Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54938.1
JCVISYN3A_0708
Thiamine ABC transporter substrate-binding protein.
M. mycoides homolog: Q6MSI4.
TIGRfam Classification: 3=Putative.
Category: Quasiessential.
Statistics
Total GO Annotation: 69
Unique PROST Go: 60
Unique BLAST Go: 0
Unique Foldseek Go: 1
Total Homologs: 173
Unique PROST Homologs: 164
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 4
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q49410
(High affinity transport system protein p37) with a FATCAT P-Value: 2.67e-13 and RMSD of 2.64 angstrom. The sequence alignment identity is 26.4%.
Structural alignment shown in left. Query protein AVX54938.1 colored as red in alignment, homolog Q49410 colored as blue.
Query protein AVX54938.1 is also shown in right top, homolog Q49410 showed in right bottom. They are colored based on secondary structures.
AVX54938.1 MYTNKLKVALGTMLSAVSIASVGSFVVACQTKEDWDTTITINNSWVNDGFFSKLDY--DTGAVTPGDKSKAFIELLTKKFNELKNKDEATKKFKDVKFDI 98 Q49410 MLFKKFTWVIPSLF--LTIIST-SLLISCATKS--DNTLIFNIS---------LDHNADT-SI---EK---FFTVFSKK---LSGK--LNKKI-NVNFNI 73 AVX54938.1 KVDFDKKTYFSKLEKNDSEN--DVYIANYSYYLSNVWNNKTKSLNKDLPFKLVSQAATLQFNWQSGDNTFYKDGKSTDDLRKLAEENNKKWLEF--GEYP 194 Q49410 -VD-DS---FTKI-NNIQANKADFAFVNSQAIASNNWFGYT-------P--LI-QTLTTAFK-EDLELDYYEDG----NLQKKAEKTN---LLFLSPPYK 149 AVX54938.1 DWHKSDKAVNGKKLDFDGSKYTNF-YKDVDLTYVYRGAVLIAGNEADREKIVKAWDDKNWDSFVKNGIVYEKTSSAGGYKYQV--ALFARHFGKTI---- 287 Q49410 EW--DD--IKQK---WTGNRY-DFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSAS--RFELPDLLFRKHFAKNYPGLQ 239 AVX54938.1 SEIKEDLEGKKYEQYIVKGQKVSAQLGKKQANSQLVPRIGFDDEGSYNWTKSEEGSEKYKPTDFKSTEKAMNGGKAMMTAAKPAAAKPAAAPAAPAPAAK 387 Q49410 NAINSDPD--KFA--VVRGR----EIG---INKNI--KIVFDDANSFSWTQNIKGS-K-RP--F-------------YT------------PIDP----- 292 AVX54938.1 PEANGMKDKNGAVVRTLTMTNPAGYDVVLARKGLLDKQV-ELLSKALNSLSL-----TENTYGIYTGYNKF-MPLSNELFEK-LVKLQVQAESTENLVTE 479 Q49410 ---N---DR----LEILTYSDPLLYDI-----GIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKM-I-ND-FEKEVVEI---IEKTYGK--- 368 AVX54938.1 IDKIQKQN 487 Q49410 -------- 368
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0005886 | plasma membrane |
| 2. PF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 2. PF | GO:0042597 | periplasmic space |
| 2. PF | GO:0055085 | transmembrane transport |
| 2. PF | GO:0008643 | carbohydrate transport |
| 3. BF | GO:0030430 | host cell cytoplasm |
| 3. BF | GO:0001932 | regulation of protein phosphorylation |
| 3. BF | GO:0030334 | regulation of cell migration |
| 5. P | GO:0015419 | ABC-type sulfate transporter activity |
| 5. P | GO:0019809 | spermidine binding |
| 5. P | GO:1901359 | tungstate binding |
| 5. P | GO:0030975 | thiamine binding |
| 5. P | GO:0009290 | DNA import into cell involved in transformation |
| 5. P | GO:0042958 | maltodextrin transmembrane transporter activity |
| 5. P | GO:0015847 | putrescine transport |
| 5. P | GO:0030288 | outer membrane-bounded periplasmic space |
| 5. P | GO:0042956 | maltodextrin transport |
| 5. P | GO:0031676 | plasma membrane-derived thylakoid membrane |
| 5. P | GO:0022857 | transmembrane transporter activity |
| 5. P | GO:0015888 | thiamine transport |
| 5. P | GO:0006972 | hyperosmotic response |
| 5. P | GO:0030973 | molybdate ion binding |
| 5. P | GO:0015709 | thiosulfate transport |
| 5. P | GO:0008272 | sulfate transport |
| 5. P | GO:0052170 | suppression by symbiont of host innate immune response |
| 5. P | GO:0009279 | cell outer membrane |
| 5. P | GO:0050997 | quaternary ammonium group binding |
| 5. P | GO:0006790 | sulfur compound metabolic process |
| 5. P | GO:0070728 | leucine binding |
| 5. P | GO:0015846 | polyamine transport |
| 5. P | GO:0035435 | phosphate ion transmembrane transport |
| 5. P | GO:0043090 | amino acid import |
| 5. P | GO:0004035 | alkaline phosphatase activity |
| 5. P | GO:0006811 | ion transport |
| 5. P | GO:0046306 | alkanesulfonate catabolic process |
| 5. P | GO:0015768 | maltose transport |
| 5. P | GO:0019808 | polyamine binding |
| 5. P | GO:0055052 | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
| 5. P | GO:1901681 | sulfur compound binding |
| 5. P | GO:0048473 | D-methionine transport |
| 5. P | GO:0030976 | thiamine pyrophosphate binding |
| 5. P | GO:0015716 | organic phosphonate transport |
| 5. P | GO:1901982 | maltose binding |
| 5. P | GO:0044010 | single-species biofilm formation |
| 5. P | GO:0015689 | molybdate ion transport |
| 5. P | GO:0030246 | carbohydrate binding |
| 5. P | GO:0051701 | biological process involved in interaction with host |
| 5. P | GO:0031460 | glycine betaine transport |
| 5. P | GO:0015829 | valine transport |
| 5. P | GO:0051938 | L-glutamate import |
| 5. P | GO:0015417 | ABC-type polyamine transporter activity |
| 5. P | GO:0006817 | phosphate ion transport |
| 5. P | GO:0006865 | amino acid transport |
| 5. P | GO:2001071 | maltoheptaose binding |
| 5. P | GO:0015740 | C4-dicarboxylate transport |
| 5. P | GO:0015820 | leucine transport |
| 5. P | GO:0016036 | cellular response to phosphate starvation |
| 5. P | GO:0042301 | phosphate ion binding |
| 5. P | GO:0042619 | poly-hydroxybutyrate biosynthetic process |
| 5. P | GO:0016595 | glutamate binding |
| 5. P | GO:0015848 | spermidine transport |
| 5. P | GO:0019810 | putrescine binding |
| 5. P | GO:0043199 | sulfate binding |
| 5. P | GO:0007155 | cell adhesion |
| 5. P | GO:0036173 | thiosulfate binding |
| 5. P | GO:0015818 | isoleucine transport |
| 5. P | GO:0010921 | regulation of phosphatase activity |
| 5. P | GO:0055072 | iron ion homeostasis |
| 6. F | GO:0015144 | carbohydrate transmembrane transporter activity |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q49410 | High affinity transport system protein p37 | 2.67e-13 | 1.63e-12 | 1.52e-15 | 0.7975 |
| 1. PBF | P75371 | High affinity transport system protein p37 | 4.08e-11 | 2.55e-17 | 1.95e-13 | 0.779 |
| 1. PBF | P15363 | High affinity transport system protein p37 | 4.84e-12 | 4.61e-11 | 4.50e-23 | 0.7867 |
| 2. PF | O69052 | Probable phosphite transport system-binding protein PtxB | 9.73e-04 | 1.91e-02 | NA | 0.5919 |
| 2. PF | A3PDP9 | Probable ABC transporter phosphonate/phosphite binding protein PhnD2 | 4.80e-03 | 2.43e-04 | NA | 0.5504 |
| 5. P | P16682 | Phosphonates-binding periplasmic protein | 1.08e-03 | 1.49e-04 | NA | NA |
| 5. P | P9WGT6 | Phosphate-binding protein PstS 3 | 1.58e-01 | 4.45e-08 | NA | NA |
| 5. P | P0A3T3 | 31 kDa immunogenic protein | 2.57e-01 | 4.21e-02 | NA | NA |
| 5. P | Q8CP98 | Phosphate-binding protein PstS | 3.51e-01 | 2.33e-06 | NA | NA |
| 5. P | P21408 | Fe(3+)-binding periplasmic protein | 5.67e-02 | 3.34e-04 | NA | NA |
| 5. P | P43020 | Uncharacterized protein YiiZ | 1.53e-01 | 4.70e-02 | NA | NA |
| 5. P | Q8E5K2 | Phosphate-binding protein PstS 1 | 5.23e-01 | 1.55e-02 | NA | NA |
| 5. P | P29724 | Membrane lipoprotein TmpC | 3.00e-01 | 1.20e-04 | NA | NA |
| 5. P | Q8TTZ5 | Uncharacterized solute-binding protein MA_0280 | 1.13e-01 | 1.80e-04 | NA | NA |
| 5. P | P44992 | Uncharacterized protein HI_1028 | 2.50e-01 | 1.44e-02 | NA | NA |
| 5. P | B0R6A8 | Chemotactic signal transduction system substrate-binding protein CosB | 1.74e-01 | 6.90e-04 | NA | NA |
| 5. P | Q2LWH5 | Uncharacterized solute-binding protein SYNAS_25580 | 1.53e-01 | 1.11e-05 | NA | NA |
| 5. P | P9WGU0 | Phosphate-binding protein PstS 1 | 1.38e-01 | 1.31e-05 | NA | NA |
| 5. P | P72827 | Iron uptake protein A1 | 4.35e-02 | 2.23e-07 | NA | NA |
| 5. P | O30142 | Molybdate/tungstate-binding protein WtpA | 2.41e-01 | 6.35e-05 | NA | NA |
| 5. P | P0DMR4 | Phosphate-binding protein PstS | 2.99e-01 | 4.37e-04 | NA | NA |
| 5. P | P04846 | Lipoprotein 28 | 2.42e-01 | 1.07e-03 | NA | NA |
| 5. P | P9WGT7 | Phosphate-binding protein PstS 3 | 1.59e-01 | 4.45e-08 | NA | NA |
| 5. P | Q9KK89 | Phosphate-binding protein PstS 3 | 2.44e-01 | 1.88e-07 | NA | NA |
| 5. P | Q8XC50 | Lipoprotein 28 | 2.74e-01 | 8.74e-04 | NA | NA |
| 5. P | Q312S0 | Isethionate-binding periplasmic protein DctP | 3.08e-01 | 8.40e-05 | NA | NA |
| 5. P | Q9I6J1 | Putrescine-binding periplasmic protein SpuD | 2.81e-02 | 4.82e-06 | NA | NA |
| 5. P | P9WGT8 | Phosphate-binding protein PstS 2 | 1.81e-01 | 9.55e-09 | NA | NA |
| 5. P | Q4L694 | Phosphate-binding protein PstS | 3.40e-01 | 9.85e-08 | NA | NA |
| 5. P | Q8U4K5 | Molybdate/tungstate-binding protein WtpA | 2.40e-01 | 6.98e-08 | NA | NA |
| 5. P | O05252 | ABC transporter guanosine-binding protein NupN | 1.81e-01 | 2.95e-04 | NA | NA |
| 5. P | Q9CNJ4 | Phosphate-binding protein PstS | 1.26e-01 | 7.79e-03 | NA | NA |
| 5. P | A9WGD2 | Riboflavin-binding protein RibY | 1.71e-01 | 2.00e-03 | NA | NA |
| 5. P | Q08383 | Molybdate-binding protein ModA | 2.39e-01 | 2.79e-02 | NA | NA |
| 5. P | Q7CR85 | Thiamine-binding periplasmic protein | 5.48e-02 | 3.15e-06 | NA | NA |
| 5. P | P0A3T2 | 31 kDa immunogenic protein | 2.14e-01 | 4.21e-02 | NA | NA |
| 5. P | Q7A0X7 | Phosphate-binding protein PstS | 4.00e-01 | 1.54e-03 | NA | NA |
| 5. P | P0A2C7 | Spermidine/putrescine-binding periplasmic protein | 9.18e-02 | 1.53e-03 | NA | NA |
| 5. P | P45192 | Phosphate-binding protein PstS | 1.25e-01 | 1.58e-04 | NA | NA |
| 5. P | Q98FL2 | Phosphate-binding protein PstS | 2.30e-01 | 2.65e-04 | NA | NA |
| 5. P | P0AFM3 | Glycine betaine/proline betaine-binding periplasmic protein | 3.38e-01 | 6.48e-05 | NA | NA |
| 5. P | Q8Z992 | D-methionine-binding lipoprotein MetQ | 3.86e-01 | 2.63e-03 | NA | NA |
| 5. P | P59214 | Maltooligosaccharide ABC transporter solute-binding lipoprotein | 7.20e-02 | 2.62e-02 | NA | NA |
| 5. P | Q49XJ1 | Phosphate-binding protein PstS | 1.86e-01 | 3.77e-06 | NA | NA |
| 5. P | Q2YXX9 | Phosphate-binding protein PstS | 3.66e-01 | 2.78e-03 | NA | NA |
| 5. P | P35482 | Alkaline phosphatase L | 3.06e-01 | 3.27e-02 | NA | NA |
| 5. P | P0AG78 | Sulfate-binding protein | 1.41e-01 | 4.11e-02 | NA | NA |
| 5. P | P31133 | Putrescine-binding periplasmic protein PotF | 1.47e-01 | 5.99e-04 | NA | NA |
| 5. P | Q5N0R0 | Iron deficiency-induced protein A | 3.81e-02 | 9.62e-03 | NA | NA |
| 5. P | Q2FH48 | Phosphate-binding protein PstS | 3.47e-01 | 1.54e-03 | NA | NA |
| 5. P | Q9CBE5 | Phosphate-binding protein PstS 3 | 2.42e-01 | 1.08e-07 | NA | NA |
| 5. P | Q87C91 | Phosphate-binding protein PstS | 1.03e-01 | 2.59e-06 | NA | NA |
| 5. P | Q8X8V9 | D-methionine-binding lipoprotein MetQ | 3.14e-01 | 6.70e-03 | NA | NA |
| 5. P | Q122C7 | Solute-binding protein Bpro_4736 | 1.17e-01 | 3.43e-06 | NA | NA |
| 5. P | P28635 | D-methionine-binding lipoprotein MetQ | 1.61e-01 | 4.65e-03 | NA | NA |
| 5. P | P35755 | Iron-utilization periplasmic protein | 3.41e-01 | 4.43e-06 | NA | NA |
| 5. P | P0A5Y3 | Phosphate-binding protein PstS 3 | 1.64e-01 | 4.45e-08 | NA | NA |
| 5. P | O59403 | Uncharacterized lipoprotein PH1714 | 2.31e-01 | 2.05e-02 | NA | NA |
| 5. P | P75184 | Uncharacterized lipoprotein MG412 homolog | 1.75e-01 | 4.82e-07 | NA | NA |
| 5. P | P33362 | Glycine betaine-binding protein YehZ | 9.34e-02 | 2.06e-07 | NA | NA |
| 5. P | Q9KU25 | Norspermidine sensor | 1.47e-01 | 3.91e-05 | NA | NA |
| 5. P | O31362 | Basic membrane protein B | 4.35e-01 | 2.69e-02 | NA | NA |
| 5. P | Q6G9H1 | Phosphate-binding protein PstS | 3.79e-01 | 1.54e-03 | NA | NA |
| 5. P | P0AG83 | Phosphate-binding protein PstS | 1.78e-01 | 5.83e-07 | NA | NA |
| 5. P | P0AG82 | Phosphate-binding protein PstS | 1.77e-01 | 5.83e-07 | NA | NA |
| 5. P | P71336 | Uncharacterized protein HI_0052 | 3.92e-01 | 1.85e-04 | NA | NA |
| 5. P | Q9I6J0 | Spermidine-binding periplasmic protein SpuE | 3.52e-02 | 4.63e-04 | NA | NA |
| 5. P | Q9PBK3 | Phosphate-binding protein PstS | 1.07e-01 | 6.09e-07 | NA | NA |
| 5. P | P31728 | Probable D-methionine-binding lipoprotein MetQ | 3.78e-01 | 5.61e-03 | NA | NA |
| 5. P | Q97BB3 | Uncharacterized solute-binding protein TV0544 | 2.23e-01 | 5.55e-08 | NA | NA |
| 5. P | A9BF57 | Uncharacterized solute-binding protein Pmob_0379 | 2.51e-01 | 2.68e-04 | NA | NA |
| 5. P | Q96YZ5 | Uncharacterized solute-binding protein STK_20340 | 8.56e-02 | 2.86e-06 | NA | NA |
| 5. P | P17259 | Major ferric iron-binding protein | 3.14e-01 | 3.07e-03 | NA | NA |
| 5. P | Q55200 | Protein SphX | 1.62e-01 | 7.26e-03 | NA | NA |
| 5. P | Q8ZML1 | Glycine betaine/proline betaine-binding periplasmic protein | 3.56e-01 | 5.14e-05 | NA | NA |
| 5. P | P61618 | Uncharacterized solute-binding protein MMP1652 | 1.16e-01 | 5.82e-04 | NA | NA |
| 5. P | Q02UB7 | Putrescine-binding periplasmic protein SpuD | 2.73e-02 | 4.82e-06 | NA | NA |
| 5. P | Q93KD6 | Tungstate-binding protein TupA | 7.81e-02 | 3.04e-03 | NA | NA |
| 5. P | Q4QP41 | Sialic acid-binding periplasmic protein SiaP | 3.42e-01 | 4.42e-05 | NA | NA |
| 5. P | Q8FYV1 | Thiamine-binding periplasmic protein | 1.90e-01 | 4.89e-05 | NA | NA |
| 5. P | P0AFK9 | Spermidine/putrescine-binding periplasmic protein | 1.49e-01 | 1.46e-03 | NA | NA |
| 5. P | P37735 | C4-dicarboxylate-binding periplasmic protein DctP | 1.75e-01 | 4.04e-02 | NA | NA |
| 5. P | Q9KR64 | Sialic acid-binding periplasmic protein SiaP | 2.60e-01 | 2.48e-04 | NA | NA |
| 5. P | O32436 | Transcriptional activator protein med | 3.15e-01 | 3.44e-02 | NA | NA |
| 5. P | Q9KQR9 | C4-dicarboxylate-binding periplasmic protein DctP | 2.19e-01 | 1.03e-02 | NA | NA |
| 5. P | A0A0H3MBL5 | Phosphate-binding protein PstS2 | 1.50e-01 | 1.40e-08 | NA | NA |
| 5. P | G2JZ42 | Carnitine transport binding protein OpuCC | 1.72e-01 | 1.73e-05 | NA | NA |
| 5. P | Q9HTX3 | Probable binding protein component of ABC iron transporter PA5217 | 2.89e-02 | 4.14e-02 | NA | NA |
| 5. P | P96600 | C4-dicarboxylate-binding protein DctB | 2.74e-01 | 1.71e-04 | NA | NA |
| 5. P | Q92BW7 | CD4+ T-cell-stimulating antigen | 3.85e-01 | 3.37e-04 | NA | NA |
| 5. P | Q7A5Q2 | Phosphate-binding protein PstS | 3.69e-01 | 1.54e-03 | NA | NA |
| 5. P | Q8ZH40 | D-methionine-binding lipoprotein MetQ | 2.49e-01 | 2.79e-02 | NA | NA |
| 5. P | P9WGT9 | Phosphate-binding protein PstS 2 | 1.49e-01 | 9.55e-09 | NA | NA |
| 5. P | A3DL83 | Uncharacterized solute-binding protein Smar_0280 | 3.38e-01 | 1.40e-07 | NA | NA |
| 5. P | P76108 | Bifunctional polyhydroxybutyrate synthase / ABC transporter periplasmic binding protein | 2.99e-01 | 2.04e-04 | NA | NA |
| 5. P | Q8DZV4 | Phosphate-binding protein PstS 1 | 5.20e-01 | 1.55e-02 | NA | NA |
| 5. P | Q08868 | Outer membrane lipoprotein 1 | 3.52e-01 | 2.93e-03 | NA | NA |
| 5. P | P37676 | 2,3-diketo-L-gulonate-binding periplasmic protein YiaO | 3.19e-01 | 1.03e-02 | NA | NA |
| 5. P | P27366 | Sulfate-binding protein | 7.96e-02 | 1.49e-04 | NA | NA |
| 5. P | P9WGU1 | Phosphate-binding protein PstS 1 | 1.33e-01 | 1.31e-05 | NA | NA |
| 5. P | P0A0Y4 | Major ferric iron-binding protein | 3.69e-01 | 2.02e-03 | NA | NA |
| 5. P | Q31L64 | Iron deficiency-induced protein A | 4.73e-02 | 9.62e-03 | NA | NA |
| 5. P | A6UX24 | Uncharacterized solute-binding protein Maeo_1470 | 5.94e-02 | 4.38e-05 | NA | NA |
| 5. P | P16700 | Thiosulfate-binding protein | 1.05e-01 | 6.19e-03 | NA | NA |
| 5. P | Q57BC4 | Thiamine-binding periplasmic protein | 1.86e-01 | 6.22e-05 | NA | NA |
| 5. P | Q55835 | Iron uptake protein A2 | 6.40e-02 | 3.84e-02 | NA | NA |
| 5. P | Q7A2S1 | Phosphate-binding protein PstS | 3.63e-01 | 1.54e-03 | NA | NA |
| 5. P | E0SCY3 | Glycine betaine-binding periplasmic protein OusX | 4.02e-01 | 7.17e-04 | NA | NA |
| 5. P | Q58586 | Molybdate/tungstate-binding protein WtpA | 1.71e-01 | 1.10e-06 | NA | NA |
| 5. P | Q8YJ02 | Thiamine-binding periplasmic protein | 1.85e-01 | 6.41e-05 | NA | NA |
| 5. P | A6VHR6 | Uncharacterized solute-binding protein MmarC7_0925 | 1.47e-01 | 1.06e-06 | NA | NA |
| 5. P | Q9KHT7 | Carnitine transport binding protein OpuCC | 1.09e-01 | 1.73e-05 | NA | NA |
| 5. P | P0AG79 | Sulfate-binding protein | 1.38e-01 | 4.11e-02 | NA | NA |
| 5. P | Q97Z99 | Uncharacterized solute-binding protein SSO1031 | 4.70e-02 | 2.60e-04 | NA | NA |
| 5. P | Q8U0A4 | Uncharacterized lipoprotein PF1695 | 2.45e-01 | 3.44e-02 | NA | NA |
| 5. P | A3QCW5 | C4-dicarboxylate-binding periplasmic protein DctP | 2.12e-01 | 1.83e-04 | NA | NA |
| 5. P | Q5HG31 | Phosphate-binding protein PstS | 3.63e-01 | 1.54e-03 | NA | NA |
| 5. P | Q58421 | Phosphate-binding protein PstS | 2.21e-01 | 2.34e-08 | NA | NA |
| 5. P | P0AFM2 | Glycine betaine/proline betaine-binding periplasmic protein | 3.79e-01 | 6.48e-05 | NA | NA |
| 5. P | A3CWQ6 | Uncharacterized solute-binding protein Memar_1880 | 9.49e-02 | 9.47e-05 | NA | NA |
| 5. P | P45168 | Spermidine/putrescine-binding periplasmic protein 1 | 4.77e-02 | 1.43e-05 | NA | NA |
| 5. P | Q02DZ3 | Phosphate-binding protein PstS | 5.89e-01 | 4.37e-04 | NA | NA |
| 5. P | P55454 | Probable ABC transporter periplasmic-binding protein y4fP | 1.25e-01 | 1.74e-03 | NA | NA |
| 5. P | P44984 | Thiamine-binding periplasmic protein | 5.94e-02 | 1.82e-05 | NA | NA |
| 5. P | A4G0R9 | Uncharacterized solute-binding protein MmarC5_1756 | 1.12e-01 | 2.12e-05 | NA | NA |
| 5. P | P31550 | Thiamine-binding periplasmic protein | 5.93e-02 | 8.95e-07 | NA | NA |
| 5. P | Q5JEB6 | Molybdate/tungstate-binding protein WtpA | 1.14e-01 | 1.10e-08 | NA | NA |
| 5. P | O07950 | Membrane lipoprotein TpN32 | 4.06e-01 | 1.94e-03 | NA | NA |
| 5. P | C0QY54 | Putative ABC transporter periplasmic binding protein BHWA1_00430 | 2.74e-02 | 1.10e-03 | NA | NA |
| 5. P | P0A2C8 | Spermidine/putrescine-binding periplasmic protein | 8.48e-02 | 1.53e-03 | NA | NA |
| 5. P | P0A0Y3 | Major ferric iron-binding protein | 3.88e-01 | 2.47e-03 | NA | NA |
| 5. P | Q9V2C4 | Molybdate/tungstate-binding protein WtpA | 1.90e-01 | 4.99e-07 | NA | NA |
| 5. P | P47652 | Uncharacterized lipoprotein MG412 | 2.44e-01 | 2.76e-08 | NA | NA |
| 5. P | A0A0H3M950 | Phosphate-binding protein PstS1 | 1.49e-01 | 1.54e-05 | NA | NA |
| 5. P | O32243 | Glycine betaine/carnitine/choline-binding protein OpuCC | 1.41e-01 | 4.51e-05 | NA | NA |
| 5. P | Q6GH18 | Phosphate-binding protein PstS | 3.65e-01 | 8.57e-04 | NA | NA |
| 5. P | Q128M1 | Solute-binding protein Bpro_3107 | 5.50e-01 | 2.42e-03 | NA | NA |
| 5. P | O32167 | Methionine-binding lipoprotein MetQ | 3.35e-01 | 1.10e-02 | NA | NA |
| 5. P | E4QEZ3 | Basic membrane protein C | 3.77e-01 | 4.01e-04 | NA | NA |
| 5. P | P44731 | Spermidine/putrescine-binding periplasmic protein 2 | 7.37e-02 | 2.27e-03 | NA | NA |
| 5. P | P59213 | Maltooligosaccharide ABC transporter solute-binding lipoprotein | 6.52e-02 | 1.72e-02 | NA | NA |
| 5. P | P37734 | Molybdate-binding protein ModA | 1.87e-01 | 1.50e-02 | NA | NA |
| 5. P | Q9HU18 | C4-dicarboxylate-binding periplasmic protein DctP | 1.76e-01 | 4.82e-03 | NA | NA |
| 5. P | P54594 | Uncharacterized lipoprotein YhcJ | 1.65e-01 | 8.97e-06 | NA | NA |
| 5. P | P0CL65 | Basic membrane protein C | 3.56e-01 | 5.66e-04 | NA | NA |
| 5. P | Q48754 | CD4+ T-cell-stimulating antigen | 3.44e-01 | 1.74e-04 | NA | NA |
| 5. P | Q9KTJ7 | Probable D-methionine-binding lipoprotein MetQ | 2.44e-01 | 2.04e-05 | NA | NA |
| 5. P | G3XDA8 | Phosphate-binding protein PstS | 2.91e-01 | 4.37e-04 | NA | NA |
| 5. P | P76223 | Protein YnjB | 7.11e-02 | 1.76e-03 | NA | NA |
| 5. P | Q01903 | Sulfate-binding protein | 2.93e-02 | 6.29e-07 | NA | NA |
| 5. P | Q5HPF2 | Phosphate-binding protein PstS | 3.88e-01 | 1.61e-05 | NA | NA |
| 5. P | Q8ZRN1 | D-methionine-binding lipoprotein MetQ | 4.19e-01 | 2.58e-03 | NA | NA |
| 5. P | Q52812 | General L-amino acid-binding periplasmic protein AapJ | 3.51e-01 | 4.57e-03 | NA | NA |
| 5. P | O57890 | Molybdate/tungstate-binding protein WtpA | 1.78e-01 | 1.35e-08 | NA | NA |
| 5. P | A0A0H3MBK5 | Phosphate-binding protein PstS3 | 1.80e-01 | 4.45e-08 | NA | NA |
| 5. P | Q8ZPK2 | Osmoprotectant-binding protein OsmX | 6.80e-02 | 3.42e-07 | NA | NA |
| 5. P | P0AFL0 | Spermidine/putrescine-binding periplasmic protein | 1.83e-01 | 1.46e-03 | NA | NA |
| 5. P | P43951 | Uncharacterized protein HI_0131 | 2.12e-01 | 1.57e-03 | NA | NA |
| 5. P | A2RK47 | ABC transporter nucleoside-binding protein BmpA | 4.13e-01 | 2.89e-04 | NA | NA |
| 5. P | Q08870 | Outer membrane lipoprotein 3 | 3.10e-01 | 3.07e-03 | NA | NA |
| 5. P | Q16BC9 | Solute-binding protein RD1_1052 | 2.05e-01 | 3.99e-03 | NA | NA |
| 5. P | Q2FYP6 | Phosphate-binding protein PstS | 3.95e-01 | 1.54e-03 | NA | NA |
| 5. P | A6UQT5 | Uncharacterized solute-binding protein Mevan_0954 | 1.43e-01 | 3.22e-04 | NA | NA |
| 5. P | Q45462 | Choline-binding protein | 1.33e-01 | 6.90e-04 | NA | NA |
| 5. P | Q2YLW8 | Thiamine-binding periplasmic protein | 1.40e-01 | 6.22e-05 | NA | NA |
| 5. P | A3T0D1 | Solute-binding protein NAS141_03721 | 1.51e-01 | 2.72e-02 | NA | NA |
| 5. P | E1VBK1 | Ectoine-binding periplasmic protein TeaA | 1.43e-01 | 6.30e-03 | NA | NA |
| 5. P | A3PC74 | Probable ABC transporter phosphite binding protein PhnD1 | 1.24e-04 | 1.09e-03 | NA | NA |
| 5. P | P44542 | Sialic acid-binding periplasmic protein SiaP | 3.47e-01 | 6.22e-05 | NA | NA |
| 6. F | O32156 | Uncharacterized ABC transporter extracellular-binding protein YurO | 8.29e-02 | NA | NA | 0.2571 |
| 6. F | Q9V297 | Maltotriose-binding protein | 2.09e-01 | NA | NA | 0.2555 |
| 6. F | Q8UB32 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 5.82e-02 | NA | NA | 0.2912 |
| 6. F | O69061 | Probable phosphite transport system-binding protein HtxB | 5.93e-04 | NA | NA | 0.5317 |