.43e-05	NA	2.10e-08	NA
7. B	Q9FF46	ABC transporter G family member 28	9.76e-08	NA	3.16e-04	NA
7. B	B5X0E4	ATP-binding cassette sub-family B member 5	2.61e-07	NA	3.75e-20	NA
7. B	Q9MAH4	ABC transporter G family member 10	1.64e-11	NA	2.29e-18	NA
7. B	Q6EQ60	ABC transporter G family member 47	8.69e-06	NA	1.74e-11	NA
7. B	O14286	Iron-sulfur clusters transporter atm1, mitochondrial	9.70e-11	NA	2.92e-09	NA
7. B	Q9I190	Macrolide export ATP-binding/permease protein MacB	3.64e-12	NA	3.31e-28	NA
7. B	Q1I7I9	Macrolide export ATP-binding/permease protein MacB 2	1.58e-12	NA	2.66e-28	NA
7. B	Q8Z245	sn-glycerol-3-phosphate import ATP-binding protein UgpC	7.77e-16	NA	4.25e-15	NA
7. B	Q8XED0	Macrolide export ATP-binding/permease protein MacB	1.82e-10	NA	9.33e-29	NA
7. B	Q9KUI0	Sulfate/thiosulfate import ATP-binding protein CysA	9.21e-15	NA	1.37e-14	NA
7. B	Q9FLT5	ABC transporter A family member 9	7.82e-10	NA	1.21e-06	NA
7. B	Q4QM77	Galactose/methyl galactoside import ATP-binding protein MglA	1.24e-13	NA	9.47e-10	NA
7. B	P63353	Sulfate/thiosulfate import ATP-binding protein CysA	2.89e-15	NA	1.40e-17	NA
7. B	Q7ANN4	Type I secretion system ATP-binding protein PrsD	3.15e-10	NA	1.90e-12	NA
7. B	Q58639	Uncharacterized ABC transporter ATP-binding protein MJ1242	1.33e-15	NA	2.11e-13	NA
7. B	Q9NP78	ABC-type oligopeptide transporter ABCB9	5.08e-09	NA	5.61e-12	NA
7. B	Q1QTX6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	1.87e-11	NA
7. B	P63390	Probable ATP-binding protein YheS	5.14e-09	NA	2.15e-10	NA
7. B	Q1C1B8	Ribose import ATP-binding protein RbsA	2.88e-13	NA	2.27e-13	NA
7. B	P26362	Cystic fibrosis transmembrane conductance regulator	9.47e-04	NA	1.52e-14	NA
7. B	B6HV31	ABC-type transporter adrC	4.54e-06	NA	5.41e-07	NA
7. B	A0AGP9	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.34e-16	NA
7. B	Q47908	ATP-dependent lipid A-core flippase	5.88e-11	NA	1.11e-15	NA
7. B	Q54QY9	ABC transporter H family member 4	3.49e-02	NA	0.033	NA
7. B	Q8DY60	Putative ABC transporter ATP-binding protein SAG1633	1.17e-13	NA	1.28e-20	NA
7. B	O42943	Uncharacterized ABC transporter ATP-binding protein C16H5.08c	8.42e-10	NA	2.16e-06	NA
7. B	Q61102	Iron-sulfur clusters transporter ABCB7, mitochondrial	3.32e-10	NA	1.46e-12	NA
7. B	Q4WPP6	ABC multidrug transporter mdr2	1.36e-09	NA	7.74e-24	NA
7. B	Q39JR1	Arabinose import ATP-binding protein AraG 1	2.41e-13	NA	2.90e-11	NA
7. B	Q2TXA7	ABC multidrug transporter atrA	6.93e-06	NA	2.82e-06	NA
7. B	A0RBB0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.69e-18	NA
7. B	Q55BC0	ABC transporter A family member 8	5.24e-10	NA	2.58e-11	NA
7. B	Q9KN37	Ribose import ATP-binding protein RbsA	3.49e-13	NA	1.23e-09	NA
7. B	Q324F4	Molybdenum import ATP-binding protein ModC	3.40e-14	NA	4.06e-06	NA
7. B	Q4W9C7	ABC multidrug transporter G	2.55e-06	NA	3.63e-06	NA
7. B	Q2NUA5	ATP-dependent lipid A-core flippase	5.49e-11	NA	1.22e-15	NA
7. B	Q737I0	Putative ABC transporter ATP-binding protein BCE_2668	3.60e-13	NA	2.89e-16	NA
7. B	Q1CDJ0	Ribose import ATP-binding protein RbsA	2.78e-13	NA	2.27e-13	NA
7. B	Q8T9W1	Serine protease/ABC transporter B family protein tagD	1.09e-04	NA	1.71e-15	NA
7. B	Q8U949	Ribose import ATP-binding protein RbsA 2	1.23e-13	NA	2.94e-15	NA
7. B	Q08D64	ATP-binding cassette sub-family B member 6	3.54e-09	NA	1.74e-16	NA
7. B	Q56242	UvrABC system protein A	1.12e-02	NA	0.049	NA
7. B	Q8EAN3	Molybdenum import ATP-binding protein ModC	6.85e-14	NA	2.99e-12	NA
7. B	Q1M589	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	1.11e-16	NA	3.38e-15	NA
7. B	P18767	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.06e-10	NA	6.80e-12	NA
7. B	G7CBF6	Mycobactin import ATP-binding/permease protein IrtB	2.77e-11	NA	1.38e-16	NA
7. B	Q57R58	Macrolide export ATP-binding/permease protein MacB	1.80e-10	NA	1.29e-30	NA
7. B	Q0PAR0	Macrolide export ATP-binding/permease protein MacB	1.79e-09	NA	3.93e-28	NA
7. B	Q55DQ2	ABC transporter G family member 11	1.37e-05	NA	2.20e-05	NA
7. B	Q11C01	Ribose import ATP-binding protein RbsA	1.61e-13	NA	1.58e-14	NA
7. B	F1M3J4	ATP-binding cassette subfamily C member 4	6.81e-06	NA	3.01e-13	NA
7. B	P61222	ATP-binding cassette sub-family E member 1	6.04e-08	NA	3.06e-08	NA
7. B	Q9R1X5	ATP-binding cassette sub-family C member 5	4.01e-06	NA	3.13e-06	NA
7. B	Q884D4	Macrolide export ATP-binding/permease protein MacB 1	5.41e-10	NA	2.44e-24	NA
7. B	Q8P8W4	ATP-dependent lipid A-core flippase	3.15e-11	NA	6.10e-14	NA
7. B	Q9ESR9	ATP-binding cassette sub-family A member 2	2.39e-04	NA	2.08e-09	NA
7. B	Q9RDI1	Ribose import ATP-binding protein RbsA 2	1.04e-12	NA	3.05e-10	NA
7. B	A1C8C8	ABC-type transporter oblD	4.96e-06	NA	1.11e-07	NA
7. B	J9VWU3	Iron-sulfur clusters transporter ATM1, mitochondrial	3.64e-10	NA	5.97e-15	NA
7. B	Q65UW1	Galactose/methyl galactoside import ATP-binding protein MglA	2.88e-13	NA	4.18e-09	NA
7. B	Q8E3S6	Putative ABC transporter ATP-binding protein gbs1680	9.66e-14	NA	1.12e-19	NA
7. B	Q9FWX8	ABC transporter B family member 12	9.46e-07	NA	3.98e-16	NA
7. B	Q2T4B3	Macrolide export ATP-binding/permease protein MacB	1.97e-10	NA	2.13e-26	NA
7. B	Q1MAB5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.71e-11	NA	6.25e-15	NA
7. B	Q63120	ATP-binding cassette sub-family C member 2	2.02e-05	NA	7.21e-10	NA
7. B	Q0BG60	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	2.37e-13	NA	1.89e-10	NA
7. B	Q7PC87	ABC transporter G family member 34	9.77e-06	NA	2.36e-08	NA
7. B	Q1CNC6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	4.47e-18	NA
7. B	P47260	Putative ABC transporter ATP-binding protein MG014	2.97e-10	NA	5.87e-06	NA
7. B	Q0I3Y9	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.53e-15	NA
7. B	Q0TI47	Uncharacterized ABC transporter ATP-binding protein YcjV	3.33e-16	NA	1.18e-11	NA
7. B	Q7N6F9	Macrolide export ATP-binding/permease protein MacB	6.41e-11	NA	7.56e-30	NA
7. B	Q7FB56	Putative ABC transporter C family member 15	2.08e-07	NA	1.08e-09	NA
7. B	Q1JUP7	Arabinose import ATP-binding protein AraG	1.48e-13	NA	8.18e-12	NA
7. B	Q48GY7	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.74e-13	NA	2.23e-10	NA
7. B	A1B677	Macrolide export ATP-binding/permease protein MacB 1/2	1.86e-13	NA	7.37e-32	NA
7. B	P9WQK3	Energy-dependent translational throttle protein EttA	1.03e-06	NA	4.12e-10	NA
7. B	Q2EHL8	Macrolide export ATP-binding/permease protein MacB	1.66e-09	NA	1.65e-26	NA
7. B	Q6NDQ0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	1.00e-10	NA
7. B	J9VPA2	ABC multidrug transporter AFR2	8.65e-06	NA	1.01e-08	NA
7. B	Q57180	Uncharacterized ABC transporter ATP-binding protein HI_1051	1.57e-10	NA	3.71e-17	NA
7. B	Q9PR37	Spermidine/putrescine import ATP-binding protein PotA	1.62e-07	NA	8.84e-07	NA
7. B	Q57SD6	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	4.22e-15	NA	5.83e-18	NA
7. B	Q8CF82	Cholesterol transporter ABCA5	5.73e-06	NA	5.26e-09	NA
7. B	Q99ZS8	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.42e-10	NA
7. B	Q9RR46	Glycine betaine/carnitine transport ATP-binding protein GbuA	1.11e-16	NA	1.74e-08	NA
7. B	Q8XXB6	ATP-dependent lipid A-core flippase	1.47e-11	NA	3.51e-18	NA
7. B	Q7NZU6	ATP-dependent lipid A-core flippase	2.37e-11	NA	1.81e-15	NA
7. B	J9VME1	ABC multidrug transporter AFR1	5.63e-06	NA	2.21e-06	NA
7. B	P35071	Cystic fibrosis transmembrane conductance regulator	7.01e-05	NA	1.93e-12	NA
7. B	Q9EXN5	Probable microcin-H47 secretion/processing ATP-binding protein MchF	1.80e-08	NA	4.36e-09	NA
7. B	Q5E0T4	Molybdenum import ATP-binding protein ModC	1.27e-13	NA	6.20e-11	NA
7. B	O34863	UvrABC system protein A	2.68e-02	NA	0.027	NA
7. B	Q98M36	UvrABC system protein A	1.34e-02	NA	2.61e-04	NA
7. B	Q2QLB4	Cystic fibrosis transmembrane conductance regulator	9.94e-04	NA	2.58e-12	NA
7. B	O34512	Uncharacterized ABC transporter ATP-binding protein YfmM	1.52e-06	NA	6.54e-10	NA
7. B	Q0S9A4	Ribose import ATP-binding protein RbsA	6.55e-14	NA	1.65e-09	NA
7. B	Q2YU20	Putative multidrug export ATP-binding/permease protein SAB1799c	1.05e-11	NA	1.66e-18	NA
7. B	Q0BIE1	Arabinose import ATP-binding protein AraG 1	2.79e-13	NA	5.17e-11	NA
7. B	P54683	Serine protease/ABC transporter B family protein tagB	1.88e-04	NA	1.11e-11	NA
7. B	P62134	DNA double-strand break repair Rad50 ATPase	3.38e-01	NA	0.025	NA
7. B	Q933I3	Leukotoxin translocation ATP-binding protein LktB	6.84e-10	NA	2.56e-16	NA
7. B	Q5HQ70	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	3.49e-14	NA
7. B	P57552	Multidrug resistance-like ATP-binding protein MdlB	2.97e-12	NA	1.11e-07	NA
7. B	Q8FDZ8	Alpha-hemolysin translocation ATP-binding protein HlyB	7.15e-10	NA	4.89e-17	NA
7. B	Q3YUV0	Maltose/maltodextrin import ATP-binding protein MalK	5.55e-16	NA	1.10e-16	NA
7. B	Q9ZR72	ABC transporter B family member 1	1.24e-06	NA	4.77e-20	NA
7. B	Q03PF2	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	3.33e-14	NA
7. B	P0CZ41	UvrABC system protein A	1.19e-02	NA	0.009	NA
7. B	Q92UI2	Ribose import ATP-binding protein RbsA 3	1.58e-13	NA	1.89e-13	NA
7. B	Q108U0	Cystic fibrosis transmembrane conductance regulator	5.89e-05	NA	2.79e-12	NA
7. B	Q0TIU8	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	8.73e-11	NA
7. B	Q3Z2S7	Arabinose import ATP-binding protein AraG	1.69e-13	NA	3.94e-13	NA
7. B	Q9DC29	ATP-binding cassette sub-family B member 6	5.54e-09	NA	1.32e-14	NA
7. B	Q2IXX0	Macrolide export ATP-binding/permease protein MacB	4.50e-13	NA	5.66e-29	NA
7. B	Q27256	Protein white	5.24e-10	NA	1.45e-13	NA
7. B	Q76CU2	Pleiotropic drug resistance protein 1	2.62e-06	NA	1.66e-08	NA
7. B	Q92W60	Ribose import ATP-binding protein RbsA 2	1.87e-13	NA	1.95e-11	NA
7. B	O86751	Fe(3+) ions import ATP-binding protein FbpC	2.78e-15	NA	2.13e-19	NA
7. B	Q9KLL9	Molybdenum import ATP-binding protein ModC	2.63e-14	NA	1.56e-11	NA
7. B	Q9AT00	Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic	5.55e-16	NA	6.73e-16	NA
7. B	P0DKX5	Cyclolysin secretion/processing ATP-binding protein CyaB	2.20e-09	NA	2.52e-13	NA
7. B	Q2K2X0	Molybdenum import ATP-binding protein ModC	7.14e-13	NA	9.43e-13	NA
7. B	Q57RB2	Glutathione import ATP-binding protein GsiA	1.32e-14	NA	4.02e-09	NA
7. B	P54719	Uncharacterized ABC transporter ATP-binding protein YfiC	1.15e-10	NA	5.57e-11	NA
7. B	P32386	ATP-dependent bile acid permease	2.90e-05	NA	2.67e-10	NA
7. B	P43535	Protein GCN20	1.59e-08	NA	4.75e-17	NA
7. B	Q2PCF1	Pleiotropic drug resistance protein 2	1.25e-05	NA	1.47e-07	NA
7. B	Q39E73	ATP-dependent lipid A-core flippase	7.65e-11	NA	5.20e-15	NA
7. B	Q1JGY7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.94e-10	NA
7. B	Q2KAW9	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	6.22e-15	NA	3.00e-07	NA
7. B	Q54VC1	ABC transporter C family member 15	1.01e-05	NA	2.49e-05	NA
7. B	Q9FWX7	ABC transporter B family member 11	7.04e-07	NA	9.31e-17	NA
7. B	Q0I2Z4	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	2.76e-16	NA
7. B	O80946	ABC transporter G family member 1	8.40e-11	NA	2.53e-14	NA
7. B	Q5LYN4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.77e-13	NA
7. B	Q2SZC2	Arabinose import ATP-binding protein AraG 1	2.74e-13	NA	4.49e-10	NA
7. B	Q6CX96	Iron-sulfur clusters transporter ATM1, mitochondrial	5.81e-10	NA	6.47e-15	NA
7. B	Q4KJB2	ATP-dependent lipid A-core flippase	1.86e-11	NA	2.02e-15	NA
7. B	P22520	Colicin V secretion/processing ATP-binding protein CvaB	2.45e-08	NA	5.82e-07	NA
7. B	Q1CNR8	Maltose/maltodextrin import ATP-binding protein MalK	4.55e-15	NA	6.43e-15	NA
7. B	Q63P06	Ribose import ATP-binding protein RbsA	3.25e-13	NA	1.03e-07	NA
7. B	Q1C951	Molybdenum import ATP-binding protein ModC	6.04e-14	NA	1.35e-10	NA
7. B	Q8X6W1	Glutathione import ATP-binding protein GsiA	1.38e-13	NA	7.63e-10	NA
7. B	Q6YPR6	Spermidine/putrescine import ATP-binding protein PotA	5.01e-14	NA	5.19e-14	NA
7. B	P16875	Multidrug resistance protein 1 (Fragment)	7.95e-07	NA	0.002	NA
7. B	Q8G0T8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	9.40e-11	NA	1.13e-12	NA
7. B	Q48J29	Molybdenum import ATP-binding protein ModC	1.73e-13	NA	1.10e-10	NA
7. B	P23212	Erythromycin resistance ATP-binding protein MsrA	1.68e-08	NA	0.002	NA
7. B	O42690	Opaque-specific ABC transporter CDR3	5.68e-06	NA	1.05e-07	NA
7. B	Q54W20	ABC transporter D family member 3	3.85e-07	NA	3.55e-05	NA
7. B	Q2IBE4	Cystic fibrosis transmembrane conductance regulator	6.93e-05	NA	2.49e-12	NA
7. B	Q9PAR9	UvrABC system protein A	1.20e-02	NA	0.050	NA
7. B	Q4K681	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	2.40e-14	NA
7. B	P0CL92	Iron-sulfur clusters transporter ATM1, mitochondrial	2.26e-10	NA	2.81e-15	NA
7. B	Q9NUQ8	ATP-binding cassette sub-family F member 3	7.27e-09	NA	1.57e-05	NA
7. B	O84337	UvrABC system protein A	1.65e-01	NA	0.002	NA
7. B	Q0TNZ3	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.93e-13	NA
7. B	A1USS5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.82e-11	NA	1.60e-14	NA
7. B	Q00552	Cystic fibrosis transmembrane conductance regulator	5.79e-05	NA	1.43e-11	NA
7. B	Q3J3V9	Ribose import ATP-binding protein RbsA	6.23e-14	NA	5.36e-08	NA
7. B	Q7W1F4	Molybdenum import ATP-binding protein ModC	1.09e-12	NA	8.04e-06	NA
7. B	Q6LKD4	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	5.14e-16	NA
7. B	Q8K448	Cholesterol transporter ABCA5	5.67e-06	NA	1.23e-08	NA
7. B	Q46577	UvrABC system protein A	1.84e-02	NA	0.013	NA
7. B	A1A9B7	Macrolide export ATP-binding/permease protein MacB 1	1.80e-10	NA	2.18e-29	NA
7. B	P0A4W5	Uncharacterized ABC transporter ATP-binding protein Mb1304c	3.45e-11	NA	2.37e-11	NA
7. B	Q9NGP5	ABC transporter G family member 2	7.77e-06	NA	2.17e-14	NA
7. B	P0C529	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	5.43e-11	NA	5.90e-13	NA
7. B	O93796	Elongation factor 3	7.11e-03	NA	1.52e-04	NA
7. B	Q9PK60	UvrABC system protein A	1.53e-01	NA	0.001	NA
7. B	Q6HG98	Putative ABC transporter ATP-binding protein BT9727_3105	4.96e-13	NA	1.72e-19	NA
7. B	Q66H39	ATP-binding cassette sub-family F member 3	6.34e-09	NA	1.78e-05	NA
7. B	Q8G847	Fructose import ATP-binding protein FruK	1.47e-13	NA	8.45e-10	NA
7. B	Q8YIT2	Macrolide export ATP-binding/permease protein MacB	4.56e-10	NA	1.55e-27	NA
7. B	P14788	Sulfate/thiosulfate import ATP-binding protein CysA	0.00e+00	NA	6.02e-15	NA
7. B	Q2YRG7	Macrolide export ATP-binding/permease protein MacB	4.77e-10	NA	2.92e-27	NA
7. B	Q87HN4	Molybdenum import ATP-binding protein ModC	7.53e-14	NA	2.18e-14	NA
7. B	Q8GU82	ABC transporter G family member 45	4.68e-06	NA	1.14e-07	NA
7. B	P16532	Leukotoxin translocation ATP-binding protein LktB	1.47e-09	NA	4.58e-17	NA
7. B	Q8TQ05	Putative ABC transporter ATP-binding protein MA_1747	4.98e-13	NA	2.15e-19	NA
7. B	Q93FH3	Leukotoxin translocation ATP-binding protein LktB	1.46e-09	NA	4.33e-17	NA
7. B	Q5PJL1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	2.91e-15	NA
7. B	Q9FKF2	ABC transporter A family member 11	7.30e-10	NA	1.35e-06	NA
7. B	Q7W9N7	ATP-dependent lipid A-core flippase	5.22e-11	NA	6.77e-12	NA
7. B	P40550	ATP-dependent permease PDR11	1.49e-05	NA	1.60e-05	NA
7. B	Q7CHI2	Macrolide export ATP-binding/permease protein MacB 1	2.19e-10	NA	1.35e-30	NA
7. B	Q0K998	sn-glycerol-3-phosphate import ATP-binding protein UgpC	5.55e-16	NA	6.59e-16	NA
7. B	Q97UY8	Glucose import ATP-binding protein GlcV	9.99e-16	NA	1.51e-18	NA
7. B	Q9ZUU9	ABC transporter G family member 3	4.59e-10	NA	8.52e-11	NA
7. B	Q54T02	ABC transporter G family member 24	3.03e-07	NA	1.29e-10	NA
7. B	Q8D0W8	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	2.01e-20	NA
7. B	Q8UKE4	Macrolide export ATP-binding/permease protein MacB	2.52e-10	NA	2.02e-28	NA
7. B	Q2YKX3	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	7.32e-14	NA
7. B	Q89TQ9	Molybdenum import ATP-binding protein ModC 1	1.46e-12	NA	0.005	NA
7. B	Q2QL83	Cystic fibrosis transmembrane conductance regulator	9.60e-04	NA	1.29e-11	NA
7. B	Q4WUS1	ABC multidrug transporter I	3.90e-05	NA	1.17e-05	NA
7. B	Q4WD46	ABC-type transporter fsqE	1.03e-06	NA	5.02e-12	NA
7. B	Q9CP98	Ribose import ATP-binding protein RbsA 1	4.16e-13	NA	3.51e-11	NA
7. B	Q3KJ31	ATP-dependent lipid A-core flippase	1.96e-11	NA	2.59e-14	NA
7. B	Q6Y306	ATP-binding cassette sub-family C member 12	3.60e-06	NA	5.40e-12	NA
7. B	P9WQI9	Hydrophilic compounds import ATP-binding/permease protein BacA	1.04e-07	NA	2.64e-05	NA
7. B	Q5RKI8	Mitochondrial potassium channel ATP-binding subunit	3.17e-10	NA	2.52e-16	NA
7. B	Q8Z864	Glutathione import ATP-binding protein GsiA	1.68e-13	NA	4.21e-09	NA
7. B	Q8ELR4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.62e-13	NA
7. B	Q4FS42	ATP-dependent lipid A-core flippase	2.98e-11	NA	1.17e-17	NA
7. B	A0A0U1LQE1	ABC transporter cctS	9.80e-06	NA	1.06e-06	NA
7. B	Q0HHH4	ATP-dependent lipid A-core flippase	9.91e-11	NA	4.44e-17	NA
7. B	Q9M0G9	ABC transporter B family member 24, mitochondrial	1.05e-10	NA	1.60e-17	NA
7. B	Q2K6Q4	Zinc import ATP-binding protein ZnuC	2.22e-16	NA	3.17e-13	NA
7. B	Q7NX01	Sulfate/thiosulfate import ATP-binding protein CysA 1	5.55e-16	NA	1.42e-15	NA
7. B	Q1CJS9	Fe(3+) ions import ATP-binding protein FbpC	3.40e-14	NA	2.86e-14	NA
7. B	A3CMQ7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.72e-12	NA
7. B	A0A2U8U2K9	ABC transporter asL7	1.72e-05	NA	6.12e-09	NA
7. B	P0CZ34	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.02e-10	NA
7. B	Q06034	Multidrug resistance protein 1	1.39e-06	NA	1.33e-15	NA
7. B	G5EE72	Multidrug resistance-associated protein 5	1.52e-06	NA	2.13e-09	NA
7. B	P23596	Proteases secretion ATP-binding protein PrtD	7.22e-11	NA	4.88e-10	NA
7. B	Q09427	ATP-binding cassette sub-family C member 8	2.32e-05	NA	4.30e-08	NA
7. B	Q8K268	ATP-binding cassette sub-family F member 3	6.97e-09	NA	5.45e-06	NA
7. B	Q7VUJ5	Molybdenum import ATP-binding protein ModC	1.09e-12	NA	7.89e-06	NA
7. B	P68579	SPbeta prophage-derived sublancin-168-processing and transport ATP-binding protein SunT	8.64e-08	NA	0.005	NA
7. B	Q2QV81	ABC transporter G family member 49	1.34e-05	NA	4.95e-07	NA
7. B	Q32DZ9	Macrolide export ATP-binding/permease protein MacB	1.11e-10	NA	8.99e-30	NA
7. B	Q2FRT7	Energy-coupling factor transporter ATP-binding protein EcfA2	3.33e-16	NA	6.05e-26	NA
7. B	P14175	Glycine betaine/proline betaine transport system ATP-binding protein ProV	0.00e+00	NA	2.53e-15	NA
7. B	K0E4D9	ABC transporter ecdL	2.28e-05	NA	7.53e-09	NA
7. B	Q6MPX9	Macrolide export ATP-binding/permease protein MacB	5.64e-13	NA	8.17e-23	NA
7. B	Q8UBN2	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	5.54e-14	NA	4.29e-13	NA
7. B	Q07DV2	Cystic fibrosis transmembrane conductance regulator	6.79e-05	NA	2.79e-12	NA
7. B	Q4UJW4	UvrABC system protein A	1.08e-02	NA	1.15e-04	NA
7. B	O07550	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI	2.21e-10	NA	9.64e-11	NA
7. B	Q2QLF9	Cystic fibrosis transmembrane conductance regulator	1.03e-03	NA	2.71e-12	NA
7. B	Q5KYQ7	Putative ribose/galactose/methyl galactoside import ATP-binding protein	4.74e-14	NA	7.04e-14	NA
7. B	Q7WGW1	Sulfate/thiosulfate import ATP-binding protein CysA	2.22e-16	NA	2.98e-15	NA
7. B	Q3YW77	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.55e-15	NA	1.04e-16	NA
7. B	Q5W274	Pleiotropic drug resistance protein 3	2.38e-06	NA	9.71e-10	NA
7. B	Q98G43	Fe(3+) ions import ATP-binding protein FbpC	7.99e-15	NA	8.98e-18	NA
7. B	Q8NZJ2	UvrABC system protein A	1.38e-02	NA	0.009	NA
7. B	Q8YM92	Spermidine/putrescine import ATP-binding protein PotA	2.44e-15	NA	1.01e-11	NA
7. B	Q32IG0	Molybdenum import ATP-binding protein ModC	3.59e-14	NA	4.02e-06	NA
7. B	Q8GU87	ABC transporter G family member 31	7.84e-06	NA	1.40e-09	NA
7. B	P9WQI2	Trehalose import ATP-binding protein SugC	6.66e-16	NA	2.32e-14	NA
7. B	Q5FA19	Fe(3+) ions import ATP-binding protein FbpC	3.22e-15	NA	1.93e-21	NA
7. B	Q0B5V4	Arabinose import ATP-binding protein AraG 2	2.69e-13	NA	2.42e-12	NA
7. B	P0A698	UvrABC system protein A	1.22e-02	NA	5.07e-04	NA
7. B	Q3B5J7	Macrolide export ATP-binding/permease protein MacB	1.73e-09	NA	1.82e-19	NA
7. B	P45861	Uncharacterized ABC transporter ATP-binding protein YwjA	1.63e-11	NA	2.10e-17	NA
7. B	B2RX12	ATP-binding cassette sub-family C member 3	1.46e-05	NA	4.58e-07	NA
7. B	P63392	Mycobactin import ATP-binding/permease protein IrtA	3.31e-08	NA	1.07e-12	NA
7. B	O15440	ATP-binding cassette sub-family C member 5	4.46e-06	NA	2.58e-06	NA
7. B	O15438	ATP-binding cassette sub-family C member 3	2.00e-05	NA	3.31e-08	NA
7. B	P19566	Maltose/maltodextrin import ATP-binding protein MalK	4.00e-15	NA	1.33e-15	NA
7. B	Q8GU89	ABC transporter G family member 37	8.44e-06	NA	2.31e-10	NA
7. B	Q2K342	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.43e-11	NA	5.36e-18	NA
7. B	Q9S472	L-arabinose transport ATP-binding protein AraG	8.56e-13	NA	1.02e-13	NA
7. B	Q5MB13	Broad substrate specificity ATP-binding cassette transporter ABCG2	2.82e-11	NA	1.60e-12	NA
7. B	Q54BU4	ABC transporter B family member 1	1.87e-08	NA	2.09e-17	NA
7. B	Q0RYP7	Fe(3+) ions import ATP-binding protein FbpC 3	1.78e-15	NA	1.41e-17	NA
7. B	Q0D9V6	Protein STAR1	0.00e+00	NA	1.64e-18	NA
7. B	A0A125QXJ1	ATP-binding cassette sub-family B member 6	5.47e-09	NA	1.88e-14	NA
7. B	P63360	ATP-dependent lipid A-core flippase	6.19e-11	NA	4.61e-16	NA
7. B	Q83LR7	Macrolide export ATP-binding/permease protein MacB	1.71e-10	NA	4.93e-29	NA
7. B	Q8T690	ABC transporter G family member 3	8.92e-06	NA	3.31e-09	NA
7. B	Q9FLT4	ABC transporter A family member 10	1.65e-09	NA	6.91e-09	NA
7. B	Q4QK57	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	2.14e-14	NA
7. B	Q7MHB5	UvrABC system protein A	1.15e-02	NA	0.005	NA
7. B	Q16928	Protein white	3.72e-09	NA	3.99e-12	NA
7. B	Q81PZ8	Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461	6.39e-13	NA	3.41e-17	NA
7. B	Q1CN15	Autoinducer 2 import ATP-binding protein LsrA	8.20e-14	NA	8.78e-12	NA
7. B	P28288	ATP-binding cassette sub-family D member 3	5.63e-08	NA	5.82e-05	NA
7. B	Q2J1U0	Molybdenum import ATP-binding protein ModC	2.02e-12	NA	4.13e-14	NA
7. B	Q399M3	Macrolide export ATP-binding/permease protein MacB	2.03e-10	NA	1.06e-28	NA
7. B	Q24XJ2	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.75e-12	NA
7. B	B9GDE5	ABC transporter G family member 50	1.82e-06	NA	1.40e-09	NA
7. B	Q04473	Toxin RTX-III translocation ATP-binding protein	1.96e-09	NA	2.14e-16	NA
7. B	Q8ZGX6	Molybdenum import ATP-binding protein ModC	4.76e-14	NA	1.35e-10	NA
7. B	Q6G868	Putative multidrug export ATP-binding/permease protein SAS1788	1.74e-11	NA	3.45e-19	NA
7. B	Q86UK0	Glucosylceramide transporter ABCA12	1.99e-04	NA	1.59e-08	NA
7. B	Q13BH6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.16e-11	NA	1.90e-14	NA
7. B	Q5ANA3	Pleiotropic ABC efflux transporter of multiple drugs CDR1	4.85e-06	NA	1.25e-07	NA
7. B	O15439	ATP-binding cassette sub-family C member 4	6.62e-06	NA	2.82e-15	NA
7. B	Q933E0	Leukotoxin translocation ATP-binding protein LktB	7.84e-10	NA	4.33e-17	NA
7. B	Q5P4W2	Molybdenum import ATP-binding protein ModC	1.25e-12	NA	1.28e-09	NA
7. B	P44785	Methionine import ATP-binding protein MetN	NA	NA	1.96e-24	NA
7. B	Q60AI1	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	1.60e-13	NA
7. B	Q5KYS1	Xylose import ATP-binding protein XylG	9.06e-14	NA	3.22e-09	NA
7. B	Q88QK7	UvrABC system protein A	1.26e-02	NA	0.014	NA
7. B	Q4WLN7	Iron-sulfur clusters transporter atm1, mitochondrial	3.20e-10	NA	9.77e-12	NA
7. B	Q8X8K4	Uncharacterized ABC transporter ATP-binding protein YcjV	5.55e-16	NA	1.51e-11	NA
7. B	Q1RD28	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	9.87e-11	NA
7. B	Q5RFQ9	Mitochondrial potassium channel ATP-binding subunit	2.67e-10	NA	3.01e-15	NA
7. B	P41820	Brefeldin A resistance protein	9.51e-06	NA	2.96e-05	NA
7. B	Q8FJL0	Glutathione import ATP-binding protein GsiA	1.42e-13	NA	2.77e-09	NA
7. B	Q6FYL0	Macrolide export ATP-binding/permease protein MacB	3.00e-13	NA	3.42e-30	NA
7. B	P09833	Molybdenum import ATP-binding protein ModC	3.19e-14	NA	1.89e-06	NA
7. B	Q31ZK0	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.42e-10	NA
7. B	Q3J7R8	ATP-dependent lipid A-core flippase	2.96e-10	NA	8.75e-15	NA
7. B	Q8H8V7	ABC transporter G family member 5	1.42e-10	NA	5.16e-11	NA
7. B	Q03203	Nisin transport ATP-binding protein NisT	3.01e-10	NA	1.43e-12	NA
7. B	Q74R28	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	4.47e-18	NA
7. B	Q1WVI7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.94e-16	NA
7. B	Q89A96	Multidrug resistance-like ATP-binding protein MdlB	3.59e-12	NA	3.50e-11	NA
7. B	Q9C8G9	ABC transporter C family member 1	2.53e-05	NA	1.10e-07	NA
7. B	Q93FH2	Leukotoxin translocation ATP-binding protein LktB	8.97e-10	NA	4.58e-17	NA
7. B	Q8D740	Molybdenum import ATP-binding protein ModC	5.27e-14	NA	2.27e-11	NA
7. B	B8ALI0	ABC transporter G family member 5	8.36e-11	NA	5.16e-11	NA
7. B	Q5H0H0	ATP-dependent lipid A-core flippase	9.53e-12	NA	2.90e-13	NA
7. B	Q9FIB4	ABC transporter F family member 2	3.60e-09	NA	5.58e-14	NA
7. B	Q5HQW9	UvrABC system protein A	1.30e-02	NA	0.039	NA
7. B	Q00PJ2	Cystic fibrosis transmembrane conductance regulator	1.09e-03	NA	3.90e-12	NA
7. B	P26363	Cystic fibrosis transmembrane conductance regulator	6.69e-05	NA	3.37e-11	NA
7. B	Q9M3B9	ABC transporter B family member 20	1.27e-06	NA	3.04e-16	NA
7. B	Q6F9A8	Sulfate/thiosulfate import ATP-binding protein CysA	2.22e-16	NA	4.15e-17	NA
7. B	Q2QLE5	Cystic fibrosis transmembrane conductance regulator	6.59e-05	NA	2.40e-12	NA
7. B	Q92337	ATP-binding cassette transporter abc1	1.44e-05	NA	6.18e-09	NA
7. B	Q54RU1	ABC transporter B family member 6	2.11e-10	NA	2.47e-12	NA
7. B	Q54W19	ABC transporter D family member 1	3.05e-07	NA	2.22e-04	NA
7. B	Q57R14	ATP-dependent lipid A-core flippase	4.51e-11	NA	4.61e-16	NA
7. B	Q1BZA2	Arabinose import ATP-binding protein AraG 1	2.60e-13	NA	3.50e-12	NA
7. B	Q2W1R8	Molybdenum import ATP-binding protein ModC	8.76e-14	NA	1.42e-08	NA
7. B	Q6FWS5	Pleiotropic ABC efflux transporter of multiple drugs YBT1	2.87e-05	NA	1.34e-11	NA
7. B	Q8UF86	UvrABC system protein A	1.09e-02	NA	0.003	NA
7. B	Q52402	Transport ATP-binding protein AarD	3.77e-10	NA	3.36e-10	NA
7. B	Q8R4P9	ATP-binding cassette sub-family C member 10	6.77e-06	NA	7.91e-08	NA
7. B	P70864	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.96e-11	NA	1.57e-14	NA
7. B	P25371	Probable ATP-dependent permease	7.62e-08	NA	6.02e-12	NA
7. B	B0R5G4	Cobalamin import ATP-binding protein BtuD	4.44e-16	NA	5.58e-19	NA
7. B	Q668K6	Sulfate/thiosulfate import ATP-binding protein CysA	8.88e-16	NA	3.06e-20	NA
7. B	Q8UBB7	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	2.44e-15	NA	2.16e-12	NA
7. B	Q65T42	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	1.58e-17	NA
7. B	A6TEB8	Autoinducer 2 import ATP-binding protein LsrA	2.66e-15	NA	1.80e-12	NA
7. B	Q54NL1	ABC transporter C family member 9	3.96e-06	NA	1.46e-10	NA
7. B	O06476	Uncharacterized ABC transporter ATP-binding protein YfmR	2.34e-08	NA	3.27e-13	NA
7. B	Q0TC10	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.33e-15	NA	3.30e-15	NA
7. B	P37009	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	2.59e-18	NA
7. B	P0A9W5	Energy-dependent translational throttle protein EttA	1.10e-05	NA	2.53e-13	NA
7. B	B1IRU7	Autoinducer 2 import ATP-binding protein LsrA	2.65e-14	NA	4.52e-10	NA
7. B	Q6D8T5	Macrolide export ATP-binding/permease protein MacB	1.12e-10	NA	6.00e-33	NA
7. B	Q71WU0	UvrABC system protein A	2.73e-02	NA	0.021	NA
7. B	Q7JII8	Cystic fibrosis transmembrane conductance regulator	6.79e-05	NA	1.83e-12	NA
7. B	Q1M360	Ribose import ATP-binding protein RbsA 3	1.67e-13	NA	5.02e-14	NA
7. B	Q1QBW0	ATP-dependent lipid A-core flippase	3.13e-11	NA	2.63e-18	NA
7. B	Q9C7F2	ABC transporter B family member 14	4.72e-07	NA	7.07e-20	NA
7. B	Q9LZB8	ABC transporter B family member 29, chloroplastic	1.53e-10	NA	3.21e-13	NA
7. B	Q08381	Molybdenum import ATP-binding protein ModC	2.04e-12	NA	7.26e-15	NA
7. B	Q9L0Q1	Diacetylchitobiose uptake system ATP-binding protein MsiK	1.11e-16	NA	5.72e-12	NA
7. B	P75094	Putative ABC transporter ATP-binding protein MG015 homolog	1.17e-10	NA	1.55e-08	NA
7. B	Q99PE8	ATP-binding cassette sub-family G member 5	2.21e-11	NA	1.32e-14	NA
7. B	Q9JUX4	Sulfate/thiosulfate import ATP-binding protein CysA	2.22e-16	NA	5.06e-17	NA
7. B	Q896Y2	Galactose/methyl galactoside import ATP-binding protein MglA	1.38e-13	NA	1.25e-06	NA
7. B	Q32IB5	Glutathione import ATP-binding protein GsiA	1.63e-13	NA	1.59e-09	NA
7. B	P12866	Alpha-factor-transporting ATPase	3.31e-07	NA	1.13e-11	NA
7. B	Q5U820	Cystic fibrosis transmembrane conductance regulator	5.44e-05	NA	1.18e-12	NA
7. B	Q2P3E7	ATP-dependent lipid A-core flippase	8.15e-12	NA	2.90e-13	NA
7. B	P44884	Galactose/methyl galactoside import ATP-binding protein MglA	1.33e-13	NA	9.47e-10	NA
7. B	Q93FH0	Leukotoxin translocation ATP-binding protein LktB	6.45e-10	NA	4.09e-17	NA
7. B	Q6G194	sn-glycerol-3-phosphate import ATP-binding protein UgpC	0.00e+00	NA	5.39e-16	NA
7. B	Q8CK44	Ribose import ATP-binding protein RbsA 1	5.04e-14	NA	3.95e-11	NA
7. B	O74676	ABC transporter CDR4	3.86e-06	NA	1.04e-05	NA
7. B	Q9KIF7	Glycine betaine transport ATP-binding protein OpuAA	1.04e-13	NA	9.21e-13	NA
7. B	Q7NUJ3	Macrolide export ATP-binding/permease protein MacB	1.03e-09	NA	2.84e-28	NA
7. B	P63389	Probable ATP-binding protein YheS	5.02e-09	NA	2.15e-10	NA
7. B	Q87EF0	ATP-dependent lipid A-core flippase	6.41e-12	NA	3.50e-14	NA
7. B	O60706	ATP-binding cassette sub-family C member 9	1.83e-05	NA	3.46e-10	NA
7. B	Q6FIK3	Iron-sulfur clusters transporter ATM1, mitochondrial	3.90e-10	NA	1.07e-14	NA
7. B	Q7A4T3	Putative multidrug export ATP-binding/permease protein SA1683	1.56e-11	NA	3.45e-19	NA
7. B	Q5MK06	Macrolide export ATP-binding/permease protein MacB	5.83e-10	NA	3.07e-23	NA
7. B	Q9X196	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	3.83e-15	NA
7. B	Q1MBG4	Arabinose import ATP-binding protein AraG	5.77e-14	NA	6.44e-09	NA
7. B	A0K4E8	Arabinose import ATP-binding protein AraG 1	3.59e-13	NA	3.50e-12	NA
7. B	P75796	Glutathione import ATP-binding protein GsiA	1.05e-14	NA	5.76e-09	NA
7. B	Q57GZ7	Maltose/maltodextrin import ATP-binding protein MalK	4.88e-15	NA	1.33e-15	NA
7. B	Q2YPX5	UvrABC system protein A	1.28e-02	NA	1.33e-04	NA
7. B	A3PRY1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	1.07e-14	NA
7. B	Q3MAR5	Spermidine/putrescine import ATP-binding protein PotA	1.55e-15	NA	1.10e-11	NA
7. B	Q5HGY5	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	1.99e-10	NA
7. B	Q8XAY7	Autoinducer 2 import ATP-binding protein LsrA	2.15e-14	NA	4.69e-10	NA
7. B	P34358	ABC transporter ced-7	2.93e-06	NA	2.51e-10	NA
7. B	Q9Z985	UvrABC system protein A	1.71e-01	NA	0.009	NA
7. B	P82451	ATP-binding cassette sub-family C member 9	1.68e-05	NA	2.11e-09	NA
7. B	Q7A342	Putative ABC transporter ATP-binding protein SA2476	9.75e-13	NA	5.11e-23	NA
7. B	Q5L222	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.77e-15	NA
7. B	Q99Y84	UvrABC system protein A	1.34e-02	NA	0.008	NA
7. B	Q2ULH4	Iron-sulfur clusters transporter atm1, mitochondrial	1.40e-10	NA	7.11e-11	NA
7. B	Q55774	Uncharacterized ABC transporter ATP-binding protein sll0182	1.38e-08	NA	9.68e-09	NA
7. B	Q31VH5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.22e-15	NA	1.05e-16	NA
7. B	Q0TQU8	Galactose/methyl galactoside import ATP-binding protein MglA	2.07e-13	NA	6.55e-13	NA
7. B	A0R6H8	Mycobactin import ATP-binding/permease protein IrtA	5.19e-08	NA	7.10e-13	NA
7. B	Q2K204	Ribose import ATP-binding protein RbsA 2	1.25e-13	NA	8.49e-15	NA
7. B	P33310	ATP-dependent permease MDL1, mitochondrial	8.70e-10	NA	3.80e-17	NA
7. B	P69876	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	8.73e-11	NA
7. B	Q8DAV2	ATP-dependent lipid A-core flippase	7.31e-12	NA	2.68e-17	NA
7. B	P91660	Probable multidrug resistance-associated protein lethal(2)03659	1.15e-05	NA	4.27e-10	NA
7. B	Q8GZ52	ABC transporter G family member 30	1.76e-06	NA	2.72e-11	NA
7. B	Q8G838	Putative ABC transporter ATP-binding protein BL0043	1.27e-09	NA	9.23e-16	NA
7. B	Q55GB1	ABC transporter G family member 15	4.82e-06	NA	5.04e-07	NA
7. B	Q830W6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.40e-12	NA
7. B	P59852	Lactococcin-G-processing and transport ATP-binding protein LagD	2.14e-09	NA	8.86e-17	NA
7. B	Q8E281	Ribose import ATP-binding protein RbsA	1.35e-14	NA	2.54e-12	NA
7. B	Q578E9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	6.81e-13	NA
7. B	Q142P6	ATP-dependent lipid A-core flippase	2.20e-11	NA	1.35e-18	NA
7. B	P44410	UvrABC system protein A	1.24e-02	NA	0.002	NA
7. B	Q825P1	Ribose import ATP-binding protein RbsA 2	2.48e-14	NA	3.83e-15	NA
7. B	Q92S10	Ribose import ATP-binding protein RbsA 1	7.96e-14	NA	4.93e-10	NA
7. B	P59738	Molybdenum import ATP-binding protein ModC	4.42e-14	NA	2.13e-06	NA
7. B	Q8T689	ABC transporter G family member 4	3.11e-09	NA	2.78e-13	NA
7. B	Q00752	Multiple sugar-binding transport ATP-binding protein MsmK	2.66e-15	NA	1.73e-15	NA
7. B	P77257	Autoinducer 2 import ATP-binding protein LsrA	2.33e-14	NA	3.86e-10	NA
7. B	Q92887	ATP-binding cassette sub-family C member 2	2.66e-05	NA	1.81e-15	NA
7. B	Q4WDD4	ABC multidrug transporter atrF	1.14e-05	NA	1.36e-11	NA
7. B	Q8PN26	UvrABC system protein A	1.38e-02	NA	0.014	NA
7. B	P55122	Leukotoxin translocation ATP-binding protein LktB	7.79e-10	NA	1.21e-15	NA
7. B	P63359	ATP-dependent lipid A-core flippase	4.63e-11	NA	4.61e-16	NA
7. B	Q73EL7	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	4.27e-28	NA
7. B	Q5R9Z5	ATP-binding cassette sub-family F member 3	8.04e-09	NA	5.66e-06	NA
7. B	A7FMJ7	Autoinducer 2 import ATP-binding protein LsrA	5.14e-14	NA	4.85e-11	NA
7. B	Q2UPC0	ABC transporter aclQ	4.03e-09	NA	7.01e-14	NA
7. B	Q8FW07	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	6.81e-13	NA
7. B	Q5PMK1	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	6.00e-11	NA
7. B	Q578M5	Putative ATP-binding protein BruAb2_0487	1.11e-16	NA	2.87e-14	NA
7. B	O95255	ATP-binding cassette sub-family C member 6	1.21e-05	NA	7.97e-06	NA
7. B	Q7PC86	ABC transporter G family member 35	2.64e-06	NA	6.01e-09	NA
7. B	Q7MFC4	Maltose/maltodextrin import ATP-binding protein MalK	9.99e-16	NA	9.54e-13	NA
7. B	Q9C7F8	ABC transporter B family member 13	4.95e-07	NA	3.09e-20	NA
7. B	O83527	UvrABC system protein A	1.26e-02	NA	0.029	NA
7. B	Q8Z7H7	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	5.35e-11	NA
7. B	Q0SML1	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.43e-23	NA
7. B	B8NDS8	ABC multidrug transporter atrF	9.65e-06	NA	1.95e-10	NA
7. B	E9PU17	ATP-binding cassette sub-family A member 17	4.25e-06	NA	2.13e-10	NA
7. B	Q56927	Fe(3+) ions import ATP-binding protein FbpC	4.44e-16	NA	1.68e-14	NA
7. B	Q55DA0	ABC transporter G family member 22	2.75e-11	NA	2.03e-13	NA
7. B	O80725	ABC transporter B family member 4	7.97e-07	NA	1.82e-17	NA
7. B	Q65S66	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	8.46e-17	NA
7. B	Q8U6M1	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	5.01e-15	NA
7. B	P78363	Retinal-specific phospholipid-transporting ATPase ABCA4	8.58e-05	NA	1.45e-07	NA
7. B	O88269	ATP-binding cassette sub-family C member 6	1.52e-05	NA	0.006	NA
7. B	O70127	Bile salt export pump	1.15e-06	NA	8.64e-14	NA
7. B	Q8LPJ4	ABC transporter E family member 2	2.26e-07	NA	1.36e-10	NA
7. B	O60102	Translation initiation factor rli1	2.49e-07	NA	3.67e-09	NA
7. B	E0SCY1	Glycine betaine/choline transport system ATP-binding protein OusV	1.11e-16	NA	1.67e-14	NA
7. B	Q1LQD3	ATP-dependent lipid A-core flippase	2.24e-11	NA	2.22e-16	NA
7. B	P56474	UvrABC system protein A	1.19e-02	NA	4.34e-04	NA
7. B	Q7JUN3	ATP-binding cassette sub-family D member	4.07e-07	NA	1.40e-07	NA
7. B	Q63QQ7	Arabinose import ATP-binding protein AraG	2.72e-13	NA	1.24e-10	NA
7. B	Q0VQ44	Molybdenum import ATP-binding protein ModC	3.94e-13	NA	2.52e-06	NA
7. B	Q6GHY6	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q1I966	Macrolide export ATP-binding/permease protein MacB 1	5.52e-10	NA	1.25e-24	NA
7. B	Q8T6J1	ABC transporter A family member 6	6.31e-06	NA	7.49e-08	NA
7. B	Q7FMW4	ABC transporter G family member 38	5.92e-06	NA	8.92e-07	NA
7. B	Q0BIZ6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-15	NA	4.17e-14	NA
7. B	Q2K9A3	Ribose import ATP-binding protein RbsA 1	1.34e-13	NA	1.98e-09	NA
7. B	Q9PR42	UvrABC system protein A	9.67e-03	NA	0.003	NA
7. B	P37608	Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3	5.50e-08	NA	5.40e-16	NA
7. B	Q9U2G5	Multidrug resistance protein mrp-7	1.61e-05	NA	6.38e-10	NA
7. B	Q556W2	ABC transporter G family member 17	3.20e-05	NA	7.07e-08	NA
7. B	Q5LBT4	Spermidine/putrescine import ATP-binding protein PotA	1.49e-14	NA	9.80e-16	NA
7. B	Q6F813	Macrolide export ATP-binding/permease protein MacB	2.48e-10	NA	9.48e-32	NA
7. B	Q881Q1	Macrolide export ATP-binding/permease protein MacB 2	4.05e-10	NA	6.85e-24	NA
7. B	Q734T1	Putative ABC transporter ATP-binding protein BCE_3323	5.22e-13	NA	3.65e-19	NA
7. B	P0DKX6	Cyclolysin secretion/processing ATP-binding protein CyaB	2.09e-09	NA	2.67e-13	NA
7. B	Q87PH3	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	2.41e-15	NA
7. B	I1S2J9	ABC transporter FGM5	8.36e-05	NA	3.68e-08	NA
7. B	Q98KI3	Molybdenum import ATP-binding protein ModC	1.10e-12	NA	1.37e-17	NA
7. B	Q5B1Q2	Iron-sulfur clusters transporter atm1, mitochondrial	2.28e-10	NA	9.85e-11	NA
7. B	Q66FU4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.22e-15	NA	2.01e-18	NA
7. B	Q09466	ABC transporter ATP-binding protein/permease wht-3	8.28e-12	NA	1.93e-10	NA
7. B	A0A1U9YI12	ABC-type transmembrane transporter verA	3.47e-07	NA	2.11e-17	NA
7. B	P16970	ATP-binding cassette sub-family D member 3	5.31e-08	NA	6.54e-04	NA
7. B	Q89WG0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.33e-15	NA	8.83e-14	NA
7. B	Q1C138	Autoinducer 2 import ATP-binding protein LsrA	6.02e-14	NA	8.78e-12	NA
7. B	Q8T6J0	ABC transporter A family member 7	2.18e-11	NA	2.48e-10	NA
7. B	Q9CM47	Macrolide export ATP-binding/permease protein MacB	1.76e-10	NA	2.13e-28	NA
7. B	Q9M3D6	ABC transporter G family member 19	8.17e-11	NA	1.39e-11	NA
7. B	Q1ARR5	Ribose import ATP-binding protein RbsA 3	6.77e-15	NA	3.99e-18	NA
7. B	P21447	ATP-dependent translocase ABCB1	7.57e-07	NA	5.01e-18	NA
7. B	Q81GU1	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	3.10e-19	NA
7. B	P63400	Uncharacterized ABC transporter ATP-binding protein Mb2353c	1.75e-09	NA	4.59e-08	NA
7. B	P21448	ATP-dependent translocase ABCB1	7.59e-07	NA	2.16e-18	NA
7. B	Q2PBM0	Autoinducer 2 import ATP-binding protein LsrA	1.15e-14	NA	1.32e-12	NA
7. B	Q07UI9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	2.96e-10	NA
7. B	F2SG60	ABC multidrug transporter MDR3	6.41e-06	NA	6.29e-06	NA
7. B	Q9CM08	Galactose/methyl galactoside import ATP-binding protein MglA	1.81e-13	NA	2.18e-09	NA
7. B	Q8J2Q1	ABC transporter FUM19	9.51e-05	NA	1.16e-09	NA
7. B	P47311	Putative ABC transporter ATP-binding protein MG065	3.44e-15	NA	2.46e-15	NA
7. B	Q8T6B7	ABC transporter F family member 2	4.21e-10	NA	4.14e-09	NA
7. B	Q9KQW9	ATP-dependent lipid A-core flippase	1.29e-11	NA	2.59e-15	NA
7. B	Q8Y8T6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.91e-17	NA
7. B	Q928A5	UvrABC system protein A	2.75e-02	NA	0.022	NA
7. B	Q9LSJ6	ABC transporter B family member 17	4.88e-07	NA	7.32e-17	NA
7. B	Q42093	ABC transporter C family member 2	2.53e-05	NA	1.93e-08	NA
7. B	O95342	Bile salt export pump	1.07e-06	NA	9.49e-14	NA
7. B	Q7JII7	Cystic fibrosis transmembrane conductance regulator	6.19e-05	NA	1.83e-12	NA
7. B	Q8EIL8	Macrolide export ATP-binding/permease protein MacB	2.27e-10	NA	3.02e-28	NA
7. B	Q98HF7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.22e-12	NA
7. B	Q0T4L9	Autoinducer 2 import ATP-binding protein LsrA	2.43e-14	NA	1.28e-09	NA
7. B	Q03518	Antigen peptide transporter 1	9.19e-09	NA	1.38e-14	NA
7. B	Q73XU8	Sulfate/thiosulfate import ATP-binding protein CysA	3.33e-16	NA	6.04e-14	NA
7. B	Q9CM80	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	1.92e-14	NA
7. B	Q1JLT7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.94e-10	NA
7. B	Q92DL6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.86e-16	NA
7. B	Q5E0F2	ATP-dependent lipid A-core flippase	2.38e-11	NA	7.38e-13	NA
7. B	Q6YW62	ABC transporter G family member 44	9.82e-06	NA	3.29e-12	NA
7. B	Q8PVG9	Putative ABC transporter ATP-binding protein MM_1996	2.32e-14	NA	1.45e-24	NA
7. B	Q7PC82	ABC transporter G family member 42	1.28e-06	NA	2.18e-11	NA
7. B	P75516	Putative carbohydrate transport ATP-binding protein MPN_258	1.84e-12	NA	9.55e-16	NA
7. B	Q7NB11	Spermidine/putrescine import ATP-binding protein PotA	3.04e-06	NA	1.17e-06	NA
7. B	Q91V24	ATP-binding cassette sub-family A member 7	6.37e-05	NA	9.43e-06	NA
7. B	O75027	Iron-sulfur clusters transporter ABCB7, mitochondrial	3.61e-10	NA	1.17e-14	NA
7. B	P38735	ABC transporter ATP-binding protein/permease VMR1	2.10e-05	NA	4.14e-08	NA
7. B	Q9HWG0	UvrABC system protein A	1.30e-02	NA	0.008	NA
7. B	Q7MG07	Galactose/methyl galactoside import ATP-binding protein MglA	2.16e-13	NA	1.82e-10	NA
7. B	A0L0V9	Macrolide export ATP-binding/permease protein MacB	2.49e-10	NA	2.02e-28	NA
7. B	Q9DBM0	ATP-binding cassette sub-family G member 8	8.04e-11	NA	8.43e-10	NA
7. B	Q8FVT0	Putative ATP-binding protein BRA0745/BS1330_II0738	1.11e-16	NA	3.26e-14	NA
7. B	Q87VF3	ATP-dependent lipid A-core flippase	5.11e-11	NA	6.80e-12	NA
7. B	A0A348AXX9	ABC-type transporter TR06	6.21e-07	NA	1.82e-16	NA
7. B	Q9BZC7	ATP-binding cassette sub-family A member 2	2.37e-04	NA	1.05e-08	NA
7. B	P53978	Elongation factor 3B	1.00e-02	NA	2.03e-05	NA
7. B	Q00554	Cystic fibrosis transmembrane conductance regulator	6.56e-05	NA	3.27e-11	NA
7. B	Q2P7S3	Methionine import ATP-binding protein MetN	0.00e+00	NA	6.60e-26	NA
7. B	Q9M1H3	ABC transporter F family member 4	1.00e-08	NA	1.28e-11	NA
7. B	P43672	ATP-binding protein Uup	2.42e-09	NA	1.35e-11	NA
7. B	Q7PC80	ABC transporter G family member 34	1.18e-05	NA	3.48e-08	NA
7. B	Q9LHD1	ABC transporter B family member 15	4.64e-07	NA	2.27e-15	NA
7. B	Q7AH43	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	8.68e-19	NA
7. B	A0A0D1CZ63	Multidrug resistance protein fer6	1.17e-06	NA	1.27e-07	NA
7. B	Q08201	Phosphatidylcholine translocator ABCB4	7.02e-07	NA	9.66e-21	NA
7. B	Q6D4E2	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	1.26e-11	NA
7. B	Q8ZPK4	Osmoprotectant import ATP-binding protein OsmV	0.00e+00	NA	1.28e-11	NA
7. B	Q4WT65	ABC multidrug transporter B	1.37e-05	NA	2.55e-15	NA
7. B	Q8GU92	ABC transporter G family member 35	9.15e-06	NA	1.63e-08	NA
7. B	Q9H221	ATP-binding cassette sub-family G member 8	7.89e-11	NA	8.69e-12	NA
7. B	Q8Y4F6	UvrABC system protein A	2.77e-02	NA	0.023	NA
7. B	Q8RWI9	ABC transporter G family member 15	1.10e-10	NA	5.45e-14	NA
7. B	Q14Q07	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.54e-20	NA
7. B	Q8WWZ4	ATP-binding cassette sub-family A member 10	2.11e-06	NA	4.79e-08	NA
7. B	Q5AV01	ABC transporter atnG	2.25e-05	NA	2.30e-13	NA
7. B	Q2YX74	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q04BG2	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.69e-16	NA
7. B	Q01937	Lactose transport ATP-binding protein LacK	3.33e-16	NA	4.42e-13	NA
7. B	Q3IX40	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	4.72e-14	NA
7. B	Q9QY30	Bile salt export pump	1.02e-06	NA	4.44e-14	NA
7. B	Q2QLH0	Cystic fibrosis transmembrane conductance regulator	1.17e-03	NA	2.23e-12	NA
7. B	Q1R9S4	Galactose/methyl galactoside import ATP-binding protein MglA	2.67e-13	NA	1.99e-09	NA
7. B	Q9LYS2	ABC transporter C family member 10	9.31e-06	NA	5.42e-10	NA
7. B	Q6F0V4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.51e-20	NA
7. B	Q4K9A4	Macrolide export ATP-binding/permease protein MacB 2	7.13e-10	NA	1.24e-27	NA
7. B	Q2HIE9	Iron-sulfur clusters transporter ATM1, mitochondrial	7.02e-12	NA	5.77e-14	NA
7. B	P55096	ATP-binding cassette sub-family D member 3	5.81e-08	NA	1.08e-04	NA
7. B	P47365	Putative carbohydrate transport ATP-binding protein MG119	3.07e-13	NA	3.74e-17	NA
7. B	Q8LPT1	ABC transporter B family member 6	1.88e-06	NA	7.81e-17	NA
7. B	P45171	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	1.70e-14	NA
7. B	P9WQJ9	Mycobactin import ATP-binding/permease protein IrtA	3.24e-08	NA	1.07e-12	NA
7. B	Q9NRK6	ATP-binding cassette sub-family B member 10, mitochondrial	1.57e-09	NA	7.40e-18	NA
7. B	P14772	Bile pigment transporter 1	3.31e-05	NA	4.07e-07	NA
7. B	Q7M8U0	Macrolide export ATP-binding/permease protein MacB	1.65e-10	NA	2.54e-30	NA
7. B	P69874	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	8.73e-11	NA
7. B	Q9LSJ2	ABC transporter B family member 22	4.65e-07	NA	7.73e-17	NA
7. B	Q2G506	ATM1-type heavy metal exporter	1.80e-11	NA	1.94e-14	NA
7. B	Q55EH8	ABC transporter G family member 23	8.91e-11	NA	1.50e-14	NA
7. B	S3D778	ABC transporter gloK	4.87e-06	NA	1.74e-11	NA
7. B	Q62K82	Sulfate/thiosulfate import ATP-binding protein CysA	5.55e-16	NA	3.48e-18	NA
7. B	Q8S628	ABC transporter G family member 51	1.18e-05	NA	9.71e-10	NA
7. B	P29551	Elongation factor 3	9.02e-06	NA	1.13e-06	NA
7. B	Q8VI47	ATP-binding cassette sub-family C member 2	2.76e-05	NA	4.21e-10	NA
7. B	Q9Y7M7	ATP-dependent permease MDL1, mitochondrial	1.15e-10	NA	5.42e-17	NA
7. B	Q15UY7	ATP-dependent lipid A-core flippase	1.76e-11	NA	4.30e-12	NA
7. B	P0A2V1	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	7.56e-11	NA	1.84e-11	NA
7. B	Q0B1U4	Xylose import ATP-binding protein XylG	1.19e-13	NA	5.29e-11	NA
7. B	Q8H0V6	ABC transporter F family member 3	2.54e-09	NA	1.24e-08	NA
7. B	O94489	Elongation factor 3	4.61e-03	NA	2.53e-05	NA
7. B	P55469	Uncharacterized ABC transporter ATP-binding protein y4gM	2.11e-11	NA	8.30e-14	NA
7. B	Q949G3	Pleiotropic drug resistance protein 1	8.32e-06	NA	6.68e-07	NA
7. B	P33941	ABC transporter ATP-binding/permease protein YojI	9.98e-11	NA	7.44e-07	NA
7. B	A0A059J0G5	ABC multidrug transporter MDR1	1.38e-05	NA	4.89e-07	NA
7. B	P63384	UvrABC system protein A	1.33e-02	NA	0.035	NA
7. B	P33116	Subtilin transport ATP-binding protein SpaT	1.86e-08	NA	2.23e-11	NA
7. B	Q3SFZ6	ATP-dependent lipid A-core flippase	2.08e-11	NA	1.60e-17	NA
7. B	A0A0M4FLW6	ABC transporter G family member STR2	3.78e-11	NA	1.96e-11	NA
7. B	Q1LX78	Cystic fibrosis transmembrane conductance regulator	7.83e-05	NA	4.00e-10	NA
7. B	Q57242	ATP-binding protein Uup	4.55e-09	NA	4.10e-09	NA
7. B	Q05360	Protein white	NA	NA	5.06e-15	NA
7. B	Q6UR05	Multidrug resistance-associated protein 1	2.24e-05	NA	2.81e-09	NA
7. B	Q8T6B4	ABC transporter F family member 4	2.08e-06	NA	1.46e-06	NA
7. B	Q63TY1	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	3.48e-18	NA
7. B	Q9QYM0	ATP-binding cassette sub-family C member 5	5.32e-06	NA	2.51e-06	NA
7. B	Q7A679	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q07DY5	Cystic fibrosis transmembrane conductance regulator	8.32e-05	NA	4.16e-13	NA
7. B	Q5PGP3	Glutathione import ATP-binding protein GsiA	1.84e-13	NA	3.56e-09	NA
7. B	Q1CGH0	ATP-dependent lipid A-core flippase	5.03e-11	NA	3.47e-16	NA
7. B	Q8K984	Multidrug resistance-like ATP-binding protein MdlB	8.21e-12	NA	3.61e-04	NA
7. B	Q8T9W4	ABC transporter B family member 3	3.66e-06	NA	2.67e-19	NA
7. B	B1JLQ0	Autoinducer 2 import ATP-binding protein LsrA	5.51e-14	NA	2.67e-11	NA
7. B	Q9M1C7	ABC transporter C family member 9	1.32e-05	NA	1.07e-09	NA
7. B	Q6D7D0	Molybdenum import ATP-binding protein ModC	2.92e-14	NA	3.47e-11	NA
7. B	Q99V03	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q92NU9	Macrolide export ATP-binding/permease protein MacB	5.83e-10	NA	3.50e-28	NA
7. B	O94911	ABC-type organic anion transporter ABCA8	5.64e-06	NA	2.06e-11	NA
7. B	Q5WNX0	Bacitracin transport ATP-binding protein BcrA	0.00e+00	NA	6.45e-15	NA
7. B	P10907	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.67e-15	NA	9.99e-17	NA
7. B	Q54V86	ABC transporter C family member 13	4.69e-06	NA	1.10e-06	NA
7. B	Q71ED1	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.92e-11	NA	4.14e-14	NA
7. B	Q8LGU1	ABC transporter C family member 8	9.55e-06	NA	8.78e-12	NA
7. B	Q92GP9	Putative export ATP-binding/permease protein RC1073	1.27e-11	NA	1.15e-12	NA
7. B	Q832R5	Putative ABC transporter ATP-binding protein EF_2153	6.88e-14	NA	4.15e-24	NA
7. B	Q54W24	ABC transporter B family member 4	6.73e-10	NA	4.79e-16	NA
7. B	P56899	UvrABC system protein A	1.47e-02	NA	1.38e-04	NA
7. B	Q80WJ6	ATP-binding cassette sub-family C member 12	3.84e-06	NA	1.14e-11	NA
7. B	P77481	Putative uncharacterized ABC transporter ATP-binding protein YcjV	5.55e-16	NA	1.54e-11	NA
7. B	Q9MUN1	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.50e-15	NA
7. B	Q7MLB8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	1.65e-13	NA
7. B	Q8FFB3	Sulfate/thiosulfate import ATP-binding protein CysA	7.77e-16	NA	4.21e-20	NA
7. B	A2XCD4	ABC transporter C family member 13	1.18e-05	NA	1.28e-08	NA
7. B	Q8ZAS8	Maltose/maltodextrin import ATP-binding protein MalK	9.99e-16	NA	6.43e-15	NA
7. B	P63398	Fatty acid ABC transporter ATP-binding/permease protein	7.49e-10	NA	3.71e-10	NA
7. B	P43071	Multidrug resistance protein CDR1	4.58e-06	NA	1.29e-07	NA
7. B	Q3JHZ1	Ribose import ATP-binding protein RbsA 2	2.79e-13	NA	9.52e-08	NA
7. B	Q46717	Alpha-hemolysin translocation ATP-binding protein HlyB	1.65e-09	NA	2.44e-16	NA
7. B	P36370	Antigen peptide transporter 1	2.52e-09	NA	3.86e-15	NA
7. B	Q8PGE8	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.84e-24	NA
7. B	Q8ZQR6	Molybdenum import ATP-binding protein ModC	2.94e-14	NA	2.69e-04	NA
7. B	Q82WT5	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-16	NA	3.02e-15	NA
7. B	Q02MI4	Macrolide export ATP-binding/permease protein MacB	8.04e-10	NA	3.31e-28	NA
7. B	Q2M3G0	ATP-binding cassette sub-family B member 5	6.35e-07	NA	3.42e-18	NA
7. B	Q93FH6	Leukotoxin translocation ATP-binding protein LktB	6.79e-10	NA	4.45e-17	NA
7. B	Q21WN9	ATP-dependent lipid A-core flippase	1.82e-11	NA	7.39e-14	NA
7. B	Q8ZGA9	ATP-dependent lipid A-core flippase	3.66e-11	NA	3.47e-16	NA
7. B	Q9C8K2	ABC transporter G family member 12	3.71e-10	NA	3.46e-13	NA
7. B	Q9VL32	ATP-binding cassette sub-family C member Sur	2.32e-04	NA	1.70e-05	NA
7. B	Q8YCB1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	2.41e-13	NA
7. B	Q972J5	Putative ABC transporter ATP-binding protein STK_11360	4.24e-14	NA	3.60e-11	NA
7. B	Q56A55	Mitochondrial potassium channel ATP-binding subunit	4.83e-10	NA	2.45e-13	NA
7. B	Q97Q42	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.47e-12	NA
7. B	Q032A0	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.99e-30	NA
7. B	P23702	Leukotoxin export ATP-binding protein LtxB	8.39e-10	NA	3.10e-20	NA
7. B	A0A3G9H9H1	ABC transporter ALT5	3.66e-04	NA	9.78e-06	NA
7. B	P13569	Cystic fibrosis transmembrane conductance regulator	6.83e-05	NA	1.33e-12	NA
7. B	Q6G5J0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	0.00e+00	NA	2.68e-14	NA
7. B	Q3Z3Q4	Macrolide export ATP-binding/permease protein MacB	1.80e-10	NA	7.22e-30	NA
7. B	P31134	Putrescine transport ATP-binding protein PotG	3.33e-16	NA	5.21e-16	NA
7. B	P9WQJ0	Uncharacterized ABC transporter ATP-binding protein MT1311	2.71e-11	NA	2.12e-11	NA
7. B	Q668L6	Macrolide export ATP-binding/permease protein MacB 2	8.45e-11	NA	8.72e-26	NA
7. B	Q1AXG5	Ribose import ATP-binding protein RbsA 1	3.06e-13	NA	6.38e-15	NA
7. B	Q92TS8	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.69e-13	NA	1.01e-09	NA
7. B	A4TQL5	Autoinducer 2 import ATP-binding protein LsrA	6.47e-14	NA	8.78e-12	NA
7. B	Q8E3S0	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.44e-19	NA
7. B	Q9I6T2	Spermidine/putrescine import ATP-binding protein PotA 1	4.44e-16	NA	6.07e-13	NA
7. B	P0C2H2	Macrolide export ATP-binding/permease protein MacB	2.07e-10	NA	3.28e-32	NA
7. B	Q8MIB3	Broad substrate specificity ATP-binding cassette transporter ABCG2	2.28e-11	NA	4.61e-14	NA
7. B	Q83LT3	Glutathione import ATP-binding protein GsiA	1.39e-13	NA	5.16e-09	NA
7. B	Q3JZP8	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.63e-20	NA
7. B	Q12C33	ATP-dependent lipid A-core flippase	2.88e-11	NA	3.95e-13	NA
7. B	P0A195	UvrABC system protein A	1.18e-02	NA	5.07e-04	NA
7. B	P72481	UvrABC system protein A	1.35e-02	NA	0.041	NA
7. B	Q62GB4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	7.77e-16	NA	1.16e-13	NA
7. B	Q8GU84	ABC transporter G family member 48	8.94e-06	NA	1.21e-13	NA
7. B	P63394	Mycobactin import ATP-binding/permease protein IrtB	3.26e-11	NA	2.75e-19	NA
7. B	Q88D92	ATP-dependent lipid A-core flippase	4.73e-11	NA	2.22e-15	NA
7. B	Q31FG2	ATP-dependent lipid A-core flippase	7.94e-11	NA	3.78e-10	NA
7. B	Q03519	Antigen peptide transporter 2	6.00e-09	NA	1.13e-18	NA
7. B	Q57335	Uncharacterized ABC transporter ATP-binding protein HI_0036	2.12e-08	NA	4.12e-06	NA
7. B	Q7RX59	Iron-sulfur clusters transporter atm1, mitochondrial	2.88e-10	NA	9.84e-19	NA
7. B	Q9FT51	ABC transporter G family member 27	9.03e-11	NA	6.28e-17	NA
7. B	Q09YH0	Cystic fibrosis transmembrane conductance regulator	5.89e-05	NA	2.63e-12	NA
7. B	Q8ZCM2	Fe(3+) ions import ATP-binding protein FbpC	2.43e-14	NA	2.86e-14	NA
7. B	Q9SJK6	Putative white-brown complex homolog protein 30	7.78e-08	NA	8.51e-09	NA
7. B	Q9HY19	Spermidine/putrescine import ATP-binding protein PotA 2	1.11e-16	NA	2.96e-13	NA
7. B	Q2IBF6	Cystic fibrosis transmembrane conductance regulator	6.20e-05	NA	2.47e-12	NA
7. B	P0AAG5	Multidrug resistance-like ATP-binding protein MdlB	1.55e-11	NA	1.19e-10	NA
7. B	A7KVC2	ABC transporter C family MRP4	1.24e-05	NA	1.76e-07	NA
7. B	P33916	Uncharacterized ABC transporter ATP-binding protein YejF	2.33e-15	NA	1.08e-15	NA
7. B	Q45460	Choline transport ATP-binding protein OpuBA	1.11e-16	NA	2.58e-15	NA
7. B	Q54BT3	ABC transporter B family member 2	3.58e-06	NA	1.64e-14	NA
7. B	Q8YCG3	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	9.17e-13	NA
7. B	I1R9B3	ABC-type transporter FGSG_00046	1.77e-05	NA	1.15e-04	NA
7. B	P77795	Uncharacterized ABC transporter ATP-binding protein YdcT	0.00e+00	NA	1.31e-11	NA
7. B	Q1C5W7	Macrolide export ATP-binding/permease protein MacB 2	7.44e-11	NA	7.92e-26	NA
7. B	Q3JUI6	ATP-dependent lipid A-core flippase	5.60e-11	NA	1.02e-18	NA
7. B	Q8LPK2	ABC transporter B family member 2	3.55e-07	NA	3.59e-18	NA
7. B	A1TXH7	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	1.48e-17	NA
7. B	P40860	Sulfate/thiosulfate import ATP-binding protein CysA	7.77e-16	NA	6.76e-21	NA
7. B	Q2FHY1	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q0P887	Tungstate uptake system ATP-binding protein TupC	5.21e-13	NA	1.43e-06	NA
7. B	D3ZCM3	ATP-binding cassette subfamily G member 4	3.29e-13	NA	1.01e-14	NA
7. B	Q5WC31	Ribose import ATP-binding protein RbsA	2.86e-14	NA	7.55e-14	NA
7. B	Q03ZQ0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.92e-14	NA
7. B	P22638	Heterocyst differentiation ATP-binding protein HepA	1.20e-10	NA	4.03e-15	NA
7. B	Q2K0S7	Ribose import ATP-binding protein RbsA 3	5.37e-14	NA	4.96e-09	NA
7. B	P78966	Mating factor M secretion protein mam1	3.05e-06	NA	1.27e-20	NA
7. B	Q87DT9	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	1.69e-18	NA
7. B	Q0T6D3	Glutathione import ATP-binding protein GsiA	1.10e-14	NA	2.43e-09	NA
7. B	Q164K3	Ribose import ATP-binding protein RbsA	2.79e-14	NA	3.48e-10	NA
7. B	Q68W42	Putative export ATP-binding/permease protein RT0691	1.03e-11	NA	2.86e-16	NA
7. B	O31707	Uncharacterized ABC transporter ATP-binding protein YknU	2.03e-11	NA	7.39e-13	NA
7. B	Q9S4Z0	Methionine import ATP-binding protein MetN	4.44e-16	NA	1.71e-22	NA
7. B	Q8T5Z7	ABC transporter A family member 1	6.67e-10	NA	5.42e-10	NA
7. B	Q10185	ATP-binding cassette transporter abc2	1.36e-05	NA	2.12e-09	NA
7. B	A0KGB3	Macrolide export ATP-binding/permease protein MacB 1	2.01e-10	NA	2.87e-28	NA
7. B	P11599	Alpha-hemolysin translocation ATP-binding protein HlyB	1.14e-09	NA	3.49e-13	NA
7. B	Q89NX6	Macrolide export ATP-binding/permease protein MacB	1.31e-10	NA	1.23e-27	NA
7. B	Q1JBV6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.94e-10	NA
7. B	P25997	Elongation factor 3	5.36e-03	NA	5.99e-05	NA
7. B	Q8RXN0	ABC transporter G family member 11	2.22e-10	NA	3.20e-16	NA
7. B	Q8DY54	Methionine import ATP-binding protein MetN	0.00e+00	NA	2.63e-20	NA
7. B	P47660	UvrABC system protein A	3.45e-02	NA	0.006	NA
7. B	Q86HQ2	ABC transporter G family member 8	2.78e-10	NA	3.82e-15	NA
7. B	Q00564	Lactococcin-A transport/processing ATP-binding protein LcnC	2.39e-09	NA	1.46e-19	NA
7. B	Q66EY9	Autoinducer 2 import ATP-binding protein LsrA	4.36e-14	NA	2.67e-11	NA
7. B	P16676	Sulfate/thiosulfate import ATP-binding protein CysA	6.66e-15	NA	4.99e-20	NA
7. B	Q7VMF9	Macrolide export ATP-binding/permease protein MacB	1.69e-13	NA	1.05e-30	NA
7. B	Q8XJX3	Ribose import ATP-binding protein RbsA	2.65e-13	NA	5.87e-10	NA
7. B	Q9FNU2	ABC transporter B family member 25	1.19e-10	NA	1.50e-16	NA
7. B	Q47CB7	Molybdenum import ATP-binding protein ModC	1.27e-12	NA	1.19e-09	NA
7. B	Q54K24	ABC transporter C family member 14	2.16e-06	NA	3.36e-10	NA
7. B	Q4WSI1	ABC multidrug transporter mdr4	2.20e-06	NA	7.76e-13	NA
7. B	Q9LHK4	Putative ABC transporter B family member 8	4.08e-07	NA	1.68e-16	NA
7. B	F1MWM0	Retinal-specific phospholipid-transporting ATPase ABCA4	NA	NA	2.90e-08	NA
7. B	Q54VJ0	ABC transporter C family member 2	7.23e-06	NA	4.04e-08	NA
7. B	Q9UNQ0	Broad substrate specificity ATP-binding cassette transporter ABCG2	4.86e-11	NA	5.93e-13	NA
7. B	Q9CHL8	Multidrug resistance ABC transporter ATP-binding and permease protein	1.53e-10	NA	4.83e-14	NA
7. B	Q8VZZ4	ABC transporter C family member 6	7.37e-06	NA	7.06e-06	NA
7. B	Q83D84	ATP-dependent lipid A-core flippase	2.68e-12	NA	3.10e-18	NA
7. B	F2RSQ6	ABC multidrug transporter MDR1	1.35e-05	NA	4.89e-07	NA
7. B	D4AYW0	ABC transporter G family member ARB_01379	1.04e-07	NA	1.33e-12	NA
7. B	Q8FHR3	Uncharacterized ABC transporter ATP-binding protein YcjV	1.11e-16	NA	1.08e-11	NA
7. B	Q09YJ4	Cystic fibrosis transmembrane conductance regulator	6.77e-05	NA	1.31e-12	NA
7. B	Q57IS3	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.22e-15	NA	6.97e-15	NA
7. B	Q8TSC8	Putative ABC transporter ATP-binding protein MA_0870	7.34e-13	NA	1.79e-23	NA
7. B	Q2QL74	Cystic fibrosis transmembrane conductance regulator	7.06e-05	NA	8.23e-11	NA
7. B	Q12M46	ATP-dependent lipid A-core flippase	8.44e-11	NA	9.38e-16	NA
7. B	Q8XKQ2	Galactose/methyl galactoside import ATP-binding protein MglA	1.68e-13	NA	6.42e-13	NA
7. B	Q55DR1	ABC transporter G family member 14	1.45e-05	NA	3.96e-05	NA
7. B	Q1MAA2	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.50e-13	NA	1.56e-07	NA
7. B	Q9KL04	Maltose/maltodextrin import ATP-binding protein MalK	3.33e-16	NA	7.08e-13	NA
7. B	D4GP39	Xylose/arabinose import ATP-binding protein XacK	8.55e-15	NA	9.85e-17	NA
7. B	Q99PE7	ATP-binding cassette sub-family G member 5	3.28e-11	NA	2.77e-14	NA
7. B	Q9NUT2	Mitochondrial potassium channel ATP-binding subunit	4.02e-10	NA	1.44e-15	NA
7. B	A1K323	Macrolide export ATP-binding/permease protein MacB	2.41e-10	NA	2.63e-31	NA
7. B	Q8D4H4	Galactose/methyl galactoside import ATP-binding protein MglA	2.67e-13	NA	1.89e-10	NA
7. B	Q9KSD1	Galactose/methyl galactoside import ATP-binding protein MglA	2.47e-13	NA	1.21e-09	NA
7. B	O24367	Pleiotropic drug resistance protein TUR2	8.99e-06	NA	1.49e-08	NA
7. B	Q323M3	Macrolide export ATP-binding/permease protein MacB	1.78e-10	NA	2.14e-28	NA
7. B	A0A0H2VFI8	Energy-dependent translational throttle protein EttA	1.39e-06	NA	2.37e-13	NA
7. B	P40416	Iron-sulfur clusters transporter ATM1, mitochondrial	2.41e-10	NA	8.37e-13	NA
7. B	O74208	Pleiotropic ABC efflux transporter of multiple drugs PDH1	8.92e-06	NA	5.02e-07	NA
7. B	Q1QDA8	Macrolide export ATP-binding/permease protein MacB	3.78e-10	NA	3.74e-30	NA
7. B	Q897I2	Putative ABC transporter ATP-binding protein CTC_00753	1.50e-14	NA	5.55e-24	NA
7. B	Q4FU75	Macrolide export ATP-binding/permease protein MacB	4.40e-10	NA	1.01e-30	NA
7. B	A1VYW8	Macrolide export ATP-binding/permease protein MacB	1.71e-09	NA	2.17e-27	NA
7. B	Q92W56	Arabinose import ATP-binding protein AraG	8.28e-14	NA	7.33e-11	NA
7. B	Q0TJD9	ATP-dependent lipid A-core flippase	3.82e-11	NA	9.78e-17	NA
7. B	Q99P81	ATP-binding cassette sub-family G member 3	2.40e-10	NA	2.24e-06	NA
7. B	Q6N0P7	Molybdenum import ATP-binding protein ModC	1.13e-12	NA	6.50e-11	NA
7. B	Q8UH62	Sulfate/thiosulfate import ATP-binding protein CysA 1	7.77e-16	NA	1.37e-18	NA
7. B	Q02XM9	Ribose import ATP-binding protein RbsA	3.69e-14	NA	1.54e-18	NA
7. B	A1BE50	Macrolide export ATP-binding/permease protein MacB	1.26e-09	NA	1.83e-24	NA
7. B	Q704E8	Iron-sulfur clusters transporter ABCB7, mitochondrial	3.51e-10	NA	1.59e-13	NA
7. B	Q1PEH6	ABC transporter A family member 3	2.67e-09	NA	2.68e-08	NA
7. B	Q7XA72	ABC transporter G family member 21	8.32e-12	NA	2.01e-17	NA
7. B	Q99758	Phospholipid-transporting ATPase ABCA3	3.87e-06	NA	4.33e-10	NA
7. B	Q63MM6	Macrolide export ATP-binding/permease protein MacB	5.84e-10	NA	1.81e-26	NA
7. B	Q8FVV5	Fe(3+) ions import ATP-binding protein FbpC	1.11e-15	NA	7.53e-15	NA
7. B	Q7N986	Maltose/maltodextrin import ATP-binding protein MalK	2.66e-15	NA	1.41e-16	NA
7. B	P9WQK2	Energy-dependent translational throttle protein EttA	5.95e-07	NA	4.12e-10	NA
7. B	B8K1W2	Bile salt export pump	1.04e-06	NA	7.37e-14	NA
7. B	Q9FUT3	ABC transporter B family member 23, mitochondrial	8.85e-11	NA	1.33e-16	NA
7. B	Q552P3	ABC transporter A family member 11	6.78e-07	NA	1.66e-09	NA
7. B	Q7DM58	ABC transporter C family member 4	1.58e-05	NA	6.30e-16	NA
7. B	Q9LK62	ABC transporter C family member 7	1.10e-05	NA	3.48e-06	NA
7. B	Q96J66	ATP-binding cassette sub-family C member 11	4.16e-06	NA	9.14e-10	NA
7. B	Q3JGG7	Macrolide export ATP-binding/permease protein MacB	6.12e-10	NA	1.81e-26	NA
7. B	Q9M2V6	ABC transporter G family member 17	1.85e-11	NA	8.03e-13	NA
7. B	P31060	ABC transporter ATP-binding protein ModF	1.84e-11	NA	3.66e-08	NA
7. B	Q8SQI5	Probable ABC transporter ECU01_0200/ECU01_1410	5.18e-11	NA	9.98e-19	NA
7. B	Q63563	ATP-binding cassette sub-family C member 9	1.59e-05	NA	5.39e-11	NA
7. B	Q9ZNB0	Uncharacterized ABC transporter ATP-binding protein SCO0742	2.22e-11	NA	4.39e-08	NA
7. B	Q2LVL0	ATP-dependent lipid A-core flippase	2.94e-11	NA	3.59e-19	NA
7. B	Q9KHT9	Carnitine transport ATP-binding protein OpuCA	2.22e-16	NA	4.28e-20	NA
7. B	A3DDF6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.22e-16	NA
7. B	Q8D3Z9	Putative ABC transporter ATP-binding protein VV2_1533	1.39e-13	NA	2.83e-20	NA
7. B	O66911	UvrABC system protein A	1.11e-02	NA	0.015	NA
7. B	P0A9W4	Energy-dependent translational throttle protein EttA	5.61e-07	NA	2.53e-13	NA
7. B	Q89A97	Multidrug resistance-like ATP-binding protein MdlA	7.22e-11	NA	1.04e-18	NA
7. B	Q0WJP9	Autoinducer 2 import ATP-binding protein LsrA	7.16e-14	NA	8.78e-12	NA
7. B	Q8TTN2	Putative ABC transporter ATP-binding protein MA_0394	2.00e-15	NA	6.01e-20	NA
7. B	Q9NP58	ATP-binding cassette sub-family B member 6	3.75e-09	NA	2.66e-13	NA
7. B	Q7MFH3	Putative ABC transporter ATP-binding protein VVA0347	2.04e-13	NA	2.03e-20	NA
7. B	Q57RH4	Molybdenum import ATP-binding protein ModC	2.93e-14	NA	2.69e-04	NA
7. B	P71355	Uncharacterized ABC transporter ATP-binding protein HI_0663	8.99e-12	NA	2.03e-07	NA
7. B	Q9VSS1	Protein Pixie	1.05e-07	NA	4.03e-08	NA
7. B	P9WQM1	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.58e-13	NA
7. B	Q9M9E1	ABC transporter G family member 40	9.96e-06	NA	1.57e-10	NA
7. B	Q9SGY1	ABC transporter B family member 10	4.05e-07	NA	2.58e-17	NA
7. B	P68580	Sublancin-168-processing and transport ATP-binding protein sunT	NA	NA	0.005	NA
7. B	Q9CEL9	UvrABC system protein A	1.24e-02	NA	0.036	NA
7. B	Q4UV65	ATP-dependent lipid A-core flippase	3.18e-11	NA	6.10e-14	NA
7. B	Q5HVG3	Macrolide export ATP-binding/permease protein MacB	1.76e-09	NA	4.32e-28	NA
7. B	Q02R79	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.71e-13	NA
7. B	Q8XZX8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	4.31e-16	NA
7. B	P97998	ATP-dependent permease MDL1	1.04e-10	NA	8.98e-25	NA
7. B	P0A699	UvrABC system protein A	1.26e-02	NA	5.07e-04	NA
7. B	B9G5Y5	ABC transporter G family member 25	3.79e-08	NA	1.55e-08	NA
7. B	Q2IBA1	Cystic fibrosis transmembrane conductance regulator	8.28e-05	NA	2.63e-12	NA
7. B	O06967	Multidrug resistance ABC transporter ATP-binding/permease protein BmrA	1.46e-10	NA	1.80e-15	NA
7. B	P44513	Fe(3+) ions import ATP-binding protein FbpC 2	9.99e-16	NA	1.88e-17	NA
7. B	Q983H5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.56e-11	NA	1.29e-10	NA
7. B	Q65U21	ATP-dependent lipid A-core flippase	6.23e-11	NA	5.17e-15	NA
7. B	Q5FL41	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.75e-18	NA
7. B	Q3E9B8	ABC transporter G family member 23	1.55e-11	NA	4.97e-13	NA
7. B	P0CI33	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.40e-30	NA
7. B	Q8X6U5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.67e-15	NA	1.06e-16	NA
7. B	Q21BF6	Molybdenum import ATP-binding protein ModC	2.76e-12	NA	1.35e-13	NA
7. B	Q8T683	ABC transporter G family member 9	1.57e-05	NA	4.12e-06	NA
7. B	D4GP38	Xylose/arabinose import ATP-binding protein XacJ	7.77e-16	NA	4.76e-18	NA
7. B	P23174	Phosphatidylcholine translocator ABCB4	8.05e-07	NA	4.52e-19	NA
7. B	Q1MCN6	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	1.11e-16	NA	1.18e-14	NA
7. B	Q5NIG3	ATP-dependent lipid A-core flippase	8.58e-11	NA	6.60e-16	NA
7. B	Q4A9E1	Spermidine/putrescine import ATP-binding protein PotA	2.75e-09	NA	2.26e-05	NA
7. B	P16521	Elongation factor 3A	2.02e-05	NA	1.20e-04	NA
7. B	Q65TH4	Macrolide export ATP-binding/permease protein MacB	5.04e-10	NA	1.52e-24	NA
7. B	Q9FJH6	ABC transporter F family member 1	8.15e-10	NA	4.98e-09	NA
7. B	P74548	Sulfate/thiosulfate import ATP-binding protein CysA	2.22e-16	NA	7.03e-17	NA
7. B	Q20Z38	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.10e-10	NA	7.37e-14	NA
7. B	Q65E55	Ribose import ATP-binding protein RbsA	1.14e-13	NA	5.04e-12	NA
7. B	Q8UB29	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	1.11e-16	NA	6.25e-13	NA
7. B	Q8G0I9	UvrABC system protein A	1.30e-02	NA	1.41e-04	NA
7. B	Q7NTN6	Ribose import ATP-binding protein RbsA	4.53e-13	NA	5.77e-10	NA
7. B	Q0A4U4	ATP-dependent lipid A-core flippase	3.75e-11	NA	2.30e-19	NA
7. B	P0A2V0	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.24e-10	NA	1.84e-11	NA
7. B	Q7ME63	Molybdenum import ATP-binding protein ModC	5.18e-14	NA	2.14e-11	NA
7. B	Q5P6D5	Macrolide export ATP-binding/permease protein MacB	5.40e-10	NA	2.07e-27	NA
7. B	Q4UMZ3	Putative export ATP-binding/permease protein RF_0214	1.11e-11	NA	6.32e-13	NA
7. B	O51587	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.24e-22	NA
7. B	Q8PC11	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	4.27e-19	NA
7. B	Q8FB37	Maltose/maltodextrin import ATP-binding protein MalK	6.11e-15	NA	1.11e-16	NA
7. B	A1AGY1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.67e-15	NA	3.27e-15	NA
7. B	Q07E16	Cystic fibrosis transmembrane conductance regulator	1.09e-03	NA	5.11e-12	NA
7. B	Q3KF57	Macrolide export ATP-binding/permease protein MacB 1	1.50e-13	NA	1.98e-24	NA
7. B	Q13U53	Arabinose import ATP-binding protein AraG	3.46e-13	NA	2.04e-10	NA
7. B	Q54DT1	ABC transporter A family member 9	1.90e-11	NA	5.89e-06	NA
7. B	Q9N0V3	Bile salt export pump	1.08e-06	NA	6.31e-13	NA
7. B	Q555Z5	ABC transporter A family member 4	2.74e-06	NA	7.88e-06	NA
7. B	P77265	Multidrug resistance-like ATP-binding protein MdlA	4.67e-11	NA	3.73e-16	NA
7. B	Q4X006	ABC multidrug transporter A-2	2.45e-05	NA	3.38e-07	NA
7. B	Q5HCL3	Putative ABC transporter ATP-binding protein SACOL2708	7.73e-13	NA	5.16e-23	NA
7. B	Q8Z4V6	Sulfate/thiosulfate import ATP-binding protein CysA	3.66e-15	NA	8.60e-21	NA
7. B	P30750	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.45e-23	NA
7. B	Q579Z3	Molybdenum import ATP-binding protein ModC	2.43e-13	NA	9.24e-13	NA
7. B	Q1CA99	Macrolide export ATP-binding/permease protein MacB 1	1.60e-10	NA	1.35e-30	NA
7. B	P12622	ATP-binding protein ChvD (Fragment)	4.70e-04	NA	4.80e-05	NA
7. B	Q1MA70	Molybdenum import ATP-binding protein ModC	6.09e-13	NA	1.54e-11	NA
7. B	K3VYH8	ABC transporter FPSE_09185	8.53e-07	NA	9.39e-14	NA
7. B	Q2NSZ1	Macrolide export ATP-binding/permease protein MacB	1.68e-10	NA	7.17e-30	NA
7. B	Q8DUF7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.93e-13	NA
7. B	Q1GB17	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.63e-17	NA
7. B	Q92WJ0	Fe(3+) ions import ATP-binding protein FbpC 1	1.11e-16	NA	1.23e-15	NA
7. B	Q9SW08	ABC transporter G family member 4	7.47e-13	NA	9.04e-18	NA
7. B	O85818	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	4.15e-14	NA
7. B	Q5D1Z7	Cystic fibrosis transmembrane conductance regulator	5.33e-05	NA	3.07e-11	NA
7. B	Q0HYN8	Molybdenum import ATP-binding protein ModC	1.30e-13	NA	2.50e-10	NA
7. B	Q8FJR4	Molybdenum import ATP-binding protein ModC	3.03e-14	NA	2.47e-06	NA
7. B	Q722B1	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.72e-16	NA
7. B	Q48KB2	Macrolide export ATP-binding/permease protein MacB	4.96e-10	NA	2.30e-24	NA
7. B	Q9SIT6	ABC transporter G family member 5	2.15e-12	NA	2.49e-13	NA
7. B	A0R6H7	Mycobactin import ATP-binding/permease protein IrtB	9.38e-11	NA	7.84e-18	NA
7. B	Q9TSP5	Cystic fibrosis transmembrane conductance regulator	7.54e-05	NA	1.86e-12	NA
7. B	Q49WM4	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	7.42e-11	NA
7. B	P60752	ATP-dependent lipid A-core flippase	4.96e-11	NA	1.05e-16	NA
7. B	P0A9U2	Probable multidrug ABC transporter ATP-binding protein YbhF	6.51e-14	NA	2.12e-16	NA
7. B	Q8GU86	ABC transporter G family member 43	8.63e-06	NA	7.75e-15	NA
7. B	Q2G2M9	Putative multidrug export ATP-binding/permease protein SAOUHSC_02003	1.44e-11	NA	3.45e-19	NA
7. B	Q0SBZ1	Fe(3+) ions import ATP-binding protein FbpC 1	1.22e-15	NA	8.45e-18	NA
7. B	Q9PEE7	ATP-dependent lipid A-core flippase	5.31e-12	NA	5.93e-14	NA
7. B	Q6N1Y7	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.09e-10	NA	3.69e-13	NA
7. B	Q5PGH0	ATP-dependent lipid A-core flippase	1.23e-11	NA	1.16e-15	NA
7. B	H2LNR5	Iron-sulfur clusters transporter ABCB7, mitochondrial	7.67e-08	NA	2.41e-11	NA
7. B	O14134	mRNA export factor elf1	6.84e-03	NA	0.002	NA
7. B	Q2T8T6	Ribose import ATP-binding protein RbsA 2	2.88e-13	NA	9.18e-08	NA
7. B	Q9LV93	ABC transporter F family member 5	3.83e-09	NA	2.92e-15	NA
7. B	Q664X5	Maltose/maltodextrin import ATP-binding protein MalK	8.88e-16	NA	6.43e-15	NA
7. B	Q87GB5	Maltose/maltodextrin import ATP-binding protein MalK	3.33e-16	NA	1.00e-12	NA
7. B	Q2T4S8	Arabinose import ATP-binding protein AraG 2	3.73e-13	NA	1.02e-10	NA
7. B	Q5E4V6	Ribose import ATP-binding protein RbsA	3.21e-13	NA	3.99e-09	NA
7. B	A0A1Y0BRF0	ABC-type transporter adrC	1.99e-05	NA	1.65e-06	NA
7. B	P21439	Phosphatidylcholine translocator ABCB4	8.27e-07	NA	2.42e-19	NA
7. B	A0A4P8GG95	ABC transporter eupT	4.45e-06	NA	4.00e-09	NA
7. B	Q4WDV4	ABC multidrug transporter F	6.28e-06	NA	1.50e-09	NA
7. B	Q81CT8	Putative ABC transporter ATP-binding protein BC_2655	1.79e-13	NA	4.89e-19	NA
7. B	Q9PF03	Methionine import ATP-binding protein MetN	0.00e+00	NA	8.61e-24	NA
7. B	Q9C8J8	ABC transporter G family member 13	4.63e-10	NA	1.25e-14	NA
7. B	Q13TV1	sn-glycerol-3-phosphate import ATP-binding protein UgpC	4.44e-16	NA	8.62e-14	NA
7. B	P75612	Putative ABC transporter ATP-binding protein MG065 homolog	4.11e-15	NA	1.58e-18	NA
7. B	P58428	ATP-binding cassette sub-family G member 8	4.29e-10	NA	1.21e-10	NA
7. B	G5EFD4	Heavy metal tolerance factor 1	3.85e-09	NA	4.72e-14	NA
7. B	E9RBG1	ABC multidrug transporter C	7.79e-06	NA	1.40e-07	NA
7. B	A1JJ55	Autoinducer 2 import ATP-binding protein LsrA	3.50e-14	NA	1.13e-12	NA
7. B	Q2K1C8	sn-glycerol-3-phosphate import ATP-binding protein UgpC 3	1.11e-16	NA	2.68e-15	NA
7. B	Q9ZU35	ABC transporter G family member 7	5.05e-10	NA	4.49e-13	NA
7. B	Q9RCG7	Exotoxin translocation ATP-binding protein PaxB	1.36e-09	NA	2.22e-16	NA
7. B	Q58129	Uncharacterized ABC transporter ATP-binding protein MJ0719	1.77e-08	NA	8.60e-15	NA
7. B	Q9K876	Sulfate/thiosulfate import ATP-binding protein CysA	8.88e-16	NA	5.58e-16	NA
7. B	Q7N8B9	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	1.59e-16	NA
7. B	Q2YKZ7	Putative ATP-binding protein BAB2_0493	1.11e-16	NA	2.87e-14	NA
7. B	Q8ELA5	Methionine import ATP-binding protein MetN 4	0.00e+00	NA	9.30e-31	NA
7. B	Q8T686	ABC transporter G family member 7	4.96e-06	NA	2.47e-11	NA
7. B	Q9KRT4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	2.52e-14	NA
7. B	Q9MAG3	ABC transporter G family member 24	1.13e-07	NA	1.72e-09	NA
7. B	Q4WR59	ABC multidrug transporter A-1	6.30e-06	NA	1.59e-06	NA
7. B	Q00553	Cystic fibrosis transmembrane conductance regulator	8.24e-05	NA	1.83e-12	NA
7. B	F9X9V4	ABC-type transporter MYCGRDRAFT_41235	1.33e-05	NA	1.42e-09	NA
7. B	H6WS94	Pleiotropic drug resistance protein 1	2.12e-06	NA	4.08e-07	NA
7. B	Q7TMS5	Broad substrate specificity ATP-binding cassette transporter ABCG2	2.29e-11	NA	7.51e-15	NA
7. B	P53049	Oligomycin resistance ATP-dependent permease YOR1	1.36e-05	NA	2.40e-12	NA
7. B	P60753	ATP-dependent lipid A-core flippase	1.28e-10	NA	1.05e-16	NA
7. B	Q1AVD3	Ribose import ATP-binding protein RbsA 2	6.52e-14	NA	5.87e-13	NA
7. B	P41233	Phospholipid-transporting ATPase ABCA1	1.02e-04	NA	1.03e-09	NA
7. B	Q0BKJ3	ATP-dependent lipid A-core flippase	6.68e-11	NA	9.99e-16	NA
7. B	Q7WH20	ATP-dependent lipid A-core flippase	8.42e-12	NA	6.77e-12	NA
7. B	Q9LID6	ABC transporter E family member 1	9.10e-08	NA	5.45e-10	NA
7. B	Q9H172	ATP-binding cassette sub-family G member 4	1.62e-13	NA	1.80e-15	NA
7. B	Q7N6Z2	Sulfate/thiosulfate import ATP-binding protein CysA	3.00e-15	NA	3.77e-23	NA
7. B	Q6YRJ4	Putative ABC transporter ATP-binding protein PAM_020	4.20e-13	NA	5.99e-23	NA
7. B	D0MYB4	Elongation factor 3	5.57e-03	NA	0.004	NA
7. B	Q62IG3	ATP-dependent lipid A-core flippase	5.32e-11	NA	1.02e-18	NA
7. B	D4GPW3	Glucose import ATP-binding protein TsgD13	3.04e-13	NA	1.72e-12	NA
7. B	Q54LE6	ABC transporter C family member 5	5.55e-06	NA	7.96e-08	NA
7. B	Q98G42	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	2.45e-15	NA
7. B	Q8E7N9	Ribose import ATP-binding protein RbsA	2.08e-14	NA	1.28e-12	NA
7. B	Q3K3R2	Ribose import ATP-binding protein RbsA	7.51e-14	NA	1.12e-12	NA
7. B	P25256	Tylosin resistance ATP-binding protein TlrC	4.21e-05	NA	9.10e-12	NA
7. B	P45321	Molybdenum import ATP-binding protein ModC	2.36e-14	NA	7.14e-12	NA
7. B	B9G300	ABC transporter G family member 52	6.98e-06	NA	1.75e-10	NA
7. B	P34158	Cystic fibrosis transmembrane conductance regulator	9.30e-04	NA	6.72e-10	NA
7. B	Q3SQZ1	Macrolide export ATP-binding/permease protein MacB	2.93e-10	NA	5.57e-30	NA
7. B	Q6FK23	Pleiotropic ABC efflux transporter of multiple drugs CDR1	5.70e-06	NA	1.51e-07	NA
7. B	Q11180	ABC transporter ATP-binding protein/permease wht-1	4.22e-10	NA	3.34e-06	NA
7. B	Q28689	ATP-binding cassette sub-family C member 2	2.95e-05	NA	7.48e-11	NA
7. B	P44808	Probable ATP-binding protein YheS	6.99e-09	NA	1.62e-04	NA
7. B	Q6P542	ATP-binding cassette sub-family F member 1	2.95e-07	NA	2.66e-04	NA
7. B	Q8GU88	ABC transporter G family member 39	1.27e-05	NA	5.57e-10	NA
7. B	P0AAF3	Arabinose import ATP-binding protein AraG	1.53e-13	NA	3.58e-13	NA
7. B	P9WER4	ABC-type transporter braE	NA	NA	6.45e-08	NA
7. B	Q8GU85	ABC transporter G family member 40	1.36e-05	NA	1.91e-12	NA
7. B	Q4KC87	Fe(3+) ions import ATP-binding protein FbpC	9.99e-16	NA	7.73e-15	NA
7. B	P0A196	UvrABC system protein A	1.15e-02	NA	5.07e-04	NA
7. B	Q1M8R6	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	2.22e-16	NA	9.70e-15	NA
7. B	Q8SRV5	Probable ATP-binding cassette sub-family F member 3 homolog	1.21e-09	NA	2.89e-04	NA
7. B	Q1GZI0	ATP-dependent lipid A-core flippase	3.09e-11	NA	9.97e-13	NA
7. B	Q1BX03	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	2.06e-13	NA	5.51e-10	NA
7. B	P97046	Multidrug resistance ABC transporter ATP-binding and permease protein	1.13e-10	NA	2.32e-14	NA
7. B	Q47JR8	ATP-dependent lipid A-core flippase	7.36e-12	NA	3.63e-12	NA
7. B	Q91WA9	ATP-binding cassette subfamily G member 4	1.62e-13	NA	4.45e-15	NA
7. B	Q9I2N4	Molybdenum import ATP-binding protein ModC	6.10e-13	NA	1.15e-12	NA
7. B	Q2SSS4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.11e-19	NA
7. B	Q2J2E9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	7.92e-11	NA
7. B	Q93YS4	ABC transporter G family member 22	1.26e-10	NA	5.08e-17	NA
7. B	Q31YT6	ATP-dependent lipid A-core flippase	5.58e-11	NA	1.05e-16	NA
7. B	Q1CA68	ATP-dependent lipid A-core flippase	4.39e-11	NA	3.47e-16	NA
7. B	Q73BM0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.69e-18	NA
7. B	Q9UG63	ATP-binding cassette sub-family F member 2	6.24e-10	NA	1.29e-04	NA
7. B	Q5SSE9	ATP-binding cassette sub-family A member 13	NA	NA	1.67e-04	NA
7. B	Q2K6L3	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	3.33e-16	NA	1.14e-14	NA
7. B	Q8K449	ATP-binding cassette sub-family A member 9	4.45e-06	NA	1.72e-11	NA
7. B	Q7WP62	Molybdenum import ATP-binding protein ModC	1.32e-12	NA	8.04e-06	NA
7. B	Q4GZT4	Broad substrate specificity ATP-binding cassette transporter ABCG2	1.93e-11	NA	3.14e-14	NA
7. B	P0AAG7	Multidrug resistance-like ATP-binding protein MdlB	1.33e-11	NA	1.19e-10	NA
7. B	Q8LPK0	ABC transporter A family member 8	1.57e-09	NA	6.94e-10	NA
7. B	Q1RAN8	Arabinose import ATP-binding protein AraG	1.56e-13	NA	5.22e-13	NA
7. B	A0A0M3R8G1	ABC transporter G family member STR	1.08e-09	NA	1.55e-13	NA
7. B	Q9CXJ4	Mitochondrial potassium channel ATP-binding subunit	3.44e-10	NA	3.99e-17	NA
7. B	Q65SW3	Molybdenum import ATP-binding protein ModC	1.64e-14	NA	4.17e-09	NA
7. B	Q8UCD5	Molybdenum import ATP-binding protein ModC	4.19e-14	NA	1.13e-16	NA
7. B	Q87LA0	UvrABC system protein A	1.21e-02	NA	0.011	NA
7. B	Q84K47	ABC transporter A family member 2	1.05e-09	NA	7.74e-06	NA
7. B	Q82JY6	Fe(3+) ions import ATP-binding protein FbpC	1.78e-15	NA	8.86e-19	NA
7. B	P0CZ40	UvrABC system protein A	1.43e-02	NA	0.009	NA
7. B	Q3K0Y6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.03e-12	NA
7. B	Q9LFG8	ABC transporter G family member 20	3.37e-11	NA	1.23e-09	NA
7. B	P75264	Putative ABC transporter ATP-binding protein MG187 homolog	8.16e-06	NA	1.40e-06	NA
7. B	P23886	ATP-binding/permease protein CydC	1.94e-11	NA	1.95e-21	NA
7. B	Q3KBH4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.62e-12	NA
7. B	P34712	Multidrug resistance protein pgp-1	1.15e-06	NA	1.69e-14	NA
7. B	Q480N3	ATP-dependent lipid A-core flippase 2	5.09e-11	NA	1.40e-13	NA
7. B	P45843	Protein scarlet	1.73e-10	NA	1.83e-09	NA
7. B	Q8RBQ1	Putative ribose/galactose/methyl galactoside import ATP-binding protein	1.60e-13	NA	1.18e-17	NA
7. B	Q6GFJ1	Putative multidrug export ATP-binding/permease protein SAR1956	1.59e-11	NA	3.45e-19	NA
7. B	Q53194	Probable peptide ABC transporter ATP-binding protein y4tS	0.00e+00	NA	4.19e-18	NA
7. B	G7CBF5	Mycobactin import ATP-binding/permease protein IrtA	7.99e-08	NA	1.18e-14	NA
7. B	Q66CL2	Macrolide export ATP-binding/permease protein MacB 1	2.15e-10	NA	1.35e-30	NA
7. B	Q9CMS0	Molybdenum import ATP-binding protein ModC	2.82e-14	NA	6.69e-08	NA
7. B	Q9USH9	Uncharacterized ABC transporter ATP-binding protein C825.01	3.36e-08	NA	1.20e-07	NA
7. B	Q8NUH8	Putative ABC transporter ATP-binding protein MW2603	9.62e-13	NA	1.60e-22	NA
7. B	P53706	Alpha-factor-transporting ATPase	5.64e-06	NA	1.14e-08	NA
7. B	P94367	ATP-binding/permease protein CydD	1.88e-12	NA	1.21e-14	NA
7. B	P45081	ATP-binding/permease protein CydC	1.78e-11	NA	8.62e-21	NA
7. B	Q9SKX0	ABC transporter C family member 13	2.28e-06	NA	6.97e-06	NA
7. B	Q9CMG7	ATP-dependent lipid A-core flippase	1.43e-10	NA	3.37e-12	NA
7. B	Q1RDU4	ATP-dependent lipid A-core flippase	4.19e-11	NA	9.78e-17	NA
7. B	P9WQL2	Molybdenum import ATP-binding protein ModC	1.04e-13	NA	5.37e-21	NA
7. B	Q54TV1	ABC transporter G family member 6	8.28e-06	NA	5.25e-10	NA
7. B	Q8T6H8	ABC transporter C family member 1	2.93e-06	NA	1.37e-08	NA
7. B	Q4WFQ4	ABC multidrug transporter H	2.13e-05	NA	0.002	NA
7. B	Q99LE6	ATP-binding cassette sub-family F member 2	1.01e-09	NA	1.52e-04	NA
7. B	Q54CG0	ABC transporter G family member 10	4.29e-06	NA	2.79e-08	NA
7. B	Q4WA92	ABC multidrug transporter E	4.90e-07	NA	2.80e-13	NA
7. B	Q4HVU7	Iron-sulfur clusters transporter ATM1, mitochondrial	8.34e-11	NA	1.80e-14	NA
7. B	P45844	ATP-binding cassette sub-family G member 1	4.71e-13	NA	2.23e-16	NA
7. B	P63354	Sulfate/thiosulfate import ATP-binding protein CysA	2.66e-15	NA	1.40e-17	NA
7. B	Q9FNB5	ABC transporter G family member 6	2.50e-11	NA	7.31e-12	NA
7. B	Q9QYJ4	ABC-type oligopeptide transporter ABCB9	4.11e-09	NA	3.44e-12	NA
7. B	Q9FLT8	ABC transporter A family member 12	2.77e-09	NA	8.61e-07	NA
7. B	Q8ZQM4	Glutathione import ATP-binding protein GsiA	1.61e-13	NA	4.37e-09	NA
7. B	P0AAG6	Multidrug resistance-like ATP-binding protein MdlB	1.34e-11	NA	1.19e-10	NA
7. B	A7A063	ABC transporter NFT1	2.13e-05	NA	1.42e-07	NA
7. B	Q55107	Bicarbonate transport ATP-binding protein CmpC	1.06e-11	NA	5.38e-14	NA
7. B	P78595	Multidrug resistance protein CDR2	4.47e-06	NA	4.36e-07	NA
7. B	Q2SMN9	Macrolide export ATP-binding/permease protein MacB	1.39e-10	NA	3.82e-31	NA
7. B	Q8D954	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	1.47e-13	NA
7. B	P69877	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	8.73e-11	NA
7. B	Q8X5U9	UvrABC system protein A	1.20e-02	NA	5.07e-04	NA
7. B	Q63VX7	ATP-dependent lipid A-core flippase	2.20e-11	NA	1.02e-18	NA
7. B	Q8DIA0	Sulfate/thiosulfate import ATP-binding protein CysA	0.00e+00	NA	2.88e-16	NA
7. B	Q483B6	ATP-dependent lipid A-core flippase 1	1.47e-10	NA	2.97e-16	NA
7. B	O95477	Phospholipid-transporting ATPase ABCA1	1.01e-04	NA	8.99e-10	NA
7. B	Q3MB44	Ribose import ATP-binding protein RbsA	1.57e-13	NA	4.59e-14	NA
7. B	P0A9W3	Energy-dependent translational throttle protein EttA	8.82e-10	NA	2.53e-13	NA
7. B	Q578K3	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	7.32e-14	NA
7. B	Q54U44	ABC transporter C family member 12	3.43e-06	NA	7.85e-09	NA
7. B	P35598	Putative ABC transporter ATP-binding protein exp8	1.61e-10	NA	2.02e-08	NA
7. B	P0C2H3	Macrolide export ATP-binding/permease protein MacB 2	1.88e-10	NA	3.28e-32	NA
7. B	Q881C1	Molybdenum import ATP-binding protein ModC	1.17e-13	NA	7.25e-10	NA
7. B	B1XEA1	Autoinducer 2 import ATP-binding protein LsrA	2.45e-14	NA	3.86e-10	NA
7. B	Q1QYT1	Arabinose import ATP-binding protein AraG	5.97e-14	NA	3.58e-16	NA
7. B	Q8YHC4	UvrABC system protein A	1.25e-02	NA	1.43e-04	NA
7. B	Q7PC84	ABC transporter G family member 39	1.19e-05	NA	7.53e-08	NA
7. B	Q8PKS5	ATP-dependent lipid A-core flippase	1.27e-11	NA	1.70e-13	NA
7. B	Q8RGC8	Fe(3+) ions import ATP-binding protein FbpC	7.77e-16	NA	1.25e-14	NA
7. B	A1U0A9	Macrolide export ATP-binding/permease protein MacB	2.11e-10	NA	1.44e-30	NA
7. B	Q17320	Protein white	1.19e-10	NA	5.27e-14	NA
7. B	O31716	Uncharacterized ABC transporter ATP-binding protein YkpA	9.40e-07	NA	1.62e-04	NA
7. B	P9WQI8	Hydrophilic compounds import ATP-binding/permease protein BacA	1.02e-07	NA	2.64e-05	NA
7. B	A1CFM0	ABC transporter patM	8.14e-06	NA	8.29e-08	NA
7. B	Q2G2A7	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q93DA2	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.00e-23	NA
7. B	Q8DCJ3	UvrABC system protein A	1.06e-02	NA	0.005	NA
7. B	Q57293	Fe(3+) ions import ATP-binding protein FbpC	0.00e+00	NA	2.84e-14	NA
7. B	Q28QL7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	1.38e-13	NA
7. B	Q98K15	Ribose import ATP-binding protein RbsA 1	2.06e-13	NA	1.23e-07	NA
7. B	Q9KUW5	UvrABC system protein A	1.19e-02	NA	0.007	NA
7. B	Q6G2Z5	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	2.37e-11	NA	4.39e-16	NA
7. B	P47261	Putative ABC transporter ATP-binding protein MG015	1.91e-10	NA	1.34e-09	NA
7. B	Q82CM5	Ribose import ATP-binding protein RbsA 1	6.55e-13	NA	3.55e-10	NA
7. B	Q8FB02	UvrABC system protein A	1.24e-02	NA	5.02e-04	NA
7. B	Q3BTC8	ATP-dependent lipid A-core flippase	9.58e-12	NA	2.43e-13	NA
7. B	Q54R52	ABC transporter A family member 10	7.40e-07	NA	3.54e-10	NA
7. B	P9WEU4	ABC multidrug transporter AFR1	6.35e-06	NA	1.94e-06	NA
7. B	Q751N2	Iron-sulfur clusters transporter ATM1, mitochondrial	1.57e-10	NA	7.85e-15	NA
7. B	P0CZ35	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.02e-10	NA
7. B	Q4A7I1	Spermidine/putrescine import ATP-binding protein PotA	2.78e-09	NA	2.24e-05	NA
7. B	Q99QV7	Putative ABC transporter ATP-binding protein SAV2684	9.92e-13	NA	5.11e-23	NA
7. B	Q6AJW3	ATP-dependent lipid A-core flippase	1.44e-11	NA	4.65e-21	NA
7. B	Q66CI3	ATP-dependent lipid A-core flippase	4.52e-11	NA	3.47e-16	NA
7. B	Q8UA73	Sulfate/thiosulfate import ATP-binding protein CysA 2	3.33e-16	NA	3.53e-14	NA
7. B	A0RP01	Macrolide export ATP-binding/permease protein MacB	4.64e-10	NA	3.29e-26	NA
7. B	Q0TJM0	Glutathione import ATP-binding protein GsiA	1.64e-13	NA	4.41e-09	NA
7. B	P51533	ATP-dependent permease PDR10	3.45e-05	NA	4.19e-07	NA
7. B	Q8CPN0	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	3.56e-13	NA
7. B	Q6LH11	Ribose import ATP-binding protein RbsA	3.73e-13	NA	1.50e-08	NA
7. B	P20162	Lipopolysaccharide export system ATP-binding protein LptB (Fragment)	NA	NA	0.005	NA
7. B	P08716	Alpha-hemolysin translocation ATP-binding protein HlyB	2.00e-09	NA	3.51e-17	NA
7. B	Q9LJX0	ABC transporter B family member 19	4.88e-07	NA	3.87e-19	NA
7. B	Q6G1V5	Macrolide export ATP-binding/permease protein MacB	2.98e-13	NA	7.49e-32	NA
7. B	Q4W575	Fe(3+) ions import ATP-binding protein FbpC	1.44e-15	NA	4.15e-19	NA
7. B	Q2PBM3	Autoinducer 2 import ATP-binding protein LsrA	1.44e-14	NA	4.47e-14	NA
7. B	O31339	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	6.81e-20	NA
7. B	A1B9Q7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	2.63e-14	NA
7. B	P36372	Antigen peptide transporter 2	3.21e-08	NA	7.62e-14	NA
7. B	Q0TJH0	Macrolide export ATP-binding/permease protein MacB	1.79e-10	NA	2.08e-29	NA
7. B	Q10418	Mesentericin-Y105 transport/processing ATP-binding protein MesD	1.91e-09	NA	3.82e-16	NA
7. B	Q8T9W2	ABC transporter B family member 5	1.16e-09	NA	1.96e-14	NA
7. B	P42246	Uncharacterized ABC transporter ATP-binding protein YcbN	0.00e+00	NA	3.20e-11	NA
7. B	P73412	UvrABC system protein A	3.23e-02	NA	0.003	NA
7. B	Q4QJQ0	Molybdenum import ATP-binding protein ModC	3.06e-14	NA	2.11e-12	NA
7. B	Q7VR44	ATP-dependent lipid A-core flippase	6.67e-12	NA	1.53e-11	NA
7. B	Q9ZUT0	ABC transporter G family member 2	5.48e-11	NA	5.55e-11	NA
7. B	Q0T5R2	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	2.40e-11	NA
7. B	Q4L5B3	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	6.22e-12	NA
7. B	Q1CFP9	Molybdenum import ATP-binding protein ModC	7.46e-14	NA	1.35e-10	NA
7. B	Q8ST66	ABC transporter G family member 18	8.77e-06	NA	7.10e-13	NA
7. B	Q9LZJ5	ABC transporter C family member 14	1.79e-05	NA	9.07e-15	NA
7. B	Q38VW6	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	5.78e-13	NA
7. B	Q2SJB5	Molybdenum import ATP-binding protein ModC	1.66e-12	NA	5.97e-11	NA
7. B	A2WSH0	ABC transporter G family member 36	1.27e-05	NA	2.24e-09	NA
7. B	Q1C607	Fe(3+) ions import ATP-binding protein FbpC	4.12e-14	NA	2.86e-14	NA
7. B	C7J6G6	ABC transporter G family member 46	7.65e-06	NA	1.11e-09	NA
7. B	Q9JVH1	Fe(3+) ions import ATP-binding protein FbpC	1.67e-15	NA	4.15e-19	NA
7. B	Q2A1U9	ATP-dependent lipid A-core flippase	6.19e-11	NA	9.99e-16	NA
7. B	P9WQJ6	Mycobactin import ATP-binding/permease protein IrtB	4.09e-11	NA	2.75e-19	NA
7. B	Q3Z3K7	ATP-dependent lipid A-core flippase	4.29e-11	NA	1.37e-16	NA
7. B	O83321	Probable riboflavin import ATP-binding protein RfuB	3.63e-10	NA	6.52e-07	NA
7. B	Q7VL52	ATP-dependent lipid A-core flippase	1.53e-11	NA	3.00e-14	NA
7. B	Q8K442	ABC-type organic anion transporter ABCA8A	7.19e-06	NA	2.01e-10	NA
7. B	Q1MHS1	Ribose import ATP-binding protein RbsA 1	1.61e-13	NA	6.15e-10	NA
7. B	P10091	Sulfate/thiosulfate import ATP-binding protein CysA	2.66e-15	NA	3.96e-12	NA
7. B	P0CL93	Iron-sulfur clusters transporter ATM1, mitochondrial	2.11e-10	NA	2.92e-15	NA
7. B	P38045	Nitrate import ATP-binding protein NrtC	1.20e-13	NA	1.11e-12	NA
7. B	Q8T6J5	ABC transporter A family member 2	4.98e-06	NA	4.69e-07	NA
7. B	Q9CL63	Ribose import ATP-binding protein RbsA 2	5.93e-13	NA	1.82e-13	NA
7. B	Q9C8H0	ABC transporter C family member 12	1.09e-05	NA	2.16e-06	NA
7. B	Q5QU36	ATP-dependent lipid A-core flippase	4.72e-11	NA	3.36e-13	NA
7. B	Q8LQX2	ABC transporter G family member 32	8.90e-06	NA	2.08e-09	NA
7. B	Q98K23	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-15	NA	6.59e-18	NA
7. B	P0C0Z2	UvrABC system protein A	1.25e-02	NA	1.33e-04	NA
7. B	Q8ENB3	Ribose import ATP-binding protein RbsA	2.28e-13	NA	3.20e-13	NA
7. B	P26760	Toxin RTX-I translocation ATP-binding protein	1.11e-09	NA	6.90e-19	NA
7. B	Q6LQ00	Putative ABC transporter ATP-binding protein PBPRA2240	1.17e-13	NA	1.26e-18	NA
7. B	Q81TH8	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.01e-18	NA
7. B	P0CE70	ABC transporter NFT1	1.96e-05	NA	1.60e-07	NA
7. B	Q8R420	Phospholipid-transporting ATPase ABCA3	3.81e-06	NA	6.27e-11	NA
7. B	Q99T13	Putative multidrug export ATP-binding/permease protein SAV1866	1.70e-11	NA	3.45e-19	NA
7. B	Q97KS6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.20e-15	NA
7. B	Q7YR37	ATP-binding cassette sub-family F member 1	1.52e-07	NA	1.91e-04	NA
7. B	Q94A18	ABC transporter G family member 29	3.20e-06	NA	1.24e-08	NA
7. B	Q8IZY2	Phospholipid-transporting ATPase ABCA7	5.98e-05	NA	2.25e-06	NA
7. B	P08183	ATP-dependent translocase ABCB1	7.87e-07	NA	3.27e-18	NA
7. B	P75176	UvrABC system protein A	1.19e-02	NA	0.004	NA
7. B	Q9P5N0	Vacuolar heme ABC transmembrane exporter abc3	1.26e-05	NA	7.01e-12	NA
7. B	O34641	ABC transporter ATP-binding protein YtrB	5.55e-16	NA	2.21e-07	NA
7. B	F2PLH2	ABC multidrug transporter MDR1	1.42e-05	NA	4.89e-07	NA
7. B	Q8NE71	ATP-binding cassette sub-family F member 1	2.93e-07	NA	1.47e-04	NA
7. B	A0A1V0QSE4	ABC-type transporter eriD	3.51e-06	NA	7.12e-06	NA
7. B	Q84M24	ABC transporter A family member 1	1.96e-05	NA	6.55e-07	NA
7. B	G4N2B5	ABC transporter 7	1.54e-04	NA	5.91e-08	NA
7. B	Q8D2U8	ATP-dependent lipid A-core flippase	7.72e-11	NA	1.10e-16	NA
7. B	Q891M1	Ribose import ATP-binding protein RbsA	1.14e-13	NA	5.63e-13	NA
7. B	Q9JW59	ATP-dependent lipid A-core flippase	1.03e-11	NA	1.00e-16	NA
7. B	Q2QLA3	Cystic fibrosis transmembrane conductance regulator	7.47e-05	NA	4.66e-12	NA
7. B	Q9SZR9	ABC transporter G family member 9	9.68e-11	NA	4.53e-14	NA
7. B	Q7CN92	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.42e-10	NA
7. B	Q03AH0	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.62e-17	NA
7. B	P59653	Transport/processing ATP-binding protein ComA	2.77e-09	NA	8.62e-18	NA
7. B	P39115	Ribosome protection protein VmlR	1.15e-07	NA	2.74e-13	NA
7. B	P10089	Alpha-hemolysin translocation ATP-binding protein HlyB	1.85e-09	NA	3.32e-17	NA
7. B	Q04JW0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.47e-12	NA
7. B	P71082	Putative multidrug export ATP-binding/permease protein YgaD	6.19e-11	NA	2.12e-15	NA
7. B	Q5M397	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.10e-13	NA
7. B	P45167	ATP-binding protein Uup-like	1.18e-10	NA	5.00e-08	NA
7. B	Q54BT5	ABC transporter A family member 3	1.28e-05	NA	6.93e-04	NA
7. B	Q63E84	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.69e-18	NA
7. B	Q9X2W0	Microcin-J25 export ATP-binding/permease protein McjD	3.25e-10	NA	6.49e-11	NA
7. B	Q9STT6	ABC transporter A family member 6	2.27e-09	NA	1.86e-09	NA
7. B	Q9UT95	Uncharacterized ABC transporter ATP-binding protein C323.04	1.06e-10	NA	5.79e-05	NA
7. B	Q3Z3V4	Glutathione import ATP-binding protein GsiA	1.37e-13	NA	5.50e-09	NA
7. B	Q8PZN0	Putative ABC transporter ATP-binding protein MM_0462	7.11e-15	NA	5.23e-21	NA
7. B	Q6GAB5	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q2KVS6	Macrolide export ATP-binding/permease protein MacB	2.74e-14	NA	1.47e-31	NA
7. B	Q23868	Serine protease/ABC transporter B family protein tagC	4.85e-05	NA	1.34e-11	NA
7. B	Q5A762	Multiple drug resistance-associated protein-like transporter 1	3.80e-05	NA	1.79e-07	NA
7. B	Q5LX21	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.22e-16	NA	6.62e-12	NA
7. B	Q83L12	Autoinducer 2 import ATP-binding protein LsrA	2.61e-14	NA	4.32e-10	NA
7. B	Q2KYS6	ATP-dependent lipid A-core flippase	2.42e-11	NA	3.38e-13	NA
7. B	Q08972	[NU+] prion formation protein 1	8.67e-03	NA	4.37e-06	NA
7. B	Q75EV6	Elongation factor 3	8.29e-03	NA	2.37e-04	NA
7. B	Q8XZP8	Sulfate/thiosulfate import ATP-binding protein CysA	9.99e-16	NA	1.37e-14	NA
7. B	Q8NR12	Ribose import ATP-binding protein RbsA	5.77e-13	NA	2.10e-13	NA
7. B	P21449	Multidrug resistance protein 2	8.24e-07	NA	2.97e-18	NA
7. B	Q4ZSS5	Molybdenum import ATP-binding protein ModC	2.36e-13	NA	1.01e-09	NA
7. B	Q09429	ATP-binding cassette sub-family C member 8	2.13e-05	NA	5.46e-08	NA
7. B	P9WQL3	Molybdenum import ATP-binding protein ModC	7.17e-14	NA	5.37e-21	NA
7. B	Q9M0M2	ABC transporter B family member 9	6.92e-07	NA	6.65e-17	NA
7. B	Q0JLC5	ABC transporter G family member 36	1.28e-05	NA	2.24e-09	NA
7. B	Q1BWN5	Ribose import ATP-binding protein RbsA 1	3.31e-13	NA	1.01e-08	NA
7. B	O05519	Putative ATP-binding protein YdiF	7.53e-09	NA	1.16e-14	NA
7. B	Q32E34	ATP-dependent lipid A-core flippase	5.11e-11	NA	1.05e-16	NA
7. B	Q9A7X1	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	9.21e-13	NA
7. B	Q4WWW3	ABC multidrug transporter atrI	7.00e-06	NA	2.34e-06	NA
7. B	Q8T674	ABC transporter G family member 20	3.03e-10	NA	2.90e-13	NA
7. B	Q87G35	Putative ABC transporter ATP-binding protein VPA1482	2.85e-13	NA	1.28e-21	NA
7. B	Q89UT8	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.56e-10	NA	5.05e-14	NA
7. B	Q9STT7	ABC transporter A family member 5	1.86e-09	NA	6.10e-05	NA
7. B	Q57QC8	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	6.28e-11	NA
7. B	Q2K3Y7	Arabinose import ATP-binding protein AraG	7.72e-14	NA	1.78e-08	NA
7. B	P63396	Uncharacterized ABC transporter ATP-binding protein Mb1312c	2.93e-13	NA	1.32e-17	NA
7. B	Q1BRZ8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.99e-16	NA	1.12e-13	NA
7. B	Q59056	Uncharacterized ABC transporter ATP-binding protein MJ1662	3.24e-08	NA	4.98e-14	NA
7. B	Q0C1N8	Macrolide export ATP-binding/permease protein MacB	1.40e-09	NA	3.48e-25	NA
7. B	P13568	Multidrug resistance protein	1.17e-05	NA	1.50e-18	NA
7. B	P57445	ATP-binding protein Uup	2.35e-09	NA	2.30e-05	NA
7. B	Q9GTN7	Serine protease/ABC transporter B family protein tagA	3.62e-05	NA	8.39e-11	NA
7. B	P41234	ATP-binding cassette sub-family A member 2	2.60e-04	NA	4.36e-09	NA
7. B	Q6HLQ9	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.53e-18	NA
7. B	Q46Y89	ATP-dependent lipid A-core flippase	5.53e-11	NA	2.24e-15	NA
7. B	Q92MP8	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.47e-13	NA	2.30e-09	NA
7. B	Q7GB25	ABC transporter C family member 5	1.27e-05	NA	2.87e-12	NA
7. B	P0CE68	ABC transporter NFT1	4.49e-05	NA	5.34e-05	NA
7. B	P75551	Oligopeptide transport ATP-binding protein OppF	1.61e-02	NA	5.65e-12	NA
7. B	Q8X5Q4	Ribose import ATP-binding protein RbsA 2	2.37e-13	NA	1.21e-14	NA
7. B	Q6BXD7	Iron-sulfur clusters transporter ATM1, mitochondrial	1.78e-10	NA	5.51e-12	NA
7. B	Q8CG09	Multidrug resistance-associated protein 1	2.44e-05	NA	1.05e-08	NA
7. B	O88563	ATP-binding cassette sub-family C member 3	1.92e-05	NA	1.16e-07	NA
7. B	A0K718	Ribose import ATP-binding protein RbsA 1	2.97e-13	NA	1.01e-08	NA
7. B	Q04G50	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	2.27e-18	NA
7. B	Q9JXR3	ATP-dependent lipid A-core flippase	3.63e-11	NA	2.54e-16	NA
7. B	Q32EY4	Spermidine/putrescine import ATP-binding protein PotA	3.33e-16	NA	9.69e-11	NA
7. B	P9WEU3	ABC multidrug transporter AFR2	2.47e-05	NA	5.32e-09	NA
7. B	P26361	Cystic fibrosis transmembrane conductance regulator	7.70e-04	NA	8.46e-11	NA
7. B	A0KMJ3	Macrolide export ATP-binding/permease protein MacB 2	9.50e-11	NA	7.03e-29	NA
7. B	Q3Z2Z3	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.42e-10	NA
7. B	P29018	ATP-binding/permease protein CydD	1.98e-10	NA	2.07e-05	NA
7. B	M2UCE5	ABC-type transporter oblD	7.91e-06	NA	9.96e-08	NA
7. B	Q9TKX3	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	3.03e-14	NA
7. B	Q54HM0	ABC transporter G family member 16	9.21e-06	NA	7.86e-07	NA
7. B	Q8EUR3	Spermidine/putrescine import ATP-binding protein PotA	4.65e-06	NA	4.17e-06	NA
7. B	Q1QX69	ATP-dependent lipid A-core flippase	9.39e-11	NA	4.86e-20	NA
7. B	P33527	Multidrug resistance-associated protein 1	2.52e-05	NA	1.67e-07	NA
7. B	Q8WWZ7	Cholesterol transporter ABCA5	5.72e-06	NA	3.01e-08	NA
7. B	Q83LP0	ATP-dependent lipid A-core flippase	6.56e-11	NA	1.02e-16	NA
7. B	Q21UI2	Molybdenum import ATP-binding protein ModC	3.95e-12	NA	7.30e-12	NA
7. B	Q1RE44	Macrolide export ATP-binding/permease protein MacB	1.80e-10	NA	2.18e-29	NA
7. B	Q8T673	ABC transporter G family member 21	3.90e-06	NA	5.32e-06	NA
7. B	P47433	Putative ABC transporter ATP-binding protein MG187	1.79e-05	NA	8.85e-08	NA
7. B	Q5PFQ7	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	3.33e-16	NA	7.71e-17	NA
7. B	O34992	Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA	1.11e-16	NA	4.14e-17	NA
7. B	Q2YKR8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	6.62e-13	NA
7. B	Q98PL2	UvrABC system protein A	3.48e-02	NA	0.007	NA
7. B	Q57538	Probable ABC transporter ATP-binding/permease protein HI_0664	6.55e-11	NA	5.64e-15	NA
7. B	P55570	Uncharacterized ABC transporter ATP-binding protein y4mK	3.50e-13	NA	3.41e-11	NA
7. B	Q5T3U5	ATP-binding cassette sub-family C member 10	6.52e-06	NA	1.32e-06	NA
7. B	Q0I4C5	ATP-dependent lipid A-core flippase	6.35e-11	NA	2.39e-14	NA
7. B	Q9ZCM8	Putative export ATP-binding/permease protein RP696	1.23e-11	NA	4.06e-15	NA
7. B	Q8EUL1	UvrABC system protein A	1.29e-02	NA	0.005	NA
7. B	Q3ATR5	Macrolide export ATP-binding/permease protein MacB	1.03e-09	NA	1.84e-27	NA
7. B	Q8XK20	Putative ABC transporter ATP-binding protein CPE1583	1.60e-13	NA	8.09e-22	NA
7. B	Q8D3V0	Maltose/maltodextrin import ATP-binding protein MalK	3.33e-16	NA	9.54e-13	NA
7. B	P75059	Spermidine/putrescine import ATP-binding protein PotA	1.36e-06	NA	1.29e-05	NA
7. B	Q9SYI2	ABC transporter B family member 3	4.84e-07	NA	6.53e-16	NA
7. B	Q81N53	Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118	5.24e-13	NA	2.84e-19	NA
7. B	Q7NIW1	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	1.21e-14	NA
7. B	Q8ZJ07	UvrABC system protein A	3.73e-02	NA	0.001	NA
7. B	Q0WML0	ABC transporter B family member 27	8.87e-11	NA	5.12e-16	NA
7. B	A0A1U8QT10	ABC multidrug transporter atrA	6.70e-06	NA	1.16e-06	NA
7. B	Q9LSJ8	ABC transporter B family member 16	3.86e-07	NA	4.95e-15	NA
7. B	Q8YE15	Molybdenum import ATP-binding protein ModC	3.37e-13	NA	1.90e-13	NA
7. B	Q48P40	ATP-dependent lipid A-core flippase	8.67e-11	NA	1.57e-12	NA
7. B	Q08234	Uncharacterized ABC transporter ATP-binding protein/permease YOL075C	7.27e-06	NA	2.30e-11	NA
7. B	E9PX95	ATP-binding cassette sub-family A member 17	4.84e-06	NA	6.79e-09	NA
7. B	P10090	Protein white	8.80e-10	NA	8.63e-14	NA
7. B	P33302	Pleiotropic ABC efflux transporter of multiple drugs	6.33e-06	NA	9.43e-08	NA
7. B	P0A9U5	Probable ATP-binding protein YbiT	1.88e-09	NA	2.12e-10	NA
7. B	Q1RK71	UvrABC system protein A	1.09e-02	NA	1.10e-04	NA
7. B	Q03195	Translation initiation factor RLI1	6.67e-08	NA	8.93e-07	NA
7. B	Q5Z9S8	ABC transporter G family member 42	4.71e-05	NA	4.47e-08	NA
7. B	P55453	Uncharacterized ABC transporter ATP-binding protein y4fO	5.55e-16	NA	3.10e-19	NA
7. B	O35600	Retinal-specific phospholipid-transporting ATPase ABCA4	9.41e-05	NA	5.64e-08	NA
7. B	Q8T664	ABC transporter H family member 2	5.78e-11	NA	1.83e-20	NA
7. B	P21441	Multidrug resistance protein	1.35e-05	NA	9.27e-05	NA
7. B	Q14JW6	ATP-dependent lipid A-core flippase	2.11e-10	NA	6.60e-16	NA
7. B	P34713	Multidrug resistance protein pgp-3	4.34e-07	NA	4.70e-15	NA
7. B	Q8YH20	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.29e-10	NA	3.53e-12	NA
7. B	Q6F9X0	ATP-dependent lipid A-core flippase	2.44e-11	NA	2.82e-09	NA
7. B	Q7NWX3	Sulfate/thiosulfate import ATP-binding protein CysA 2	0.00e+00	NA	2.00e-18	NA
7. B	Q8ZLF4	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.44e-15	NA	4.37e-15	NA
7. B	Q89L46	UvrABC system protein A	1.56e-02	NA	3.90e-04	NA
7. B	P43245	ATP-dependent translocase ABCB1	7.42e-07	NA	7.60e-19	NA
7. B	Q48TP4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.02e-10	NA
7. B	Q9FHF1	ABC transporter B family member 7	7.09e-07	NA	9.45e-16	NA
7. B	P9WQJ1	Uncharacterized ABC transporter ATP-binding protein Rv1273c	3.65e-11	NA	2.37e-11	NA
7. B	A8A066	Autoinducer 2 import ATP-binding protein LsrA	2.75e-14	NA	3.93e-10	NA
7. B	Q8Z1U0	Maltose/maltodextrin import ATP-binding protein MalK	5.44e-15	NA	1.34e-15	NA
7. B	Q39KB9	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.99e-16	NA	7.93e-13	NA
7. B	Q9PDN2	Sulfate/thiosulfate import ATP-binding protein CysA	5.55e-16	NA	6.00e-19	NA
7. B	Q9ZUT8	ABC transporter G family member 33	2.22e-06	NA	4.65e-10	NA
7. B	Q1RE96	Glutathione import ATP-binding protein GsiA	1.30e-13	NA	4.70e-09	NA
7. B	Q82VK1	Macrolide export ATP-binding/permease protein MacB	7.16e-10	NA	7.07e-29	NA
7. B	P0A9U3	Probable ATP-binding protein YbiT	1.49e-09	NA	2.12e-10	NA
7. B	Q9SYI3	ABC transporter B family member 5	6.38e-07	NA	1.50e-16	NA
7. B	O35379	Multidrug resistance-associated protein 1	2.33e-05	NA	2.73e-08	NA
7. B	O59672	Uncharacterized ABC transporter ATP-binding protein C29A3.09c	7.11e-09	NA	3.61e-09	NA
7. B	P33951	ATP-binding protein SyrD	4.55e-10	NA	3.29e-11	NA
7. B	Q5F6V6	Macrolide export ATP-binding/permease protein MacB	5.54e-10	NA	2.49e-23	NA
7. B	Q2KJA2	ATP-binding cassette sub-family F member 2	7.99e-10	NA	2.16e-04	NA
7. B	Q1J6Q6	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.94e-10	NA
7. B	F2Q5G0	ABC multidrug transporter MDR2	4.27e-06	NA	4.46e-15	NA
7. B	Q08409	ATP-dependent permease AUS1	1.51e-05	NA	3.16e-04	NA
7. B	Q7CG00	Ribose import ATP-binding protein RbsA	3.02e-13	NA	2.27e-13	NA
7. B	Q4KES7	Macrolide export ATP-binding/permease protein MacB 1	5.19e-10	NA	1.39e-21	NA
7. B	Q7N6C6	ATP-dependent lipid A-core flippase	4.20e-11	NA	4.98e-14	NA
7. B	Q8HXQ5	Multidrug resistance-associated protein 1	2.26e-05	NA	3.89e-09	NA
7. B	C8ZCR2	ABC transporter NFT1	2.16e-05	NA	1.75e-07	NA
7. B	Q00748	Multidrug resistance protein homolog 65	1.33e-06	NA	6.19e-18	NA
7. B	P37624	Ribosome-associated ATPase	2.24e-10	NA	1.16e-15	NA
7. B	Q65QT6	Maltose/maltodextrin import ATP-binding protein MalK	4.44e-16	NA	3.37e-18	NA
7. B	Q6LHL2	Molybdenum import ATP-binding protein ModC	1.27e-13	NA	8.64e-12	NA
7. B	Q8UF79	Zinc import ATP-binding protein ZnuC	1.11e-16	NA	3.59e-14	NA
7. B	Q9WXX0	Ribose import ATP-binding protein RbsA 1	1.44e-13	NA	4.19e-14	NA
7. B	A1JIE0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	2.86e-16	NA
7. B	O07549	Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH	1.62e-09	NA	2.09e-13	NA
7. B	Q323W5	Glutathione import ATP-binding protein GsiA	1.02e-14	NA	6.15e-09	NA
7. B	P54933	ATP-binding transport protein SmoK	1.11e-16	NA	1.14e-13	NA
7. B	Q9P7V2	ATP-binding cassette transporter abc4	1.70e-05	NA	3.11e-10	NA
7. B	Q6LK87	Maltose/maltodextrin import ATP-binding protein MalK	1.11e-15	NA	1.39e-11	NA
7. B	P96063	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	6.66e-16	NA	1.69e-17	NA
7. B	F2SHL1	ABC multidrug transporter MDR1	1.37e-05	NA	4.89e-07	NA
7. B	Q7A169	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	1.99e-10	NA
7. B	Q31YV7	Galactose/methyl galactoside import ATP-binding protein MglA	1.30e-13	NA	1.83e-09	NA
7. B	Q9JJ59	ABC-type oligopeptide transporter ABCB9	4.22e-09	NA	1.29e-12	NA
7. B	A9YWR6	ABC transporter G family member STR2	4.73e-11	NA	9.03e-14	NA
7. B	Q85A69	Sulfate/thiosulfate import ATP-binding protein CysA	5.00e-15	NA	1.57e-11	NA
7. B	Q1R5H8	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-15	NA	3.27e-15	NA
7. B	S0ELQ3	ABC transporter GPY2	1.62e-05	NA	1.32e-10	NA
7. B	Q28P50	Ribose import ATP-binding protein RbsA	2.36e-13	NA	9.37e-12	NA
7. B	Q9JZW0	Sulfate/thiosulfate import ATP-binding protein CysA	3.33e-16	NA	5.86e-17	NA
7. B	Q1CGD7	Macrolide export ATP-binding/permease protein MacB 2	1.93e-10	NA	1.35e-30	NA
7. B	Q6D3A9	Glutathione import ATP-binding protein GsiA	1.15e-14	NA	4.98e-10	NA
7. B	Q9H222	ATP-binding cassette sub-family G member 5	2.78e-11	NA	2.41e-12	NA
7. B	P61221	ATP-binding cassette sub-family E member 1	6.51e-08	NA	3.06e-08	NA
7. B	Q13ER6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	2.78e-15	NA	1.55e-11	NA
7. B	P06795	ATP-dependent translocase ABCB1	7.55e-07	NA	3.23e-17	NA
7. B	Q62GY9	Arabinose import ATP-binding protein AraG	3.34e-13	NA	6.69e-09	NA
7. B	Q5PGK9	Macrolide export ATP-binding/permease protein MacB	1.79e-10	NA	2.98e-30	NA
7. B	Q82B58	Putative ABC transporter ATP-binding protein SAV_5847	2.46e-11	NA	4.08e-24	NA
7. B	Q6YUU5	Putative multidrug resistance protein	4.57e-07	NA	1.02e-15	NA
7. B	Q0TJT5	Molybdenum import ATP-binding protein ModC	3.38e-14	NA	4.32e-07	NA
7. B	Q7N2D9	Autoinducer 2 import ATP-binding protein LsrA	1.81e-14	NA	6.01e-15	NA
7. B	Q3SJC6	Molybdenum import ATP-binding protein ModC	1.88e-13	NA	7.95e-11	NA
7. B	Q47258	Alpha-hemolysin translocation ATP-binding protein HlyB	1.68e-09	NA	4.53e-17	NA
7. B	Q1WVG9	Methionine import ATP-binding protein MetN	0.00e+00	NA	6.40e-23	NA
7. B	Q7PC88	ABC transporter G family member 31	1.10e-05	NA	1.21e-08	NA
7. B	Q9LK64	ABC transporter C family member 3	1.39e-05	NA	5.24e-08	NA
7. B	P45082	ATP-binding/permease protein CydD	2.75e-10	NA	6.25e-09	NA
7. B	Q28433	Antigen peptide transporter 1	2.66e-09	NA	3.12e-14	NA
7. B	Q2SZW0	ATP-dependent lipid A-core flippase	1.92e-11	NA	3.30e-18	NA
7. B	Q9HUG8	ATP-dependent lipid A-core flippase	1.88e-10	NA	8.64e-14	NA
7. B	A0A1V1GB10	ABC-type transporter oblD	6.99e-06	NA	2.59e-08	NA
7. B	Q6G5Z1	Putative ABC transporter ATP-binding protein SAS2569	7.55e-13	NA	1.60e-22	NA
7. B	Q9Z3R9	Alpha-glucoside transport ATP-binding protein AglK	3.33e-16	NA	3.84e-14	NA
7. B	Q09428	ATP-binding cassette sub-family C member 8	2.01e-05	NA	6.35e-10	NA
7. B	Q9C6W5	ABC transporter G family member 14	5.57e-12	NA	3.20e-15	NA
7. B	Q3Z445	Molybdenum import ATP-binding protein ModC	3.47e-14	NA	1.89e-06	NA
7. B	Q00555	Cystic fibrosis transmembrane conductance regulator	5.95e-05	NA	1.39e-12	NA
7. B	Q07QX6	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	4.92e-11	NA	8.22e-15	NA
7. B	Q8K440	ABC-type organic anion transporter ABCA8B	6.03e-06	NA	2.22e-11	NA
7. B	Q8T6H3	ABC transporter C family member 6	3.11e-06	NA	2.94e-10	NA
7. B	P9WQJ5	Uncharacterized ABC transporter ATP-binding protein Rv1281c	3.07e-13	NA	1.32e-17	NA
7. B	Q9R1S7	ATP-binding cassette sub-family C member 6	1.33e-05	NA	1.01e-04	NA
7. B	Q80W57	Broad substrate specificity ATP-binding cassette transporter ABCG2	2.16e-11	NA	2.15e-14	NA
7. B	Q92G31	UvrABC system protein A	1.07e-02	NA	1.12e-04	NA
7. B	Q87JM4	Macrolide export ATP-binding/permease protein MacB	4.15e-10	NA	1.46e-26	NA
7. B	B2GUP8	Mitochondrial potassium channel ATP-binding subunit	2.60e-10	NA	2.97e-15	NA
7. B	Q3KCC5	Fe(3+) ions import ATP-binding protein FbpC	2.22e-16	NA	5.04e-14	NA
7. B	Q6MU19	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.83e-19	NA
7. B	Q9LK50	ABC transporter G family member 26	1.82e-10	NA	2.93e-19	NA
7. B	F2RPA4	ABC multidrug transporter MDR2	4.54e-06	NA	4.45e-15	NA
7. B	Q7VKP7	Molybdenum import ATP-binding protein ModC	5.11e-15	NA	5.54e-10	NA
7. B	Q1CBH2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	4.47e-18	NA
7. B	Q2YIN5	Molybdenum import ATP-binding protein ModC	2.47e-13	NA	9.24e-13	NA
7. B	P0C086	Leukotoxin translocation ATP-binding protein LktB	1.46e-09	NA	4.45e-17	NA
7. B	P9WQI3	Trehalose import ATP-binding protein SugC	7.77e-16	NA	2.32e-14	NA
7. B	Q9LVM1	ABC transporter B family member 25, mitochondrial	2.71e-10	NA	3.48e-15	NA
7. B	Q8RD43	Ribose import ATP-binding protein RbsA	5.55e-14	NA	3.93e-15	NA
7. B	Q6NLC1	ABC transporter D family member 2, chloroplastic	4.12e-08	NA	1.35e-09	NA
7. B	Q664G2	Ribose import ATP-binding protein RbsA	2.81e-13	NA	2.29e-13	NA
7. B	A1A967	Glutathione import ATP-binding protein GsiA	1.08e-13	NA	3.66e-09	NA
7. B	Q7PC81	ABC transporter G family member 43	1.21e-06	NA	1.21e-10	NA
7. B	Q2QLC5	Cystic fibrosis transmembrane conductance regulator	6.94e-05	NA	1.71e-08	NA
7. B	Q10RX7	ABC transporter C family member 13	1.14e-05	NA	1.28e-08	NA
7. B	Q87R16	ATP-dependent lipid A-core flippase	9.19e-12	NA	1.22e-16	NA
7. B	Q1CJW8	Macrolide export ATP-binding/permease protein MacB 1	7.38e-11	NA	7.92e-26	NA
7. B	Q7N6R3	Molybdenum import ATP-binding protein ModC	5.76e-14	NA	7.04e-13	NA
7. B	Q9ZLD6	UvrABC system protein A	1.32e-02	NA	1.17e-04	NA
7. B	P17328	Glycine betaine/proline betaine transport system ATP-binding protein ProV	0.00e+00	NA	4.84e-16	NA
7. B	A1BCE9	Macrolide export ATP-binding/permease protein MacB 3	1.56e-12	NA	1.42e-26	NA
7. B	Q0ST95	Galactose/methyl galactoside import ATP-binding protein MglA	2.24e-13	NA	1.20e-12	NA
7. B	A0K3S5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	9.99e-16	NA	1.12e-13	NA
7. B	Q02785	ATP-dependent permease PDR12	2.50e-05	NA	2.33e-06	NA
7. B	O70595	ATP-binding cassette sub-family B member 6	2.38e-09	NA	1.68e-14	NA
7. B	Q9CJB8	Lactococcin transport/processing ATP-binding protein LcnC-like	2.98e-09	NA	1.74e-20	NA
7. B	P57551	Multidrug resistance-like ATP-binding protein MdlA	8.10e-11	NA	6.84e-11	NA
7. B	Q9K6Y0	UvrABC system protein A	2.68e-02	NA	0.002	NA
7. B	Q7NRX5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	6.66e-16	NA	5.40e-17	NA
7. B	Q8GEH7	Methionine import ATP-binding protein MetN	0.00e+00	NA	3.66e-18	NA
7. B	Q8Z0H0	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	3.67e-14	NA
7. B	Q8FXI7	Molybdenum import ATP-binding protein ModC	1.83e-13	NA	3.32e-13	NA
7. B	Q0VT01	Macrolide export ATP-binding/permease protein MacB	6.88e-10	NA	7.05e-28	NA
7. B	A0B3Z7	Arabinose import ATP-binding protein AraG 2	1.53e-13	NA	6.36e-11	NA
7. B	P9WQJ4	Uncharacterized ABC transporter ATP-binding protein MT1318	3.12e-13	NA	1.32e-17	NA
7. B	Q7M816	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.85e-17	NA
7. B	Q8PUE7	Putative ABC transporter ATP-binding protein MM_2387	2.62e-14	NA	8.18e-22	NA
7. B	Q8LPQ6	ABC transporter B family member 28	9.98e-10	NA	6.94e-13	NA
7. B	Q92XW1	Sulfate/thiosulfate import ATP-binding protein CysA 1	5.55e-16	NA	4.97e-19	NA
7. B	P69875	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	8.73e-11	NA
7. B	Q8IUA7	ATP-binding cassette sub-family A member 9	2.83e-06	NA	4.42e-11	NA
7. B	Q9JVR5	Macrolide export ATP-binding/permease protein MacB	1.60e-09	NA	3.51e-23	NA
7. B	Q2YAD6	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	1.31e-11	NA
7. B	O81016	ABC transporter G family member 32	2.65e-06	NA	6.72e-08	NA
7. B	Q3JMW7	sn-glycerol-3-phosphate import ATP-binding protein UgpC	8.88e-16	NA	1.11e-13	NA
7. B	Q0TA26	Maltose/maltodextrin import ATP-binding protein MalK	5.55e-15	NA	2.88e-17	NA
7. B	Q9C8H1	ABC transporter C family member 11	8.49e-06	NA	2.26e-08	NA
7. B	Q0S0Z3	Fe(3+) ions import ATP-binding protein FbpC 2	1.22e-15	NA	9.52e-18	NA
7. B	Q1BUV6	ATP-dependent lipid A-core flippase	7.27e-11	NA	4.07e-15	NA
7. B	Q8Z824	Macrolide export ATP-binding/permease protein MacB	1.74e-10	NA	3.16e-30	NA
7. B	Q46ZM0	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-15	NA	1.90e-15	NA
7. B	A0A0G2K1Q8	Phospholipid-transporting ATPase ABCA3	4.40e-06	NA	1.81e-10	NA
7. B	Q5UNZ1	Uncharacterized ABC transporter ATP-binding protein/permease L733	NA	NA	1.15e-06	NA
7. B	Q7UBD0	Maltose/maltodextrin import ATP-binding protein MalK	5.11e-15	NA	1.01e-16	NA
7. B	Q9XIE2	ABC transporter G family member 36	4.72e-06	NA	2.79e-08	NA
7. B	Q5WVN2	ATP-dependent lipid A-core flippase	4.21e-11	NA	1.00e-11	NA
7. B	Q8ST87	ABC transporter C family member 10	2.77e-06	NA	8.78e-09	NA
7. B	Q88G95	Molybdenum import ATP-binding protein ModC	9.41e-13	NA	2.55e-08	NA
7. B	P54718	Uncharacterized ABC transporter ATP-binding protein YfiB	5.64e-11	NA	1.02e-11	NA
7. B	Q6MCV4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	5.69e-13	NA
7. B	D3GE74	ABC transporter G family member STR	4.56e-10	NA	2.49e-11	NA
7. B	P94360	Oligosaccharides import ATP-binding protein MsmX	1.11e-16	NA	4.52e-12	NA
7. B	Q4ZRC6	Putative ribose/galactose/methyl galactoside import ATP-binding protein	2.49e-13	NA	2.55e-10	NA
7. B	Q8UII7	sn-glycerol-3-phosphate import ATP-binding protein UgpC 1	5.55e-16	NA	3.35e-12	NA
7. B	Q54EK2	ABC transporter C family member 7	3.48e-06	NA	1.10e-09	NA
7. B	Q9JI39	ATP-binding cassette sub-family B member 10, mitochondrial	9.33e-10	NA	1.46e-18	NA
7. B	Q21GS5	Molybdenum import ATP-binding protein ModC	2.00e-13	NA	1.77e-13	NA
7. B	P57979	UvrABC system protein A	1.18e-02	NA	0.006	NA
7. B	Q4KB64	Molybdenum import ATP-binding protein ModC	4.13e-13	NA	1.05e-10	NA
7. B	P63385	UvrABC system protein A	1.37e-02	NA	0.035	NA
7. B	Q329G7	Ribose import ATP-binding protein RbsA	1.77e-13	NA	1.80e-13	NA
7. B	Q0SRL2	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	6.63e-14	NA
7. B	P75110	Putative ABC transporter ATP-binding protein MG467 homolog	0.00e+00	NA	4.84e-22	NA
7. B	P37388	Xylose import ATP-binding protein XylG	6.74e-14	NA	1.97e-11	NA
7. B	Q1RJ91	Putative export ATP-binding/permease protein RBE_0492	2.76e-11	NA	2.12e-08	NA
7. B	Q2YQ73	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	8.31e-11	NA	5.90e-13	NA
7. B	B2KWH4	ABC transporter 1	1.91e-06	NA	2.86e-11	NA
7. B	Q6LPK6	ATP-dependent lipid A-core flippase	2.58e-11	NA	1.52e-12	NA
7. B	Q6BEX0	Galactofuranose transporter ATP-binding protein YtfR	5.16e-14	NA	4.40e-09	NA
7. B	Q8T6J2	ABC transporter A family member 5	2.25e-06	NA	4.38e-12	NA
7. B	Q96J65	ATP-binding cassette sub-family C member 12	2.72e-06	NA	1.93e-12	NA
7. B	Q2UD41	ABC multidrug transporter atrH	3.67e-06	NA	4.69e-07	NA
7. B	P21440	Phosphatidylcholine translocator ABCB4	6.81e-07	NA	2.26e-19	NA
7. B	O14678	Lysosomal cobalamin transporter ABCD4	1.57e-08	NA	1.75e-04	NA
7. B	P9WQJ7	Mycobactin import ATP-binding/permease protein IrtB	3.62e-11	NA	2.75e-19	NA
7. B	P0CU83	ABC multidrug transporter MDR2	3.77e-06	NA	4.67e-15	NA
7. B	Q6D437	ATP-dependent lipid A-core flippase	1.74e-11	NA	9.61e-18	NA
7. B	Q03727	Transport/processing ATP-binding protein ComA	1.07e-09	NA	5.22e-18	NA
7. B	P0A9U4	Probable ATP-binding protein YbiT	1.89e-09	NA	2.12e-10	NA
7. B	P0AAG8	Galactose/methyl galactoside import ATP-binding protein MglA	2.04e-13	NA	1.00e-09	NA
7. B	Q0SXQ1	Maltose/maltodextrin import ATP-binding protein MalK	6.88e-15	NA	6.24e-17	NA
7. B	G0SEV9	Translation initiation factor RLI1	1.13e-07	NA	2.02e-10	NA
7. B	Q5F4X8	ATP-dependent lipid A-core flippase	3.32e-11	NA	1.78e-17	NA
7. B	H6WS93	Pleiotropic drug resistance protein 1	1.06e-05	NA	3.93e-07	NA
7. B	A1KF14	Multidrug efflux ATP-binding/permease protein BCG_0231	1.63e-06	NA	5.90e-10	NA
7. B	Q668Q3	Fe(3+) ions import ATP-binding protein FbpC	1.58e-14	NA	2.83e-14	NA
7. B	Q9CIN4	Methionine import ATP-binding protein MetN	0.00e+00	NA	5.21e-32	NA
7. B	S0EGU4	ABC transporter BEA3	4.83e-07	NA	3.67e-11	NA
7. B	B6RAL1	ABC transporter patM	9.80e-06	NA	1.05e-07	NA
7. B	Q13CI6	Molybdenum import ATP-binding protein ModC	1.85e-12	NA	2.06e-14	NA
7. B	P39109	Metal resistance protein YCF1	1.47e-05	NA	3.32e-05	NA
7. B	Q6MG08	ATP-binding cassette sub-family F member 1	3.13e-07	NA	2.01e-04	NA
7. B	P0A9U1	Probable multidrug ABC transporter ATP-binding protein YbhF	2.71e-13	NA	2.12e-16	NA
7. B	P32568	Protein SNQ2	2.21e-05	NA	7.22e-08	NA
7. B	I1RL06	ZEB2-regulated ABC transporter 1	8.73e-06	NA	4.35e-08	NA
7. B	P36371	Antigen peptide transporter 2	2.82e-08	NA	5.42e-12	NA
7. B	Q9FVV9	Probable non-intrinsic ABC protein 5	3.25e-05	NA	0.002	NA
7. B	Q8PNN4	Sulfate/thiosulfate import ATP-binding protein CysA	4.44e-16	NA	4.10e-18	NA
7. B	Q5HEQ8	Putative multidrug export ATP-binding/permease protein SACOL1924	1.74e-11	NA	3.45e-19	NA
7. B	Q2FFM9	Putative multidrug export ATP-binding/permease protein SAUSA300_1847	1.63e-11	NA	3.45e-19	NA
7. B	Q7VNG4	Spermidine/putrescine import ATP-binding protein PotA	1.11e-16	NA	9.68e-18	NA
7. B	Q6FQN3	ABC multidrug transporter SNQ2	6.72e-06	NA	2.69e-07	NA
7. B	P9WQI6	Uncharacterized ABC transporter ATP-binding protein MT2388	2.85e-09	NA	4.59e-08	NA
7. B	Q767L0	ATP-binding cassette sub-family F member 1	2.02e-07	NA	4.82e-05	NA
7. B	Q5PG54	Molybdenum import ATP-binding protein ModC	2.95e-14	NA	2.69e-04	NA
7. B	Q0HTS8	ATP-dependent lipid A-core flippase	1.18e-10	NA	4.44e-17	NA
7. B	O31708	Uncharacterized ABC transporter ATP-binding protein YknV	6.78e-11	NA	1.90e-08	NA
7. B	E9Q236	ATP-binding cassette sub-family C member 4	6.66e-06	NA	1.11e-12	NA
7. B	A0A0H2VBH0	Probable ATP-binding protein YheS	8.32e-09	NA	1.57e-10	NA
7. B	Q1QH37	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.72e-11	NA	1.40e-15	NA
7. B	Q5DZC6	Maltose/maltodextrin import ATP-binding protein MalK	3.33e-16	NA	9.37e-13	NA
7. B	Q9CF44	Ribose import ATP-binding protein RbsA	9.13e-14	NA	1.18e-16	NA
7. B	Q9LFH0	ABC transporter G family member 37	2.81e-06	NA	3.79e-11	NA
7. B	Q9FLX5	ABC transporter G family member 8	2.81e-12	NA	9.76e-18	NA
7. B	P0C886	Autoinducer 2 import ATP-binding protein LsrA	9.10e-15	NA	5.06e-14	NA
7. B	Q92LU2	Molybdenum import ATP-binding protein ModC	1.47e-12	NA	5.37e-17	NA
7. B	Q55DW4	ABC transporter G family member 1	3.66e-10	NA	3.04e-18	NA
7. B	Q5P2S7	ATP-dependent lipid A-core flippase	1.86e-11	NA	6.37e-15	NA
7. B	Q1LLP5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	5.55e-16	NA	1.98e-16	NA
7. B	Q58762	Molybdate/tungstate import ATP-binding protein WtpC	6.66e-16	NA	1.71e-17	NA
7. B	Q7AKE5	ABC transporter ATP-binding protein RamB	2.29e-09	NA	5.81e-19	NA
7. B	Q217L2	Macrolide export ATP-binding/permease protein MacB	2.06e-10	NA	2.56e-28	NA
7. B	Q4ZV10	Macrolide export ATP-binding/permease protein MacB 1	5.28e-10	NA	5.56e-24	NA
7. B	Q73KK2	Galactose/methyl galactoside import ATP-binding protein MglA	4.75e-14	NA	2.07e-14	NA
7. B	Q1REG5	Molybdenum import ATP-binding protein ModC	3.25e-14	NA	4.32e-07	NA
7. B	Q2G0V2	Methionine import ATP-binding protein MetN 1	0.00e+00	NA	5.36e-24	NA
7. B	Q0BGD7	Putative ribose/galactose/methyl galactoside import ATP-binding protein 1	1.68e-13	NA	1.79e-16	NA
7. B	Q8FCQ2	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.55e-15	NA	3.53e-15	NA
7. B	Q1AS06	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.25e-16	NA
7. B	D8KFN1	Methionine import ATP-binding protein MetN	0.00e+00	NA	1.40e-30	NA
7. B	Q9HQ18	Cobalamin import ATP-binding protein BtuD	4.44e-16	NA	5.58e-19	NA
7. B	Q88AS5	Sulfate/thiosulfate import ATP-binding protein CysA	0.00e+00	NA	2.11e-18	NA
7. B	Q09YK5	Cystic fibrosis transmembrane conductance regulator	6.17e-05	NA	3.52e-12	NA
7. B	P47326	Oligopeptide transport ATP-binding protein OppF	8.49e-03	NA	5.97e-12	NA
7. B	P36619	Leptomycin B resistance protein pmd1	4.65e-05	NA	3.05e-20	NA
7. B	Q9M2V7	ABC transporter G family member 16	8.18e-11	NA	2.50e-13	NA
7. B	Q8SQU5	ABC transporter-like protein ECU11_1340	2.91e-10	NA	5.52e-08	NA
7. B	Q6NBT1	Sulfate/thiosulfate import ATP-binding protein CysA	3.33e-16	NA	6.42e-16	NA
7. B	Q8ES39	Putative ABC transporter ATP-binding protein OB0804	2.46e-14	NA	3.42e-21	NA
7. B	A0A1U8QTJ9	ABC-type transporter cicA	7.42e-06	NA	5.95e-11	NA
7. B	Q8K441	ATP-binding cassette sub-family A member 6	4.15e-06	NA	3.91e-09	NA
7. B	Q2K353	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.62e-13	NA	4.62e-08	NA
7. B	P0C087	Leukotoxin translocation ATP-binding protein LktB	9.29e-10	NA	4.45e-17	NA
7. B	Q54P13	ABC transporter C family member 8	1.79e-05	NA	1.12e-11	NA
7. B	Q5MZ54	Bicarbonate transport ATP-binding protein CmpC	1.37e-12	NA	5.38e-14	NA
7. B	Q9STT5	ABC transporter A family member 7	2.95e-09	NA	9.41e-10	NA
7. B	Q7PC83	ABC transporter G family member 41	7.39e-06	NA	3.88e-09	NA
7. B	Q9CAF5	ABC transporter I family member 6, chloroplastic	2.30e-14	NA	1.19e-07	NA
7. B	Q6GDC0	Putative ABC transporter ATP-binding protein SAR2766	8.12e-13	NA	1.58e-23	NA
7. B	Q07DW5	Cystic fibrosis transmembrane conductance regulator	6.41e-05	NA	9.77e-13	NA
7. B	Q3IGX5	ATP-dependent lipid A-core flippase	8.55e-11	NA	2.02e-11	NA
7. B	Q5ZUH9	ATP-dependent lipid A-core flippase	1.61e-10	NA	2.18e-12	NA
7. B	P44531	Fe(3+) ions import ATP-binding protein FbpC 1	0.00e+00	NA	7.90e-15	NA
7. B	Q9WYC4	Uncharacterized ABC transporter ATP-binding protein TM_0288	1.38e-10	NA	1.64e-10	NA
7. B	Q2U0M6	ABC multidrug transporter atrG	6.70e-06	NA	1.34e-07	NA
7. B	A9R074	Autoinducer 2 import ATP-binding protein LsrA	6.49e-14	NA	8.78e-12	NA
7. B	Q84TH5	ABC transporter G family member 25	2.04e-11	NA	2.76e-14	NA
7. B	Q2K8C8	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	1.99e-15	NA
7. B	Q03024	Alkaline protease secretion ATP-binding protein AprD	1.30e-10	NA	2.54e-12	NA
7. B	Q042G7	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.93e-19	NA
7. B	E9Q876	Glucosylceramide transporter ABCA12	4.01e-04	NA	9.25e-09	NA
7. B	Q5X498	ATP-dependent lipid A-core flippase	9.29e-11	NA	7.48e-13	NA
7. B	P9WQJ8	Mycobactin import ATP-binding/permease protein IrtA	2.34e-08	NA	1.07e-12	NA
7. B	A0A059JK44	ABC multidrug transporter MDR2	3.77e-06	NA	4.81e-15	NA
7. B	Q2RWI9	Molybdenum import ATP-binding protein ModC	3.09e-13	NA	1.72e-08	NA
7. B	B2K3G1	Autoinducer 2 import ATP-binding protein LsrA	4.31e-14	NA	2.67e-11	NA
7. B	Q54TV2	ABC transporter G family member 5	7.98e-06	NA	7.32e-10	NA
7. B	P44407	ATP-dependent lipid A-core flippase	9.31e-12	NA	1.08e-13	NA
7. B	Q07E42	Cystic fibrosis transmembrane conductance regulator	5.87e-05	NA	9.83e-12	NA
7. B	Q1R3Q1	Maltose/maltodextrin import ATP-binding protein MalK	8.88e-16	NA	1.10e-16	NA
7. B	Q74K65	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	7.62e-19	NA
7. B	Q5PKZ8	Maltose/maltodextrin import ATP-binding protein MalK	2.78e-15	NA	1.86e-15	NA
7. B	Q8K985	Multidrug resistance-like ATP-binding protein MdlA	4.16e-11	NA	5.01e-15	NA
7. B	Q45978	ATP-binding protein Uup	5.43e-09	NA	2.23e-08	NA
7. B	Q2RPB4	Macrolide export ATP-binding/permease protein MacB	2.34e-10	NA	5.54e-26	NA
7. B	Q9TUQ2	Cystic fibrosis transmembrane conductance regulator	6.89e-05	NA	1.88e-12	NA
7. B	Q8KFE9	Macrolide export ATP-binding/permease protein MacB	3.36e-09	NA	1.74e-28	NA
7. B	P36497	Pediocin PA-1 transport/processing ATP-binding protein PedD	4.29e-09	NA	7.83e-14	NA
7. B	Q6D2F6	Fe(3+) ions import ATP-binding protein FbpC 2	7.77e-16	NA	7.07e-18	NA
7. B	P21958	Antigen peptide transporter 1	1.29e-09	NA	1.05e-13	NA
7. B	P77509	Uncharacterized ABC transporter ATP-binding protein YphE	4.33e-15	NA	8.84e-12	NA
7. B	P45127	Energy-dependent translational throttle protein EttA	1.97e-06	NA	6.06e-13	NA
7. B	Q9K0N7	Macrolide export ATP-binding/permease protein MacB	1.46e-09	NA	8.78e-23	NA
7. B	Q3SP57	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	1.94e-10	NA	5.73e-14	NA
7. B	Q8Z8W8	Putative 2-aminoethylphosphonate import ATP-binding protein PhnT	4.44e-16	NA	7.63e-17	NA
7. B	Q4QPI4	ATP-dependent lipid A-core flippase	5.30e-11	NA	3.15e-13	NA
7. B	P94366	ATP-binding/permease protein CydC	2.61e-10	NA	9.05e-10	NA
7. B	Q86UQ4	ATP-binding cassette sub-family A member 13	NA	NA	7.08e-05	NA
7. B	P40024	ABC transporter ATP-binding protein ARB1	3.60e-10	NA	9.74e-10	NA
7. B	P55604	Uncharacterized ABC transporter ATP-binding protein y4oS	1.33e-15	NA	1.47e-11	NA
7. B	Q8EDF0	ATP-dependent lipid A-core flippase	8.53e-11	NA	3.26e-16	NA
7. B	Q660M8	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.20e-22	NA
7. B	Q59R09	Iron-sulfur clusters transporter ATM1, mitochondrial	2.24e-10	NA	7.24e-13	NA
7. B	A7ZLX1	Putative autoinducer 2 import ATP-binding protein LsrA homolog	0.00e+00	NA	3.30e-10	NA
7. B	Q6D734	Fe(3+) ions import ATP-binding protein FbpC 1	0.00e+00	NA	3.83e-19	NA
7. B	O34362	Putative HMP/thiamine import ATP-binding protein YkoD	3.70e-14	NA	3.87e-31	NA
7. B	Q8E554	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.03e-12	NA
7. B	Q2IBB3	Cystic fibrosis transmembrane conductance regulator	8.76e-04	NA	5.03e-11	NA
7. B	O53645	Multidrug efflux ATP-binding/permease protein Rv0194	1.50e-06	NA	5.90e-10	NA
7. B	Q7PC85	ABC transporter G family member 38	6.99e-06	NA	9.62e-08	NA
7. B	P75831	Macrolide export ATP-binding/permease protein MacB	1.97e-10	NA	2.38e-29	NA
7. B	Q1CC21	Maltose/maltodextrin import ATP-binding protein MalK	9.99e-16	NA	6.43e-15	NA
7. B	Q9CGD4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.31e-12	NA
7. B	Q88ZZ2	Putative ABC transporter ATP-binding protein lp_0149	3.24e-13	NA	3.30e-20	NA
7. B	A3BXL8	ABC transporter G family member 53	1.06e-05	NA	6.70e-10	NA
7. B	P9WQI7	Uncharacterized ABC transporter ATP-binding protein Rv2326c	6.49e-09	NA	4.59e-08	NA
7. B	Q8TK65	Putative ABC transporter ATP-binding protein MA_3551	8.88e-15	NA	9.21e-21	NA
7. B	Q4ZT65	Macrolide export ATP-binding/permease protein MacB 2	1.75e-10	NA	1.53e-23	NA
7. B	Q07DX5	Cystic fibrosis transmembrane conductance regulator	7.05e-05	NA	3.20e-12	NA
7. B	Q9M1Q9	ABC transporter B family member 21	1.16e-06	NA	1.38e-17	NA
7. B	P70170	ATP-binding cassette sub-family C member 9	1.46e-05	NA	1.98e-10	NA
7. B	Q6C6N0	Iron-sulfur clusters transporter ATM1, mitochondrial	2.13e-10	NA	1.05e-11	NA
7. B	O34631	Uncharacterized ABC transporter ATP-binding protein YvrA	2.22e-16	NA	1.19e-13	NA
7. B	Q8K9I3	ATP-binding protein Uup	2.73e-09	NA	4.37e-08	NA
7. B	Q39HA1	Putative ribose/galactose/methyl galactoside import ATP-binding protein 2	1.48e-13	NA	1.06e-10	NA
7. B	Q0VQP5	ATP-dependent lipid A-core flippase	3.23e-11	NA	4.13e-17	NA
7. B	P40790	Spermidine/putrescine import ATP-binding protein PotA	2.22e-16	NA	6.28e-11	NA
7. B	Q5XA89	UvrABC system protein A	1.41e-02	NA	0.009	NA
7. B	P37732	Molybdenum import ATP-binding protein ModC 1	1.04e-12	NA	3.92e-08	NA
7. B	Q4PH16	Iron-sulfur clusters transporter ATM1, mitochondrial	6.61e-10	NA	1.14e-12	NA
7. B	Q60AA3	ATP-dependent lipid A-core flippase	2.96e-10	NA	1.37e-16	NA
7. B	E7F6F7	Iron-sulfur clusters transporter ABCB7, mitochondrial	6.46e-10	NA	1.35e-12	NA
7. B	P21410	Fe(3+) ions import ATP-binding protein FbpC	1.11e-16	NA	3.53e-18	NA
7. B	Q8N139	ATP-binding cassette sub-family A member 6	1.78e-06	NA	2.54e-10	NA
7. B	Q54JR2	ABC transporter C family member 3	6.38e-06	NA	6.92e-07	NA
7. B	Q3JNJ9	Arabinose import ATP-binding protein AraG	3.29e-13	NA	1.39e-10	NA
7. B	Q1BPZ6	Macrolide export ATP-binding/permease protein MacB	1.10e-12	NA	1.36e-28	NA
7. B	Q7MJ07	ATP-dependent lipid A-core flippase	6.59e-12	NA	2.34e-17	NA
7. B	Q8XIZ5	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	1.93e-13	NA
7. B	Q07DZ6	Cystic fibrosis transmembrane conductance regulator	6.13e-05	NA	3.59e-11	NA
7. B	Q8X4V7	Molybdenum import ATP-binding protein ModC	3.14e-14	NA	4.06e-06	NA
7. B	A1RG29	Macrolide export ATP-binding/permease protein MacB	2.69e-10	NA	7.62e-24	NA
7. B	Q864R9	Multidrug resistance-associated protein 1	2.45e-05	NA	4.10e-07	NA
7. B	Q8ZKQ4	Autoinducer 2 import ATP-binding protein LsrA	1.28e-14	NA	1.15e-13	NA
7. B	Q8PBH3	UvrABC system protein A	1.37e-02	NA	0.014	NA
7. B	Q8RY46	ABC transporter B family member 26, chloroplastic	2.29e-10	NA	1.75e-21	NA
7. B	P9WQM0	Sulfate/thiosulfate import ATP-binding protein CysA	1.11e-16	NA	2.58e-13	NA
7. B	Q9LSJ5	ABC transporter B family member 18	3.62e-07	NA	1.27e-15	NA
7. B	Q2K4V4	sn-glycerol-3-phosphate import ATP-binding protein UgpC 2	2.22e-16	NA	7.73e-15	NA
7. B	Q6CZ34	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-15	NA	5.51e-18	NA
7. B	Q7CJG3	Macrolide export ATP-binding/permease protein MacB 2	7.35e-11	NA	7.92e-26	NA
7. B	Q3KC21	Molybdenum import ATP-binding protein ModC	9.01e-13	NA	2.36e-08	NA
7. B	Q63GR8	Methionine import ATP-binding protein MetN 2	0.00e+00	NA	4.74e-28	NA
7. B	Q2SIN5	ATP-dependent lipid A-core flippase	1.58e-11	NA	1.34e-15	NA
7. B	P13567	UvrABC system protein A	1.64e-02	NA	0.010	NA
7. B	Q03JH1	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	2.96e-13	NA
7. B	Q2NK31	Spermidine/putrescine import ATP-binding protein PotA	7.42e-14	NA	3.98e-14	NA
7. B	Q24739	Protein brown	NA	NA	2.97e-11	NA
7. B	O83658	Spermidine/putrescine import ATP-binding protein PotA	4.44e-16	NA	3.28e-16	NA
7. B	Q164Y5	sn-glycerol-3-phosphate import ATP-binding protein UgpC	3.33e-16	NA	3.09e-15	NA
7. B	Q8DPC2	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	3.47e-12	NA
7. B	Q0P9C4	Protein glycosylation K	6.30e-12	NA	1.33e-17	NA
7. B	Q8DZJ0	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.03e-12	NA
7. B	P46920	Glycine betaine transport ATP-binding protein OpuAA	0.00e+00	NA	2.66e-10	NA
7. B	Q8ZQE4	Macrolide export ATP-binding/permease protein MacB	1.63e-10	NA	3.19e-30	NA
7. B	Q8T685	ABC transporter G family member 12	7.65e-11	NA	1.92e-14	NA
7. B	P9WQJ2	Fatty acid ABC transporter ATP-binding/permease protein	2.67e-10	NA	3.71e-10	NA
7. B	P68187	Maltose/maltodextrin import ATP-binding protein MalK	1.11e-15	NA	1.10e-16	NA
7. B	Q9M2V5	ABC transporter G family member 18	3.43e-11	NA	3.37e-12	NA
7. B	Q492S9	ATP-dependent lipid A-core flippase	9.53e-12	NA	7.20e-14	NA
7. B	Q7TNJ2	ATP-binding cassette sub-family A member 7	6.71e-05	NA	1.28e-06	NA
7. B	Q5XCA4	Spermidine/putrescine import ATP-binding protein PotA	0.00e+00	NA	4.62e-10	NA
7. B	Q87ZE0	Putative ribose/galactose/methyl galactoside import ATP-binding protein	2.15e-13	NA	3.63e-10	NA
7. B	A0B212	Macrolide export ATP-binding/permease protein MacB	1.12e-12	NA	1.91e-28	NA
7. B	O32151	Uncharacterized ABC transporter ATP-binding protein YurJ	3.33e-16	NA	3.01e-13	NA
7. B	P9WQJ3	Fatty acid ABC transporter ATP-binding/permease protein	1.82e-10	NA	3.71e-10	NA
7. B	Q88J90	Ribose import ATP-binding protein RbsA	4.55e-13	NA	2.76e-10	NA
7. B	B1LFA2	Autoinducer 2 import ATP-binding protein LsrA	2.53e-14	NA	5.92e-10	NA
7. B	Q21CA3	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.55e-15	NA	2.56e-10	NA
7. B	P33311	ATP-dependent permease MDL2, mitochondrial	4.70e-10	NA	9.97e-19	NA
7. B	Q8XBJ8	Sulfate/thiosulfate import ATP-binding protein CysA	8.88e-16	NA	5.30e-20	NA
7. B	Q4ZZ16	ATP-dependent lipid A-core flippase	1.41e-11	NA	2.11e-11	NA
7. B	Q7VWD8	ATP-dependent lipid A-core flippase	1.32e-11	NA	6.40e-12	NA
7. B	Q88F88	Macrolide export ATP-binding/permease protein MacB	9.00e-10	NA	5.49e-27	NA
7. B	Q7A0J1	Putative multidrug export ATP-binding/permease protein MW1806	1.65e-11	NA	3.45e-19	NA
7. B	Q7VLW2	UvrABC system protein A	1.35e-02	NA	0.002	NA
7. B	Q6FZF2	Beta-(1-->2)glucan export ATP-binding/permease protein NdvA	3.49e-11	NA	2.86e-17	NA
7. B	P53756	ABC transporter ATP-binding protein/permease PDR18	1.50e-06	NA	1.30e-06	NA
7. B	Q64343	ATP-binding cassette sub-family G member 1	3.21e-13	NA	2.73e-16	NA
7. B	Q8T675	ABC transporter G family member 19	1.52e-05	NA	1.52e-06	NA
7. B	Q92WD6	sn-glycerol-3-phosphate import ATP-binding protein UgpC	1.11e-16	NA	2.87e-13	NA
7. B	Q02592	Heavy metal tolerance protein	4.45e-09	NA	1.94e-16	NA
7. B	G2JZ44	Carnitine transport ATP-binding protein OpuCA	2.22e-16	NA	4.28e-20	NA
7. B	Q080T2	ATP-dependent lipid A-core flippase	1.08e-10	NA	1.92e-15	NA
7. B	Q6PQZ2	Cystic fibrosis transmembrane conductance regulator	5.02e-05	NA	9.65e-12	NA
7. B	P04983	Ribose import ATP-binding protein RbsA	2.09e-13	NA	3.23e-11	NA
7. B	Q7ULB5	Macrolide export ATP-binding/permease protein MacB	2.09e-13	NA	3.84e-20	NA
7. B	Q8X170	ABC multidrug transporter A	5.50e-06	NA	1.59e-06	NA
7. B	P12428	Protein brown	1.45e-09	NA	7.49e-12	NA
7. B	Q04182	ATP-dependent permease PDR15	8.84e-06	NA	7.49e-06	NA
7. B	Q93FG6	Leukotoxin translocation ATP-binding protein LktB	7.03e-10	NA	4.25e-17	NA
7. B	Q3KE48	Macrolide export ATP-binding/permease protein MacB 2	2.06e-10	NA	1.45e-23	NA