Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54945.1
JCVISYN3A_0732

Deoxyribose-phosphate aldolase.
M. mycoides homolog: Q6MSE7.
TIGRfam Classification: 3=Putative.
Category: Nonessential.

Statistics

Total GO Annotation: 90
Unique PROST Go: 37
Unique BLAST Go: 1
Unique Foldseek Go: 29

Total Homologs: 2078
Unique PROST Homologs: 1250
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 443

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: deoC; Deoxyribose-phosphate aldolase
Zhang et al. [4]: GO:0004139|deoxyribose-phosphate aldolase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q6D3R0 (Deoxyribose-phosphate aldolase) with a FATCAT P-Value: 0 and RMSD of 1.53 angstrom. The sequence alignment identity is 45.7%.
Structural alignment shown in left. Query protein AVX54945.1 colored as red in alignment, homolog Q6D3R0 colored as blue. Query protein AVX54945.1 is also shown in right top, homolog Q6D3R0 showed in right bottom. They are colored based on secondary structures. 

  AVX54945.1 MEIKLNKYIDHTLLKPEATKQDIINLCNQAIQYDFATVCVNTCWTSLCKELLKNSNVGITNVVGFPLGACLTEVKVFETKKAIENGCDEIDMVLNIGALK 100
      Q6D3R0 M-TDYARYIDHTLLAANATEQQIVTLCDEAIAHHFYAVCVNSGYVPLVAEKLKGSAVQVCSVIGFPLGAGLTSSKAFEAKAAIDAGAQEIDMVINVGWLK 99

  AVX54945.1 DKDYDLVLNDMKEVKK--AANDHV-VKVILENCLLTEQEIIKACELAVKAGID--FVKTSTGFNKSGANIKDVKLMSEVVKNKAKVKAAGGVRTYDDAIA 195
      Q6D3R0 SGKIDAVKADIQAVRGVCAA---IPLKVILETCLLDDEQIVLVCEMCRQ--LDVAFVKTSTGFSTDGAREEHVRLMRSTVGSEMGVKASGAVR--DRETA 192

  AVX54945.1 --MINAGASRLGTSGSVEIVLKQENKS---NY 222
      Q6D3R0 QRMIEAGATRIGTSSGVAIV--SDDAAAAGNY 222

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0004139 deoxyribose-phosphate aldolase activity
1. PBF GO:0009264 deoxyribonucleotide catabolic process
1. PBF GO:0005737 cytoplasm
1. PBF GO:0046386 deoxyribose phosphate catabolic process
1. PBF GO:0046121 deoxyribonucleoside catabolic process
1. PBF GO:0016052 carbohydrate catabolic process
2. PF GO:0006096 glycolytic process
2. PF GO:0047465 N-acylglucosamine-6-phosphate 2-epimerase activity
2. PF GO:0006878 cellular copper ion homeostasis
2. PF GO:0005886 plasma membrane
2. PF GO:0046279 3,4-dihydroxybenzoate biosynthetic process
2. PF GO:0004834 tryptophan synthase activity
2. PF GO:0009073 aromatic amino acid family biosynthetic process
2. PF GO:0004332 fructose-bisphosphate aldolase activity
2. PF GO:0008652 cellular amino acid biosynthetic process
2. PF GO:0003855 3-dehydroquinate dehydratase activity
2. PF GO:0009385 N-acylmannosamine-6-phosphate 2-epimerase activity
2. PF GO:0009423 chorismate biosynthetic process
2. PF GO:0006094 gluconeogenesis
2. PF GO:0046872 metal ion binding
2. PF GO:0000287 magnesium ion binding
2. PF GO:0004807 triose-phosphate isomerase activity
4. PB GO:0005576 extracellular region
5. P GO:0008615 pyridoxine biosynthetic process
5. P GO:0003723 RNA binding
5. P GO:0000162 tryptophan biosynthetic process
5. P GO:0043801 hexulose-6-phosphate synthase activity
5. P GO:0000105 histidine biosynthetic process
5. P GO:0019262 N-acetylneuraminate catabolic process
5. P GO:1990107 thiazole synthase activity
5. P GO:0006051 N-acetylmannosamine metabolic process
5. P GO:0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
5. P GO:0019647 formaldehyde assimilation via ribulose monophosphate cycle
5. P GO:0046391 5-phosphoribose 1-diphosphate metabolic process
5. P GO:0004789 thiamine-phosphate diphosphorylase activity
5. P GO:0000107 imidazoleglycerol-phosphate synthase activity
5. P GO:0009228 thiamine biosynthetic process
5. P GO:0016829 lyase activity
5. P GO:0019563 glycerol catabolic process
5. P GO:0046474 glycerophospholipid biosynthetic process
5. P GO:0005975 carbohydrate metabolic process
5. P GO:0005634 nucleus
5. P GO:0009229 thiamine diphosphate biosynthetic process
5. P GO:0004640 phosphoribosylanthranilate isomerase activity
5. P GO:0006053 N-acetylmannosamine catabolic process
5. P GO:0004425 indole-3-glycerol-phosphate synthase activity
5. P GO:0061595 6-deoxy-6-sulfofructose-1-phosphate aldolase activity
5. P GO:0004590 orotidine-5'-phosphate decarboxylase activity
5. P GO:0001072 transcription antitermination factor activity, RNA binding
5. P GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
5. P GO:0047294 phosphoglycerol geranylgeranyltransferase activity
5. P GO:0016744 transketolase or transaldolase activity
5. P GO:0033856 pyridoxine 5'-phosphate synthase activity
5. P GO:1902777 6-sulfoquinovose(1-) catabolic process
5. P GO:0016020 membrane
5. P GO:0016836 hydro-lyase activity
5. P GO:0046166 glyceraldehyde-3-phosphate biosynthetic process
5. P GO:0006730 one-carbon metabolic process
5. P GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
5. P GO:0002094 polyprenyltransferase activity
6. F GO:2001120 methanofuran biosynthetic process
6. F GO:0030603 oxaloacetase activity
6. F GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity
6. F GO:0047776 citramalate lyase activity
6. F GO:0019570 L-arabinose catabolic process to 2-oxoglutarate
6. F GO:0009082 branched-chain amino acid biosynthetic process
6. F GO:0009102 biotin biosynthetic process
6. F GO:0009089 lysine biosynthetic process via diaminopimelate
6. F GO:0047449 2-dehydro-3-deoxy-L-arabinonate dehydratase activity
6. F GO:0006098 pentose-phosphate shunt
6. F GO:0008700 4-hydroxy-2-oxoglutarate aldolase activity
6. F GO:0005507 copper ion binding
6. F GO:0009098 leucine biosynthetic process
6. F GO:0004152 dihydroorotate dehydrogenase activity
6. F GO:0010177 2-(2'-methylthio)ethylmalate synthase activity
6. F GO:0050188 phosphoenolpyruvate mutase activity
6. F GO:0043714 (R)-citramalate synthase activity
6. F GO:0005524 ATP binding
6. F GO:0032923 organic phosphonate biosynthetic process
6. F GO:0016830 carbon-carbon lyase activity
6. F GO:0019877 diaminopimelate biosynthetic process
6. F GO:0015937 coenzyme A biosynthetic process
6. F GO:0008840 4-hydroxy-tetrahydrodipicolinate synthase activity
6. F GO:0009384 N-acylmannosamine kinase activity
6. F GO:0004076 biotin synthase activity
6. F GO:0051537 2 iron, 2 sulfur cluster binding
6. F GO:0008807 carboxyvinyl-carboxyphosphonate phosphorylmutase activity
6. F GO:0015940 pantothenate biosynthetic process
6. F GO:0003852 2-isopropylmalate synthase activity
7. B GO:0005829 cytosol

Uniprot GO Annotations

GO Description
GO:0004139 deoxyribose-phosphate aldolase activity
GO:0016829 lyase activity
GO:0009264 deoxyribonucleotide catabolic process
GO:0005737 cytoplasm
GO:0016052 carbohydrate catabolic process
GO:0003824 catalytic activity
GO:0046386 deoxyribose phosphate catabolic process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF B1WW41 Deoxyribose-phosphate aldolase 0.00e+00 3.89e-39 1.53e-47 0.9732
1. PBF A7MGB0 Deoxyribose-phosphate aldolase 0.00e+00 4.27e-14 3.15e-19 0.8969
1. PBF Q6NJX0 Deoxyribose-phosphate aldolase 0.00e+00 1.52e-34 2.44e-49 0.9054
1. PBF B7UR09 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8947
1. PBF A8FYQ9 Deoxyribose-phosphate aldolase 0.00e+00 4.14e-15 7.56e-18 0.9184
1. PBF B1ILA1 Deoxyribose-phosphate aldolase 0.00e+00 1.78e-39 4.39e-73 0.9908
1. PBF Q73A11 Deoxyribose-phosphate aldolase 0.00e+00 1.69e-43 5.10e-73 0.9885
1. PBF A9KZ80 Deoxyribose-phosphate aldolase 0.00e+00 1.06e-16 2.15e-19 0.9173
1. PBF P43048 Deoxyribose-phosphate aldolase 0.00e+00 4.66e-40 3.80e-65 0.9779
1. PBF A0KCV5 Deoxyribose-phosphate aldolase 0.00e+00 4.31e-41 1.57e-50 0.9805
1. PBF A3CMP6 Deoxyribose-phosphate aldolase 0.00e+00 3.09e-47 6.07e-85 0.9912
1. PBF Q327L5 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8946
1. PBF P63930 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 0.9373
1. PBF C6DEP1 Deoxyribose-phosphate aldolase 0.00e+00 1.43e-44 8.36e-59 0.9764
1. PBF B0BPV4 Deoxyribose-phosphate aldolase 0.00e+00 2.37e-13 6.44e-20 0.8945
1. PBF Q4JSV3 Deoxyribose-phosphate aldolase 0.00e+00 1.07e-23 3.73e-37 0.8628
1. PBF Q97RH2 Deoxyribose-phosphate aldolase 0.00e+00 4.61e-45 4.34e-80 0.9931
1. PBF Q5UX95 Deoxyribose-phosphate aldolase 0.00e+00 1.59e-19 2.44e-32 0.9339
1. PBF B2HQU3 Deoxyribose-phosphate aldolase 0.00e+00 1.30e-28 7.83e-46 0.9395
1. PBF A4VVB2 Deoxyribose-phosphate aldolase 0.00e+00 1.49e-44 2.92e-82 0.9912
1. PBF Q6F0H8 Deoxyribose-phosphate aldolase 2 0.00e+00 5.19e-38 5.69e-59 0.9858
1. PBF Q8DBT2 Deoxyribose-phosphate aldolase 0.00e+00 1.15e-10 3.21e-24 0.9049
1. PBF Q4ZMV1 Deoxyribose-phosphate aldolase 0.00e+00 6.23e-42 1.60e-60 0.9868
1. PBF B2GG36 Deoxyribose-phosphate aldolase 0.00e+00 6.38e-35 8.58e-52 0.9223
1. PBF Q892U4 Deoxyribose-phosphate aldolase 0.00e+00 5.94e-43 1.29e-74 0.9873
1. PBF B2TL86 Deoxyribose-phosphate aldolase 0.00e+00 1.12e-47 1.13e-57 0.9586
1. PBF Q7NFI7 Deoxyribose-phosphate aldolase 0.00e+00 2.00e-32 1.35e-38 0.9605
1. PBF B7MNI8 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.9023
1. PBF B2A4J4 Deoxyribose-phosphate aldolase 0.00e+00 2.98e-41 5.10e-71 0.9773
1. PBF A4SRU4 Deoxyribose-phosphate aldolase 0.00e+00 1.04e-14 1.06e-18 0.9293
1. PBF Q6LUH4 Deoxyribose-phosphate aldolase 0.00e+00 3.42e-15 2.49e-22 0.9154
1. PBF Q0SX30 Deoxyribose-phosphate aldolase 0.00e+00 1.66e-14 9.44e-21 0.9103
1. PBF Q65D22 Deoxyribose-phosphate aldolase 2 0.00e+00 5.20e-44 7.37e-66 0.9663
1. PBF Q6ALS3 Deoxyribose-phosphate aldolase 0.00e+00 2.36e-45 3.54e-64 0.9869
1. PBF P73618 Deoxyribose-phosphate aldolase 0.00e+00 2.11e-43 3.46e-52 0.969
1. PBF B0JK91 Deoxyribose-phosphate aldolase 0.00e+00 4.55e-38 5.00e-52 0.9739
1. PBF A6T962 Deoxyribose-phosphate aldolase 0.00e+00 9.45e-24 2.33e-35 0.9243
1. PBF A3D7J4 Deoxyribose-phosphate aldolase 0.00e+00 2.42e-16 5.39e-19 0.9093
1. PBF P39121 Deoxyribose-phosphate aldolase 0.00e+00 8.94e-44 3.99e-69 0.9701
1. PBF Q6F1Z6 Deoxyribose-phosphate aldolase 1 0.00e+00 2.56e-54 1.18e-109 0.9971
1. PBF Q5N4L8 Deoxyribose-phosphate aldolase 0.00e+00 5.60e-38 7.31e-42 0.9673
1. PBF B7IS80 Deoxyribose-phosphate aldolase 0.00e+00 9.12e-44 2.11e-72 0.9722
1. PBF B9DMC3 Deoxyribose-phosphate aldolase 0.00e+00 2.35e-49 1.42e-74 0.9933
1. PBF Q5XA31 Deoxyribose-phosphate aldolase 0.00e+00 2.25e-49 7.70e-56 0.9561
1. PBF Q0HXQ4 Deoxyribose-phosphate aldolase 0.00e+00 1.22e-16 9.31e-20 0.9094
1. PBF B7NH49 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.8905
1. PBF A2RCN4 Deoxyribose-phosphate aldolase 0.00e+00 2.25e-49 7.70e-56 0.955
1. PBF A3QGT3 Deoxyribose-phosphate aldolase 0.00e+00 8.42e-18 3.76e-18 0.9046
1. PBF Q0T8T2 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.9013
1. PBF A4XLW0 Deoxyribose-phosphate aldolase 0.00e+00 2.29e-43 4.19e-75 0.9748
1. PBF Q8XB36 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8947
1. PBF A0PYX5 Deoxyribose-phosphate aldolase 0.00e+00 8.01e-47 4.57e-82 0.979
1. PBF C1C6H7 Deoxyribose-phosphate aldolase 0.00e+00 1.52e-44 2.67e-77 0.9918
1. PBF B0K709 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-45 3.72e-73 0.9745
1. PBF C0M9B0 Deoxyribose-phosphate aldolase 0.00e+00 1.74e-53 4.59e-80 0.992
1. PBF O83288 Deoxyribose-phosphate aldolase 0.00e+00 2.15e-37 5.53e-50 0.9634
1. PBF Q6HK62 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9724
1. PBF A4IR26 Deoxyribose-phosphate aldolase 0.00e+00 2.47e-44 4.13e-78 0.9919
1. PBF P09924 Deoxyribose-phosphate aldolase 0.00e+00 8.61e-40 2.98e-52 0.9799
1. PBF A9VQK2 Deoxyribose-phosphate aldolase 0.00e+00 1.87e-43 4.01e-75 0.972
1. PBF Q66CP8 Deoxyribose-phosphate aldolase 1 0.00e+00 3.07e-42 6.04e-52 0.985
1. PBF Q600B2 Deoxyribose-phosphate aldolase 0.00e+00 7.53e-40 2.45e-59 0.9849
1. PBF A7ZVS4 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8948
1. PBF B1LB68 Deoxyribose-phosphate aldolase 0.00e+00 1.39e-21 8.22e-62 0.9915
1. PBF Q81EY8 Deoxyribose-phosphate aldolase 0.00e+00 2.68e-43 3.48e-72 0.972
1. PBF Q5E7J7 Deoxyribose-phosphate aldolase 0.00e+00 1.23e-14 3.64e-21 0.9043
1. PBF Q04L69 Deoxyribose-phosphate aldolase 0.00e+00 2.89e-45 2.52e-79 0.9928
1. PBF C3LQC2 Deoxyribose-phosphate aldolase 0.00e+00 2.98e-14 7.89e-20 0.904
1. PBF A3N123 Deoxyribose-phosphate aldolase 0.00e+00 7.44e-14 6.24e-20 0.895
1. PBF C1CJT2 Deoxyribose-phosphate aldolase 0.00e+00 4.61e-45 4.34e-80 0.9926
1. PBF Q1JF38 Deoxyribose-phosphate aldolase 0.00e+00 5.82e-49 6.26e-56 0.9619
1. PBF B3H1P7 Deoxyribose-phosphate aldolase 0.00e+00 3.98e-13 3.80e-20 0.8964
1. PBF Q6KHA7 Deoxyribose-phosphate aldolase 0.00e+00 1.88e-47 3.09e-65 0.988
1. PBF C0ZB54 Deoxyribose-phosphate aldolase 0.00e+00 1.45e-45 6.91e-77 0.9847
1. PBF Q5HM84 Deoxyribose-phosphate aldolase 0.00e+00 2.89e-45 7.80e-71 0.9907
1. PBF Q9HP08 Deoxyribose-phosphate aldolase 0.00e+00 5.16e-21 1.05e-38 0.9405
1. PBF B1IB13 Deoxyribose-phosphate aldolase 0.00e+00 8.76e-44 8.10e-80 0.9932
1. PBF C1KWT9 Deoxyribose-phosphate aldolase 0.00e+00 6.25e-47 8.89e-73 0.9677
1. PBF Q74IA4 Deoxyribose-phosphate aldolase 0.00e+00 8.22e-35 3.15e-58 0.9786
1. PBF A7FK39 Deoxyribose-phosphate aldolase 0.00e+00 1.03e-42 3.21e-51 0.9823
1. PBF Q7MI38 Deoxyribose-phosphate aldolase 2 0.00e+00 8.47e-11 6.47e-24 0.9071
1. PBF Q9PPQ4 Deoxyribose-phosphate aldolase 0.00e+00 1.42e-42 1.62e-55 0.9871
1. PBF B9E8I5 Deoxyribose-phosphate aldolase 0.00e+00 1.53e-43 7.14e-77 0.9916
1. PBF B1XFJ1 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.8999
1. PBF P47722 Deoxyribose-phosphate aldolase 0.00e+00 7.11e-40 5.59e-56 0.9671
1. PBF Q5SJ28 Deoxyribose-phosphate aldolase 0.00e+00 1.88e-38 4.36e-54 0.9543
1. PBF C1FN33 Deoxyribose-phosphate aldolase 0.00e+00 4.75e-40 2.69e-73 0.9899
1. PBF A6WRB8 Deoxyribose-phosphate aldolase 0.00e+00 1.06e-16 2.15e-19 0.9128
1. PBF B8E0F1 Deoxyribose-phosphate aldolase 0.00e+00 6.65e-45 1.89e-69 0.9929
1. PBF C3KVW7 Deoxyribose-phosphate aldolase 0.00e+00 2.00e-39 6.50e-73 0.9916
1. PBF C1CS48 Deoxyribose-phosphate aldolase 0.00e+00 1.44e-43 6.71e-81 0.9925
1. PBF Q8E2U1 Deoxyribose-phosphate aldolase 0.00e+00 1.64e-49 4.77e-56 0.9538
1. PBF Q2YUL6 Deoxyribose-phosphate aldolase 2 0.00e+00 4.34e-45 2.95e-70 0.9935
1. PBF A8FJ14 Deoxyribose-phosphate aldolase 0.00e+00 9.65e-48 2.68e-72 0.9757
1. PBF Q8ZJV8 Deoxyribose-phosphate aldolase 0.00e+00 6.22e-15 1.63e-20 0.9032
1. PBF A6UCC1 Deoxyribose-phosphate aldolase 0.00e+00 8.80e-27 2.38e-28 0.954
1. PBF A4Y9A8 Deoxyribose-phosphate aldolase 0.00e+00 7.70e-17 3.96e-19 0.9176
1. PBF B5FTC5 Deoxyribose-phosphate aldolase 0.00e+00 6.22e-15 1.63e-20 0.8915
1. PBF Q8NVF5 Deoxyribose-phosphate aldolase 2 0.00e+00 2.28e-42 4.01e-70 0.9917
1. PBF Q02YD6 Deoxyribose-phosphate aldolase 0.00e+00 9.62e-51 2.43e-73 0.9919
1. PBF B5Y277 Deoxyribose-phosphate aldolase 0.00e+00 2.35e-14 9.19e-19 0.8963
1. PBF B9DS93 Deoxyribose-phosphate aldolase 0.00e+00 9.60e-53 6.11e-83 0.9892
1. PBF A9NG35 Deoxyribose-phosphate aldolase 0.00e+00 1.40e-47 2.87e-62 0.9888
1. PBF B5E3L5 Deoxyribose-phosphate aldolase 0.00e+00 2.95e-45 3.73e-80 0.9921
1. PBF Q1J4Z3 Deoxyribose-phosphate aldolase 0.00e+00 6.63e-48 1.61e-56 0.9624
1. PBF Q1JK46 Deoxyribose-phosphate aldolase 0.00e+00 1.07e-48 2.68e-55 0.9617
1. PBF B7N2V7 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8961
1. PBF Q9RV25 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-46 1.88e-67 0.9896
1. PBF B8CKI4 Deoxyribose-phosphate aldolase 0.00e+00 3.11e-16 2.30e-19 0.9051
1. PBF Q5WHF4 Deoxyribose-phosphate aldolase 0.00e+00 2.33e-42 3.08e-71 0.9797
1. PBF Q72JE9 Deoxyribose-phosphate aldolase 0.00e+00 3.24e-37 8.64e-55 0.9542
1. PBF B1L1S5 Deoxyribose-phosphate aldolase 0.00e+00 1.41e-40 2.04e-73 0.9904
1. PBF Q3T0V9 Deoxyribose-phosphate aldolase 0.00e+00 7.06e-05 1.95e-11 0.8733
1. PBF Q086G0 Deoxyribose-phosphate aldolase 0.00e+00 9.08e-15 5.09e-20 0.9089
1. PBF Q4A7J6 Deoxyribose-phosphate aldolase 0.00e+00 5.64e-42 2.56e-59 0.9846
1. PBF B4TGZ9 Deoxyribose-phosphate aldolase 0.00e+00 6.22e-15 1.63e-20 0.8943
1. PBF Q97CC6 Deoxyribose-phosphate aldolase 0.00e+00 1.88e-11 7.66e-29 0.8868
1. PBF Q97IU5 Deoxyribose-phosphate aldolase 0.00e+00 8.83e-45 9.31e-71 0.985
1. PBF C4Z3P0 Deoxyribose-phosphate aldolase 0.00e+00 5.46e-49 8.81e-84 0.9845
1. PBF A4W1L5 Deoxyribose-phosphate aldolase 0.00e+00 2.02e-44 8.39e-83 0.9916
1. PBF B8HXS4 Deoxyribose-phosphate aldolase 0.00e+00 3.85e-44 6.75e-56 0.9738
1. PBF Q3ABV0 Deoxyribose-phosphate aldolase 0.00e+00 2.03e-40 6.91e-76 0.979
1. PBF O26909 Deoxyribose-phosphate aldolase 0.00e+00 4.55e-36 1.68e-53 0.9735
1. PBF B7LEM7 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.9033
1. PBF B8ZT93 Deoxyribose-phosphate aldolase 0.00e+00 8.20e-29 1.98e-47 0.9484
1. PBF Q8NTC4 Deoxyribose-phosphate aldolase 0.00e+00 6.26e-38 8.39e-43 0.9326
1. PBF C1CDJ0 Deoxyribose-phosphate aldolase 0.00e+00 2.95e-45 3.73e-80 0.993
1. PBF A5I237 Deoxyribose-phosphate aldolase 0.00e+00 5.66e-41 1.76e-72 0.99
1. PBF B5FA98 Deoxyribose-phosphate aldolase 0.00e+00 8.10e-14 3.57e-21 0.9046
1. PBF Q65H59 Deoxyribose-phosphate aldolase 1 0.00e+00 6.51e-47 4.42e-77 0.9869
1. PBF B0UTU0 Deoxyribose-phosphate aldolase 0.00e+00 1.69e-47 1.29e-67 0.9911
1. PBF B6I6M8 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8945
1. PBF Q4A5W6 Deoxyribose-phosphate aldolase 0.00e+00 1.69e-43 2.13e-74 0.9709
1. PBF B2INW0 Deoxyribose-phosphate aldolase 0.00e+00 4.17e-45 4.86e-79 0.9937
1. PBF C3L6K8 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9723
1. PBF B0TQ91 Deoxyribose-phosphate aldolase 0.00e+00 1.34e-16 1.20e-19 0.908
1. PBF Q5KX02 Deoxyribose-phosphate aldolase 0.00e+00 5.07e-43 8.01e-80 0.9911
1. PBF Q6GET8 Deoxyribose-phosphate aldolase 2 0.00e+00 1.20e-45 3.52e-70 0.9938
1. PBF A9R4U4 Deoxyribose-phosphate aldolase 0.00e+00 5.66e-41 7.84e-52 0.9826
1. PBF A8AX59 Deoxyribose-phosphate aldolase 0.00e+00 1.35e-49 5.52e-84 0.9929
1. PBF Q3A247 Deoxyribose-phosphate aldolase 0.00e+00 2.06e-38 1.46e-51 0.9893
1. PBF B7HMQ9 Deoxyribose-phosphate aldolase 0.00e+00 1.09e-43 9.71e-74 0.9735
1. PBF Q0W6M2 Deoxyribose-phosphate aldolase 0.00e+00 7.38e-46 1.11e-68 0.9658
1. PBF Q8Z0U3 Deoxyribose-phosphate aldolase 0.00e+00 4.65e-15 1.69e-20 0.9062
1. PBF A4WHP7 Deoxyribose-phosphate aldolase 0.00e+00 3.94e-15 5.17e-23 0.8825
1. PBF B1KCV0 Deoxyribose-phosphate aldolase 0.00e+00 4.31e-41 1.57e-50 0.9802
1. PBF A7GNS8 Deoxyribose-phosphate aldolase 0.00e+00 3.69e-45 2.11e-74 0.9767
1. PBF B1YB76 Deoxyribose-phosphate aldolase 0.00e+00 2.50e-14 2.64e-23 0.8836
1. PBF B1YKT7 Deoxyribose-phosphate aldolase 0.00e+00 3.88e-42 7.31e-76 0.9848
1. PBF A0AKA1 Deoxyribose-phosphate aldolase 0.00e+00 8.01e-47 5.56e-73 0.9706
1. PBF Q6D3R0 Deoxyribose-phosphate aldolase 0.00e+00 1.07e-46 2.93e-60 0.9876
1. PBF B2KBN0 Deoxyribose-phosphate aldolase 0.00e+00 1.28e-37 6.28e-70 0.9816
1. PBF Q7UPT7 Deoxyribose-phosphate aldolase 0.00e+00 3.24e-25 1.47e-42 0.936
1. PBF A6VQW4 Deoxyribose-phosphate aldolase 0.00e+00 1.63e-42 1.66e-67 0.988
1. PBF Q6GKG7 Deoxyribose-phosphate aldolase 1 0.00e+00 1.27e-47 3.16e-73 0.9935
1. PBF Q24SU9 Deoxyribose-phosphate aldolase 0.00e+00 6.74e-35 8.16e-63 0.9811
1. PBF B9E4U5 Deoxyribose-phosphate aldolase 0.00e+00 3.13e-42 2.62e-75 0.9889
1. PBF B5IEU6 Deoxyribose-phosphate aldolase 0.00e+00 1.56e-47 3.16e-74 0.9693
1. PBF Q99Y51 Deoxyribose-phosphate aldolase 0.00e+00 1.98e-49 5.04e-56 0.9621
1. PBF B8E6P4 Deoxyribose-phosphate aldolase 0.00e+00 1.06e-16 2.15e-19 0.9184
1. PBF B5ZCA0 Deoxyribose-phosphate aldolase 0.00e+00 2.90e-44 1.16e-61 0.988
1. PBF Q2YUU4 Deoxyribose-phosphate aldolase 1 0.00e+00 1.80e-47 1.61e-72 0.9921
1. PBF A0PVY3 Deoxyribose-phosphate aldolase 0.00e+00 1.30e-28 7.83e-46 0.9394
1. PBF B5Z4R3 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.903
1. PBF Q8Y5R1 Deoxyribose-phosphate aldolase 0.00e+00 2.65e-46 6.77e-72 0.9718
1. PBF B2K9V8 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-42 6.04e-52 0.9745
1. PBF C5C9E5 Deoxyribose-phosphate aldolase 0.00e+00 1.45e-31 8.93e-55 0.9457
1. PBF Q3IQA5 Deoxyribose-phosphate aldolase 0.00e+00 5.94e-33 3.30e-31 0.9278
1. PBF Q839J1 Deoxyribose-phosphate aldolase 0.00e+00 8.64e-51 3.44e-72 0.9848
1. PBF P0DA62 Deoxyribose-phosphate aldolase 0.00e+00 2.25e-49 7.70e-56 0.9562
1. PBF A4TN86 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-42 6.04e-52 0.9762
1. PBF B0S0N1 Deoxyribose-phosphate aldolase 0.00e+00 2.46e-45 2.65e-83 0.994
1. PBF Q1CAE0 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-42 6.04e-52 0.9825
1. PBF B1KRP8 Deoxyribose-phosphate aldolase 0.00e+00 9.50e-16 2.89e-19 0.9075
1. PBF Q8CNH7 Deoxyribose-phosphate aldolase 0.00e+00 1.45e-45 1.75e-72 0.9934
1. PBF A1RH87 Deoxyribose-phosphate aldolase 0.00e+00 7.70e-17 3.96e-19 0.9172
1. PBF B1HTK8 Deoxyribose-phosphate aldolase 0.00e+00 1.03e-46 1.01e-75 0.9929
1. PBF Q0RRG0 Deoxyribose-phosphate aldolase 0.00e+00 6.48e-34 8.37e-48 0.9345
1. PBF Q65WA1 Deoxyribose-phosphate aldolase 0.00e+00 1.14e-46 5.04e-73 0.9896
1. PBF Q9HKB7 Deoxyribose-phosphate aldolase 0.00e+00 6.84e-13 9.63e-29 0.8684
1. PBF Q66EW0 Deoxyribose-phosphate aldolase 2 0.00e+00 5.66e-16 8.54e-18 0.8939
1. PBF A5IM24 Deoxyribose-phosphate aldolase 0.00e+00 4.20e-22 7.14e-62 0.9915
1. PBF Q6A655 Deoxyribose-phosphate aldolase 2 0.00e+00 2.36e-41 7.64e-46 0.9382
1. PBF Q9X1P5 Deoxyribose-phosphate aldolase 0.00e+00 1.18e-21 8.87e-62 0.9929
1. PBF Q9CFM7 Deoxyribose-phosphate aldolase 0.00e+00 9.02e-51 2.04e-73 0.9899
1. PBF B6ENG3 Deoxyribose-phosphate aldolase 0.00e+00 3.50e-14 2.03e-19 0.9066
1. PBF Q39NL8 Deoxyribose-phosphate aldolase 0.00e+00 4.71e-39 2.82e-60 0.9727
1. PBF Q38XI2 Deoxyribose-phosphate aldolase 0.00e+00 4.23e-41 1.07e-70 0.9807
1. PBF B2TZR4 Deoxyribose-phosphate aldolase 0.00e+00 1.18e-14 2.59e-19 0.9001
1. PBF Q5YP36 Deoxyribose-phosphate aldolase 0.00e+00 8.02e-33 7.84e-42 0.8947
1. PBF Q8DQC4 Deoxyribose-phosphate aldolase 0.00e+00 2.89e-45 2.52e-79 0.993
1. PBF Q7MP37 Deoxyribose-phosphate aldolase 1 0.00e+00 8.88e-48 3.14e-67 0.9675
1. PBF Q8UJ09 Deoxyribose-phosphate aldolase 0.00e+00 2.87e-18 1.23e-18 0.9005
1. PBF A1S474 Deoxyribose-phosphate aldolase 0.00e+00 3.82e-18 3.86e-19 0.9031
1. PBF Q9Y948 Deoxyribose-phosphate aldolase 0.00e+00 2.57e-22 1.98e-29 0.9302
1. PBF B7NW61 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8981
1. PBF Q8DJZ1 Deoxyribose-phosphate aldolase 0.00e+00 1.55e-31 4.07e-53 0.9779
1. PBF A1AJU8 Deoxyribose-phosphate aldolase 0.00e+00 4.95e-15 5.66e-20 0.8947
1. PBF B1LEI6 Deoxyribose-phosphate aldolase 0.00e+00 1.07e-14 5.21e-20 0.9116
1. PBF Q8ZIQ4 Deoxyribose-phosphate aldolase 2 0.00e+00 5.66e-16 8.54e-18 0.8937
1. PBF Q1BVA7 Deoxyribose-phosphate aldolase 0.00e+00 4.31e-41 1.57e-50 0.9802
1. PBF Q0SRC4 Deoxyribose-phosphate aldolase 0.00e+00 1.42e-51 1.21e-76 0.9868
1. PBF Q6MGR8 Deoxyribose-phosphate aldolase 0.00e+00 4.19e-48 4.94e-74 0.9924
1. PBF Q87M22 Deoxyribose-phosphate aldolase 0.00e+00 2.77e-11 1.07e-22 0.9033
1. PBF A8A8B0 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.903
1. PBF P61108 Deoxyribose-phosphate aldolase 1 0.00e+00 2.17e-47 1.29e-72 0.9922
1. PBF Q3JYQ4 Deoxyribose-phosphate aldolase 0.00e+00 1.64e-49 4.77e-56 0.9533
1. PBF C4L415 Deoxyribose-phosphate aldolase 0.00e+00 7.08e-47 1.81e-81 0.9817
1. PBF B4EWA4 Deoxyribose-phosphate aldolase 0.00e+00 2.72e-15 8.91e-18 0.8914
1. PBF Q2SRA7 Deoxyribose-phosphate aldolase 0.00e+00 2.90e-67 1.16e-153 0.9991
1. PBF C5BHJ2 Deoxyribose-phosphate aldolase 0.00e+00 1.91e-16 4.03e-21 0.9032
1. PBF P9WP02 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 0.938
1. PBF Q5FLZ2 Deoxyribose-phosphate aldolase 0.00e+00 1.03e-33 4.80e-60 0.9792
1. PBF P0A6L1 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.8961
1. PBF P61084 Deoxyribose-phosphate aldolase 2 0.00e+00 1.53e-43 1.30e-69 0.9935
1. PBF Q71Y27 Deoxyribose-phosphate aldolase 0.00e+00 9.19e-45 1.11e-72 0.9687
1. PBF O66540 Deoxyribose-phosphate aldolase 0.00e+00 3.15e-35 2.22e-48 0.9716
1. PBF Q7VMS9 Deoxyribose-phosphate aldolase 0.00e+00 1.24e-13 1.73e-20 0.9074
1. PBF B8ZNP4 Deoxyribose-phosphate aldolase 0.00e+00 2.95e-45 3.73e-80 0.9922
1. PBF C4ZT63 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 0.899
1. PBF B7LNS1 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8939
1. PBF C0ZUQ6 Deoxyribose-phosphate aldolase 0.00e+00 8.77e-34 7.87e-47 0.894
1. PBF P47296 Deoxyribose-phosphate aldolase 0.00e+00 1.53e-41 1.55e-51 0.9816
1. PBF Q48RH2 Deoxyribose-phosphate aldolase 0.00e+00 3.58e-49 5.99e-57 0.9635
1. PBF Q8XIR2 Deoxyribose-phosphate aldolase 0.00e+00 3.25e-52 1.85e-76 0.9868
1. PBF B9IXA5 Deoxyribose-phosphate aldolase 0.00e+00 2.57e-44 8.33e-74 0.9883
1. PBF C1EQH0 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9725
1. PBF Q81RZ3 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9728
1. PBF Q7N932 Deoxyribose-phosphate aldolase 0.00e+00 1.79e-14 1.38e-17 0.8955
1. PBF P57937 Deoxyribose-phosphate aldolase 0.00e+00 5.41e-47 2.92e-66 0.9752
1. PBF Q8DWZ0 Deoxyribose-phosphate aldolase 0.00e+00 1.64e-49 4.77e-56 0.9623
1. PBF Q8EMT9 Deoxyribose-phosphate aldolase 2 0.00e+00 2.34e-46 8.93e-65 0.9782
1. PBF B1AJM6 Deoxyribose-phosphate aldolase 0.00e+00 1.42e-42 1.62e-55 0.9868
1. PBF Q73QJ5 Deoxyribose-phosphate aldolase 0.00e+00 2.11e-40 6.26e-68 0.9774
1. PBF A8MH18 Deoxyribose-phosphate aldolase 0.00e+00 1.52e-46 4.58e-67 0.9881
1. PBF Q73SV2 Deoxyribose-phosphate aldolase 0.00e+00 7.61e-30 1.45e-42 0.9447
1. PBF P0CH94 Deoxyribose-phosphate aldolase 0.00e+00 1.09e-20 3.77e-58 0.9412
1. PBF B5Y7V3 Deoxyribose-phosphate aldolase 0.00e+00 5.49e-43 2.33e-61 0.9932
1. PBF Q8EHK4 Deoxyribose-phosphate aldolase 0.00e+00 8.22e-17 9.81e-20 0.9092
1. PBF B8F671 Deoxyribose-phosphate aldolase 0.00e+00 3.70e-15 2.43e-19 0.9072
1. PBF Q92A19 Deoxyribose-phosphate aldolase 0.00e+00 1.49e-46 2.89e-73 0.9675
1. PBF Q92MQ3 Deoxyribose-phosphate aldolase 0.00e+00 6.75e-24 4.00e-29 0.9522
1. PBF B7HIT0 Deoxyribose-phosphate aldolase 0.00e+00 4.61e-44 1.13e-72 0.9884
1. PBF Q6A8F1 Deoxyribose-phosphate aldolase 1 0.00e+00 1.12e-42 2.51e-65 0.9918
1. PBF Q8ZXK7 Deoxyribose-phosphate aldolase 0.00e+00 7.43e-16 6.17e-22 0.8832
1. PBF B4U2S5 Deoxyribose-phosphate aldolase 0.00e+00 1.74e-53 4.59e-80 0.992
1. PBF Q5HE63 Deoxyribose-phosphate aldolase 2 0.00e+00 1.41e-44 7.71e-70 0.9935
1. PBF Q7NAQ0 Deoxyribose-phosphate aldolase 0.00e+00 5.55e-41 1.23e-54 0.985
1. PBF A7GDP8 Deoxyribose-phosphate aldolase 0.00e+00 1.26e-38 2.11e-73 0.9901
1. PBF B5XID8 Deoxyribose-phosphate aldolase 0.00e+00 1.98e-49 5.04e-56 0.9632
1. PBF P63932 Deoxyribose-phosphate aldolase 0.00e+00 2.25e-49 7.70e-56 0.9563
1. PBF B4ENZ2 Deoxyribose-phosphate aldolase 0.00e+00 2.81e-41 4.47e-52 0.9809
1. PBF Q877I0 Deoxyribose-phosphate aldolase 0.00e+00 4.88e-47 7.59e-84 0.9516
1. PBF Q7NRS9 Deoxyribose-phosphate aldolase 0.00e+00 3.86e-19 1.95e-19 0.9154
1. PBF Q8EWT4 Deoxyribose-phosphate aldolase 0.00e+00 7.84e-43 1.38e-62 0.9684
1. PBF A0KU07 Deoxyribose-phosphate aldolase 0.00e+00 1.31e-16 1.31e-20 0.919
1. PBF Q3MF82 Deoxyribose-phosphate aldolase 0.00e+00 1.56e-41 1.08e-51 0.9717
1. PBF Q89ZF2 Deoxyribose-phosphate aldolase 0.00e+00 1.10e-39 7.42e-58 0.9761
1. PBF Q0HLF0 Deoxyribose-phosphate aldolase 0.00e+00 9.64e-17 5.55e-21 0.9189
1. PBF Q83P02 Deoxyribose-phosphate aldolase 0.00e+00 1.66e-14 9.44e-21 0.8994
1. PBF A7MUW7 Deoxyribose-phosphate aldolase 0.00e+00 3.98e-11 2.02e-23 0.9058
1. PBF C5D4T6 Deoxyribose-phosphate aldolase 0.00e+00 7.03e-49 5.03e-78 0.9879
1. PBF B7K8P2 Deoxyribose-phosphate aldolase 0.00e+00 8.51e-41 5.32e-46 0.9435
1. PBF Q49Z84 Deoxyribose-phosphate aldolase 0.00e+00 1.22e-48 3.33e-70 0.9934
1. PBF A5UCY8 Deoxyribose-phosphate aldolase 0.00e+00 1.14e-48 1.85e-72 0.9773
1. PBF B8DBT6 Deoxyribose-phosphate aldolase 0.00e+00 1.62e-47 1.57e-72 0.9725
1. PBF B2V184 Deoxyribose-phosphate aldolase 0.00e+00 4.49e-47 1.94e-58 0.9583
1. PBF Q2RRZ2 Deoxyribose-phosphate aldolase 0.00e+00 1.99e-38 1.64e-65 0.9906
1. PBF Q0TNQ8 Deoxyribose-phosphate aldolase 0.00e+00 6.50e-52 3.67e-76 0.9868
1. PBF B1JRK6 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-42 6.04e-52 0.9822
1. PBF Q67RZ3 Deoxyribose-phosphate aldolase 0.00e+00 3.88e-42 4.97e-68 0.9844
1. PBF Q6G7H3 Deoxyribose-phosphate aldolase 2 0.00e+00 2.28e-42 4.01e-70 0.9919
1. PBF A8G9H6 Deoxyribose-phosphate aldolase 0.00e+00 2.83e-15 5.27e-20 0.8935
1. PBF A7FU73 Deoxyribose-phosphate aldolase 0.00e+00 5.66e-41 1.76e-72 0.9899
1. PBF Q8RB49 Deoxyribose-phosphate aldolase 0.00e+00 2.62e-36 7.44e-74 0.9756
1. PBF Q1CG96 Deoxyribose-phosphate aldolase 0.00e+00 3.07e-42 6.04e-52 0.9761
1. PBF B2S2L2 Deoxyribose-phosphate aldolase 0.00e+00 2.15e-37 5.53e-50 0.962
1. PBF Q6MSE7 Deoxyribose-phosphate aldolase 0.00e+00 6.01e-07 4.14e-120 0.9935
1. PBF Q8EPW8 Deoxyribose-phosphate aldolase 1 0.00e+00 8.14e-45 5.48e-69 0.9857
1. PBF Q18C22 Deoxyribose-phosphate aldolase 0.00e+00 2.72e-49 1.61e-63 0.9762
1. PBF Q8FSJ0 Deoxyribose-phosphate aldolase 0.00e+00 2.73e-33 2.45e-35 0.9293
1. PBF A1KFV2 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 0.9327
1. PBF C0MG52 Deoxyribose-phosphate aldolase 0.00e+00 1.74e-53 4.59e-80 0.9921
1. PBF Q4QLH8 Deoxyribose-phosphate aldolase 0.00e+00 3.66e-49 8.89e-73 0.9769
1. PBF A7ZAF1 Deoxyribose-phosphate aldolase 0.00e+00 1.30e-40 4.41e-70 0.964
1. PBF B1XI10 Deoxyribose-phosphate aldolase 0.00e+00 5.00e-46 4.86e-50 0.9695
1. PBF A5F5S6 Deoxyribose-phosphate aldolase 0.00e+00 2.98e-14 7.89e-20 0.9021
1. PBF B7LXU3 Deoxyribose-phosphate aldolase 0.00e+00 1.26e-14 5.21e-20 0.8939
1. PBF B1IS38 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.8947
1. PBF Q6GCY6 Deoxyribose-phosphate aldolase 1 0.00e+00 1.46e-46 8.90e-72 0.9928
1. PBF Q4L819 Deoxyribose-phosphate aldolase 0.00e+00 1.77e-42 4.24e-71 0.9924
1. PBF C3P786 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9884
1. PBF Q1J9Z9 Deoxyribose-phosphate aldolase 0.00e+00 1.07e-48 2.68e-55 0.9621
1. PBF B7VJF8 Deoxyribose-phosphate aldolase 0.00e+00 1.53e-13 1.07e-21 0.9037
1. PBF P99174 Deoxyribose-phosphate aldolase 2 0.00e+00 1.53e-43 1.30e-69 0.9937
1. PBF Q31SV8 Deoxyribose-phosphate aldolase 0.00e+00 1.18e-14 2.59e-19 0.8997
1. PBF A0KPE4 Deoxyribose-phosphate aldolase 0.00e+00 9.55e-15 6.47e-19 0.9275
1. PBF A5TZK6 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 0.9372
1. PBF Q8DU34 Deoxyribose-phosphate aldolase 0.00e+00 1.90e-49 5.44e-70 0.9909
1. PBF Q0I2N7 Deoxyribose-phosphate aldolase 0.00e+00 1.69e-47 1.29e-67 0.9886
1. PBF Q18FF3 Deoxyribose-phosphate aldolase 0.00e+00 4.36e-37 1.76e-40 0.9281
1. PBF C3PI20 Deoxyribose-phosphate aldolase 0.00e+00 2.79e-37 4.78e-54 0.9097
1. PBF Q9CB45 Deoxyribose-phosphate aldolase 0.00e+00 8.20e-29 1.98e-47 0.9487
1. PBF Q98QP7 Deoxyribose-phosphate aldolase 0.00e+00 2.45e-41 4.73e-74 0.9884
1. PBF Q3YU12 Deoxyribose-phosphate aldolase 0.00e+00 9.43e-15 5.05e-20 0.9032
1. PBF P44430 Deoxyribose-phosphate aldolase 0.00e+00 3.19e-48 1.02e-71 0.9787
1. PBF B9LR64 Deoxyribose-phosphate aldolase 0.00e+00 3.86e-34 2.46e-41 0.9298
1. PBF Q5HJN0 Deoxyribose-phosphate aldolase 1 0.00e+00 2.17e-47 1.29e-72 0.9922
1. PBF Q8YPM0 Deoxyribose-phosphate aldolase 0.00e+00 2.86e-41 3.44e-51 0.9725
1. PBF B7JJK4 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9885
1. PBF Q4A9F7 Deoxyribose-phosphate aldolase 0.00e+00 2.42e-40 7.90e-60 0.9855
1. PBF C5A366 Deoxyribose-phosphate aldolase 0.00e+00 2.15e-46 6.19e-86 0.9712
1. PBF Q63CR9 Deoxyribose-phosphate aldolase 0.00e+00 3.08e-43 4.57e-73 0.9886
1. PBF A1JM38 Deoxyribose-phosphate aldolase 0.00e+00 8.35e-47 9.30e-59 0.9814
1. PBF B0KA53 Deoxyribose-phosphate aldolase 0.00e+00 7.24e-43 6.13e-71 0.9751
1. PBF B3PM95 Deoxyribose-phosphate aldolase 0.00e+00 3.93e-44 1.30e-70 0.9927
1. PBF A5N0Z3 Deoxyribose-phosphate aldolase 0.00e+00 3.13e-42 2.62e-75 0.9878
1. PBF P0DA63 Deoxyribose-phosphate aldolase 0.00e+00 2.25e-49 7.70e-56 0.955
1. PBF A2RK45 Deoxyribose-phosphate aldolase 0.00e+00 9.62e-51 2.43e-73 0.9902
1. PBF Q8NYR1 Deoxyribose-phosphate aldolase 1 0.00e+00 1.46e-46 8.90e-72 0.9933
1. PBF A1RU26 Deoxyribose-phosphate aldolase 0.00e+00 2.24e-16 1.59e-23 0.8844
1. PBF P99102 Deoxyribose-phosphate aldolase 1 0.00e+00 2.17e-47 1.29e-72 0.9922
1. PBF B2VH50 Deoxyribose-phosphate aldolase 0.00e+00 8.12e-17 4.80e-19 0.901
1. PBF Q9KD67 Deoxyribose-phosphate aldolase 0.00e+00 1.55e-40 2.29e-77 0.9868
1. PBF Q9KPL7 Deoxyribose-phosphate aldolase 0.00e+00 2.98e-14 7.89e-20 0.9026
1. PBF B8FUK9 Deoxyribose-phosphate aldolase 0.00e+00 6.86e-35 2.36e-63 0.9812
1. PBF A4W698 Deoxyribose-phosphate aldolase 0.00e+00 1.50e-14 1.32e-20 0.9064
1. PBF Q88Z64 Deoxyribose-phosphate aldolase 0.00e+00 4.13e-37 6.28e-69 0.9817
1. PBF B0R6I6 Deoxyribose-phosphate aldolase 0.00e+00 5.16e-21 1.05e-38 0.9402
1. PBF A8H728 Deoxyribose-phosphate aldolase 0.00e+00 2.95e-16 6.33e-20 0.9022
1. PBF Q8ZGH4 Deoxyribose-phosphate aldolase 1 0.00e+00 3.07e-42 6.04e-52 0.9755
1. PBF A0QLL2 Deoxyribose-phosphate aldolase 0.00e+00 4.58e-29 5.60e-43 0.9446
1. PBF C1AKF6 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 0.9327
2. PF Q5XDL5 Copper homeostasis protein CutC 3.22e-11 3.64e-05 NA 0.6977
2. PF B2U6Y7 Tryptophan synthase alpha chain 9.65e-05 8.21e-03 NA 0.5955
2. PF A8A0N9 3-dehydroquinate dehydratase 2.95e-09 4.42e-04 NA 0.6195
2. PF B2U2J7 3-dehydroquinate dehydratase 3.01e-09 2.19e-03 NA 0.6203
2. PF Q83RA1 3-dehydroquinate dehydratase 3.02e-09 2.17e-03 NA 0.6206
2. PF Q1RBA3 3-dehydroquinate dehydratase 3.28e-09 9.01e-04 NA 0.619
2. PF B5F7D7 3-dehydroquinate dehydratase 4.23e-09 1.65e-02 NA 0.5962
2. PF Q32GE2 3-dehydroquinate dehydratase 2.89e-09 2.71e-03 NA 0.6211
2. PF B7M0P9 3-dehydroquinate dehydratase 3.13e-09 6.16e-04 NA 0.6186
2. PF B6IBD3 3-dehydroquinate dehydratase 3.08e-09 5.35e-04 NA 0.5857
2. PF Q0THD6 3-dehydroquinate dehydratase 3.25e-09 5.22e-04 NA 0.6161
2. PF Q9A733 Triosephosphate isomerase 2.79e-05 3.83e-02 NA 0.5994
2. PF B2UV41 Tryptophan synthase alpha chain 7.18e-05 2.34e-02 NA 0.5836
2. PF Q8J308 Fructose-bisphosphate aldolase class 1 1.56e-09 3.80e-04 NA 0.632
2. PF Q321F0 3-dehydroquinate dehydratase 3.29e-09 1.14e-03 NA 0.5863
2. PF B6EK72 Copper homeostasis protein CutC 3.69e-11 2.06e-02 NA 0.6734
2. PF B8GQE5 Tryptophan synthase alpha chain 1.03e-05 3.43e-02 NA 0.5676
2. PF Q8X5X7 3-dehydroquinate dehydratase 2.91e-09 8.58e-04 NA 0.6207
2. PF P58315 Fructose-bisphosphate aldolase class 1 4.56e-10 1.33e-06 NA 0.5952
2. PF Q161I8 Tryptophan synthase alpha chain 1.01e-05 1.02e-02 NA 0.5522
2. PF Q830V2 Copper homeostasis protein CutC 4.98e-13 2.94e-03 NA 0.7204
2. PF B1IQ63 3-dehydroquinate dehydratase 2.98e-09 4.42e-04 NA 0.6195
2. PF A5UNQ5 (5-formylfuran-3-yl)methyl phosphate synthase 4.00e-12 4.43e-02 NA 0.6315
2. PF Q7NUD9 Tryptophan synthase alpha chain 6.65e-04 5.74e-03 NA 0.5523
2. PF Q8FH42 3-dehydroquinate dehydratase 3.16e-09 9.01e-04 NA 0.619
2. PF A8MJ87 3-dehydroquinate dehydratase 5.17e-09 6.31e-03 NA 0.597
2. PF B7US32 3-dehydroquinate dehydratase 3.10e-09 9.01e-04 NA 0.6192
2. PF B5EK17 Tryptophan synthase alpha chain 1.76e-05 9.58e-03 NA 0.5667
2. PF A7ZMF8 3-dehydroquinate dehydratase 3.06e-09 1.06e-03 NA 0.6204
2. PF Q6AIT8 3-dehydroquinate dehydratase 5.37e-06 3.13e-02 NA 0.5825
2. PF B7J4S8 Tryptophan synthase alpha chain 2.09e-05 9.58e-03 NA 0.5611
2. PF Q3Z247 3-dehydroquinate dehydratase 3.11e-09 4.38e-04 NA 0.6181
2. PF Q9YG90 Probable fructose-bisphosphate aldolase class 1 3.12e-09 1.93e-04 NA 0.6133
2. PF P24670 3-dehydroquinate dehydratase 3.38e-09 8.47e-03 NA 0.5881
2. PF B7NTU3 3-dehydroquinate dehydratase 3.09e-09 1.22e-03 NA 0.6191
2. PF O57840 Fructose-bisphosphate aldolase class 1 1.23e-09 7.31e-05 NA 0.603
2. PF Q47HQ4 Tryptophan synthase alpha chain 1.23e-05 1.87e-02 NA 0.5862
2. PF Q9V2I6 Fructose-bisphosphate aldolase class 1 2.41e-09 1.64e-05 NA 0.6036
2. PF B5YPY0 3-dehydroquinate dehydratase 3.06e-09 8.58e-04 NA 0.6204
2. PF Q8XXY2 Tryptophan synthase alpha chain 1.46e-04 8.47e-03 NA 0.5797
2. PF Q49W41 3-dehydroquinate dehydratase 1.73e-08 5.74e-03 NA 0.5973
2. PF A1ABN0 3-dehydroquinate dehydratase 3.22e-09 9.01e-04 NA 0.6188
2. PF Q4L4R1 3-dehydroquinate dehydratase 2.88e-09 2.14e-02 NA 0.5891
2. PF P58314 Fructose-bisphosphate aldolase class 1 2.70e-09 3.84e-05 NA 0.6147
2. PF B7MAQ3 3-dehydroquinate dehydratase 2.92e-09 9.01e-04 NA 0.6194
2. PF B1XG01 3-dehydroquinate dehydratase 2.99e-09 1.42e-03 NA 0.6191
2. PF B7L5P5 3-dehydroquinate dehydratase 2.99e-09 4.27e-04 NA 0.6208
4. PB P9WP03 Deoxyribose-phosphate aldolase 0.00e+00 8.79e-25 1.19e-38 NA
4. PB Q91YP3 Deoxyribose-phosphate aldolase 0.00e+00 2.94e-05 9.99e-13 NA
4. PB P0A6L0 Deoxyribose-phosphate aldolase 0.00e+00 1.81e-14 1.78e-19 NA
4. PB Q9Y315 Deoxyribose-phosphate aldolase 0.00e+00 6.08e-05 3.22e-15 NA
4. PB Q19264 Putative deoxyribose-phosphate aldolase 0.00e+00 3.73e-03 4.98e-16 NA
5. P Q97EF3 Indole-3-glycerol phosphate synthase 2.63e-09 1.57e-04 NA NA
5. P C1A0L8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.64e-09 7.20e-03 NA NA
5. P C1EV72 Heptaprenylglyceryl phosphate synthase 4.58e-07 2.38e-04 NA NA
5. P Q3K5V4 Indole-3-glycerol phosphate synthase 5.15e-09 2.17e-05 NA NA
5. P B9IU36 Indole-3-glycerol phosphate synthase 1.31e-09 1.38e-04 NA NA
5. P A6TEN5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.48e-10 9.43e-08 NA NA
5. P P9WG73 Thiazole synthase 5.99e-10 9.00e-03 NA NA
5. P Q3SWF0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.87e-08 4.91e-03 NA NA
5. P Q8NMD0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.72e-10 5.87e-05 NA NA
5. P Q8U213 Geranylgeranylglyceryl phosphate synthase 2.47e-10 2.71e-05 NA NA
5. P Q2NYD7 Indole-3-glycerol phosphate synthase 7.48e-09 1.49e-04 NA NA
5. P B0BSI0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.87e-10 4.83e-03 NA NA
5. P B1JUU5 Indole-3-glycerol phosphate synthase 2.05e-09 7.38e-05 NA NA
5. P A2RCG2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.70e-10 5.31e-04 NA NA
5. P Q7W387 Indole-3-glycerol phosphate synthase 3.04e-09 4.16e-03 NA NA
5. P Q21CK4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.68e-08 3.21e-02 NA NA
5. P A0R904 Heptaprenylglyceryl phosphate synthase 4.42e-07 2.38e-04 NA NA
5. P B2ISS3 Indole-3-glycerol phosphate synthase 1.07e-09 5.07e-06 NA NA
5. P Q8PXE7 3-dehydroquinate dehydratase 1.07e-08 3.63e-02 NA NA
5. P Q2FJ70 3-hexulose-6-phosphate synthase 1.41e-12 2.11e-02 NA NA
5. P O30128 Putative 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 2 1.22e-09 6.45e-06 NA NA
5. P Q2YVA8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.76e-10 5.40e-04 NA NA
5. P Q3IDK9 Pyridoxine 5'-phosphate synthase 3.63e-08 1.91e-02 NA NA
5. P Q88QR6 Indole-3-glycerol phosphate synthase 5.12e-09 1.86e-04 NA NA
5. P P0DC68 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.68e-10 6.27e-04 NA NA
5. P P05325 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.04e-09 1.13e-02 NA NA
5. P B2K948 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.81e-10 2.21e-04 NA NA
5. P P26938 Indole-3-glycerol phosphate synthase 3.33e-09 1.13e-04 NA NA
5. P Q9PDN8 Copper homeostasis protein CutC 4.65e-11 1.38e-03 NA NA
5. P B9M0L9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.32e-08 6.94e-05 NA NA
5. P C3LAW0 Indole-3-glycerol phosphate synthase 1.29e-09 6.14e-05 NA NA
5. P Q31HP0 Pyridoxine 5'-phosphate synthase 3.90e-08 1.31e-02 NA NA
5. P Q31W92 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.25e-10 4.00e-07 NA NA
5. P A6U9C5 Indole-3-glycerol phosphate synthase 5.97e-09 4.63e-05 NA NA
5. P A5ISQ2 Indole-3-glycerol phosphate synthase 2.19e-09 1.75e-04 NA NA
5. P O68814 Indole-3-glycerol phosphate synthase 1 1.15e-10 2.74e-05 NA NA
5. P Q3SRJ3 Indole-3-glycerol phosphate synthase 3.68e-09 1.56e-04 NA NA
5. P Q48C80 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.44e-09 1.63e-02 NA NA
5. P A5U2W7 Indole-3-glycerol phosphate synthase 4.28e-10 3.60e-06 NA NA
5. P P0A633 Indole-3-glycerol phosphate synthase 4.14e-10 3.60e-06 NA NA
5. P A0PPN4 Triosephosphate isomerase 4.53e-05 2.33e-02 NA NA
5. P B3QZD6 Indole-3-glycerol phosphate synthase 1.23e-09 2.67e-05 NA NA
5. P Q2JK82 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.12e-09 3.91e-02 NA NA
5. P B1L6Q8 Geranylgeranylglyceryl phosphate synthase 3.35e-10 4.38e-04 NA NA
5. P Q9HJH3 Geranylgeranylglyceryl phosphate synthase 7.45e-10 1.06e-02 NA NA
5. P P62356 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.33e-10 1.71e-02 NA NA
5. P B7HSW3 Heptaprenylglyceryl phosphate synthase 4.52e-07 2.43e-04 NA NA
5. P A8YZE2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.80e-10 6.22e-04 NA NA
5. P Q5FHH4 Pyridoxine 5'-phosphate synthase 1.99e-08 1.56e-02 NA NA
5. P Q4L7M1 Heptaprenylglyceryl phosphate synthase 6.20e-07 1.96e-02 NA NA
5. P Q9YGB5 Indole-3-glycerol phosphate synthase 8.58e-10 4.65e-03 NA NA
5. P Q81ZG3 Heptaprenylglyceryl phosphate synthase 3.75e-07 2.01e-04 NA NA
5. P P0A761 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.23e-10 4.00e-07 NA NA
5. P O30009 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1 6.73e-09 2.50e-07 NA NA
5. P A4WUS7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.27e-09 2.90e-04 NA NA
5. P Q8FY08 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.73e-08 3.26e-03 NA NA
5. P Q083K0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.73e-10 1.87e-02 NA NA
5. P A7I773 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.41e-09 8.30e-04 NA NA
5. P Q2G9L9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.63e-08 4.43e-03 NA NA
5. P Q88WI2 Indole-3-glycerol phosphate synthase 4.90e-10 1.78e-05 NA NA
5. P Q6GDD0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-08 3.70e-03 NA NA
5. P A6X0L0 Indole-3-glycerol phosphate synthase 5.35e-09 2.97e-05 NA NA
5. P A9M9R9 Imidazole glycerol phosphate synthase subunit HisF 3.35e-09 4.88e-02 NA NA
5. P A3MUC6 Triosephosphate isomerase 2.09e-10 1.36e-05 NA NA
5. P A0RNN3 Indole-3-glycerol phosphate synthase 5.09e-10 1.02e-04 NA NA
5. P Q7VF28 Thiazole synthase 1.73e-10 4.00e-02 NA NA
5. P Q7MLS2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.17e-09 7.90e-03 NA NA
5. P A0AG16 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.38e-09 2.94e-03 NA NA
5. P A6VJZ0 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.84e-09 5.63e-04 NA NA
5. P A6URI9 Geranylgeranylglyceryl phosphate synthase 1.90e-04 7.14e-03 NA NA
5. P Q9KCB2 Indole-3-glycerol phosphate synthase 5.26e-09 2.87e-06 NA NA
5. P B8DHB2 Indole-3-glycerol phosphate synthase 1.91e-09 5.12e-06 NA NA
5. P Q1B7H6 Indole-3-glycerol phosphate synthase 5.14e-10 5.41e-06 NA NA
5. P A3QF20 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.20e-10 3.94e-03 NA NA
5. P Q87F88 Pyridoxine 5'-phosphate synthase 5.42e-07 1.96e-02 NA NA
5. P Q5HG46 Tryptophan synthase alpha chain 6.93e-05 3.40e-02 NA NA
5. P C1L0J3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.32e-09 3.97e-02 NA NA
5. P A9VRN4 Thiamine-phosphate synthase 2.55e-09 2.94e-03 NA NA
5. P Q72EU7 Tryptophan synthase alpha chain 3.47e-04 4.09e-02 NA NA
5. P A4WDW4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.93e-11 9.58e-06 NA NA
5. P Q2SMB3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.30e-08 3.74e-02 NA NA
5. P A1VTG7 Indole-3-glycerol phosphate synthase 3.15e-09 1.12e-03 NA NA
5. P A8FKS2 Indole-3-glycerol phosphate synthase 3.63e-10 2.89e-03 NA NA
5. P A5N7N8 Indole-3-glycerol phosphate synthase 9.72e-09 6.75e-04 NA NA
5. P Q8XK02 Thiazole synthase 4.81e-10 1.90e-02 NA NA
5. P B4RBX5 Indole-3-glycerol phosphate synthase 6.90e-10 4.59e-05 NA NA
5. P Q97Q95 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 7.26e-10 4.80e-06 NA NA
5. P Q02584 Indole-3-glycerol phosphate synthase 3.96e-09 1.49e-04 NA NA
5. P Q58114 Uncharacterized protein MJ0703 3.18e-07 1.41e-04 NA NA
5. P Q8NKN9 Triosephosphate isomerase 1.68e-10 1.35e-07 NA NA
5. P A1T8L2 Triosephosphate isomerase 5.17e-05 4.30e-03 NA NA
5. P Q57700 Orotidine 5'-phosphate decarboxylase 6.11e-09 6.11e-03 NA NA
5. P A9VJW0 Indole-3-glycerol phosphate synthase 1.30e-09 1.41e-04 NA NA
5. P Q9JSN4 Indole-3-glycerol phosphate synthase 4.76e-09 1.91e-03 NA NA
5. P B9JXN7 Pyridoxine 5'-phosphate synthase 1.13e-08 5.88e-03 NA NA
5. P A1SL44 Indole-3-glycerol phosphate synthase 2.87e-10 6.82e-05 NA NA
5. P P39594 Thiamine-phosphate synthase 8.15e-09 3.11e-02 NA NA
5. P Q1QDV0 Pyridoxine 5'-phosphate synthase 8.07e-08 4.06e-04 NA NA
5. P A7FG95 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.07e-10 1.05e-04 NA NA
5. P Q465F4 Tryptophan synthase alpha chain 4.16e-08 1.22e-03 NA NA
5. P A0RBM1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.13e-09 4.50e-02 NA NA
5. P Q8DPF0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 3.15e-10 9.67e-06 NA NA
5. P Q2FUU2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.89e-09 3.36e-03 NA NA
5. P Q99W39 3-hexulose-6-phosphate synthase 1.34e-12 3.33e-02 NA NA
5. P Q7N2D6 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 5.75e-05 3.44e-03 NA NA
5. P A0M284 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.00e-10 1.26e-02 NA NA
5. P Q03X00 Indole-3-glycerol phosphate synthase 8.44e-10 6.58e-05 NA NA
5. P Q2G0K7 3-hexulose-6-phosphate synthase 1.36e-12 3.33e-02 NA NA
5. P A3PED0 Indole-3-glycerol phosphate synthase 3.84e-09 3.28e-03 NA NA
5. P C1ELE8 Indole-3-glycerol phosphate synthase 1.19e-09 2.29e-05 NA NA
5. P Q8KEZ7 Tryptophan synthase alpha chain 2.73e-07 1.38e-02 NA NA
5. P Q1GNC2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.03e-08 1.90e-02 NA NA
5. P Q8U088 Indole-3-glycerol phosphate synthase 1.23e-09 4.31e-02 NA NA
5. P Q8R9M7 Indole-3-glycerol phosphate synthase 7.02e-10 1.60e-04 NA NA
5. P Q02YB4 Indole-3-glycerol phosphate synthase 1.51e-09 1.33e-06 NA NA
5. P Q3YX25 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.44e-10 4.12e-07 NA NA
5. P A5IPI5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.81e-10 4.53e-04 NA NA
5. P A5GSL8 Triosephosphate isomerase 3.03e-09 6.45e-03 NA NA
5. P A7X234 Indole-3-glycerol phosphate synthase 3.68e-09 1.75e-04 NA NA
5. P P0CB52 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.16e-10 2.25e-06 NA NA
5. P P65518 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.76e-10 1.97e-08 NA NA
5. P B7JN72 Thiamine-phosphate synthase 4.05e-09 1.03e-02 NA NA
5. P C0RJB1 Indole-3-glycerol phosphate synthase 4.96e-09 6.32e-04 NA NA
5. P Q0C1A2 Indole-3-glycerol phosphate synthase 3.36e-09 3.98e-05 NA NA
5. P P65522 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.91e-10 5.35e-04 NA NA
5. P Q3V8B3 Pyridoxine 5'-phosphate synthase 4.27e-08 1.58e-03 NA NA
5. P Q7UKJ7 Indole-3-glycerol phosphate synthase 1.32e-09 4.25e-06 NA NA
5. P B6IWI6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.42e-08 1.41e-04 NA NA
5. P A0AJ82 Indole-3-glycerol phosphate synthase 1.74e-09 5.89e-06 NA NA
5. P A5UXG2 Tryptophan synthase alpha chain 4.41e-08 3.94e-02 NA NA
5. P P31605 Uncharacterized protein ycf23 1.04e-12 6.08e-05 NA NA
5. P Q5E8W6 Thiazole synthase 1.13e-09 1.67e-02 NA NA
5. P Q4UZF8 Indole-3-glycerol phosphate synthase 6.96e-09 6.82e-05 NA NA
5. P P59948 Thiazole synthase 8.47e-10 1.36e-02 NA NA
5. P B5FF70 Thiazole synthase 1.33e-09 1.55e-02 NA NA
5. P A5VQR5 Indole-3-glycerol phosphate synthase 4.53e-09 2.83e-04 NA NA
5. P A4VTQ8 Triosephosphate isomerase 4.40e-05 2.72e-02 NA NA
5. P Q5YYP5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.93e-09 2.55e-02 NA NA
5. P A1R5S7 Indole-3-glycerol phosphate synthase 5.13e-10 3.95e-06 NA NA
5. P A8ET36 Indole-3-glycerol phosphate synthase 6.03e-10 3.40e-04 NA NA
5. P A4TMJ5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.80e-10 6.88e-05 NA NA
5. P A0QHH8 Phosphoribosyl isomerase A 9.42e-09 4.47e-02 NA NA
5. P Q3AU73 Indole-3-glycerol phosphate synthase 1.56e-09 9.36e-03 NA NA
5. P A1ATI1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.15e-08 4.72e-04 NA NA
5. P Q1QMJ9 Indole-3-glycerol phosphate synthase 6.64e-09 4.16e-04 NA NA
5. P Q0AP83 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.17e-09 6.98e-03 NA NA
5. P O58851 Geranylgeranylglyceryl phosphate synthase 2.92e-10 1.10e-03 NA NA
5. P A9A6C3 Orotidine 5'-phosphate decarboxylase 1.02e-09 6.56e-03 NA NA
5. P B1W0M4 Phosphoribosyl isomerase A 1.02e-08 5.70e-03 NA NA
5. P B2IKL7 Indole-3-glycerol phosphate synthase 4.40e-09 3.32e-04 NA NA
5. P A6LTL5 Thiazole synthase 1.58e-09 2.43e-02 NA NA
5. P Q15RU5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.23e-09 3.11e-02 NA NA
5. P Q2SS69 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.72e-10 4.44e-09 NA NA
5. P Q2INW2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.25e-09 4.88e-02 NA NA
5. P Q1JNJ8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.63e-10 6.27e-04 NA NA
5. P A4G0J0 Geranylgeranylglyceryl phosphate synthase 1.72e-04 1.18e-03 NA NA
5. P Q7VHY5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.57e-08 1.03e-02 NA NA
5. P Q5HPH2 Indole-3-glycerol phosphate synthase 2.87e-09 1.15e-03 NA NA
5. P B2S984 Imidazole glycerol phosphate synthase subunit HisF 3.63e-09 4.88e-02 NA NA
5. P Q98QJ8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.32e-10 1.22e-09 NA NA
5. P A1T8X3 Indole-3-glycerol phosphate synthase 6.01e-10 6.82e-06 NA NA
5. P Q1B9C0 Triosephosphate isomerase 4.78e-05 3.94e-02 NA NA
5. P A8I836 Indole-3-glycerol phosphate synthase 2.46e-09 1.15e-03 NA NA
5. P Q81IP4 Heptaprenylglyceryl phosphate synthase 5.10e-07 8.30e-04 NA NA
5. P A3CLM2 Tryptophan synthase alpha chain 2.62e-04 7.31e-03 NA NA
5. P B1YSF5 Indole-3-glycerol phosphate synthase 2.18e-09 5.87e-05 NA NA
5. P Q5JHG3 Triosephosphate isomerase 3.09e-10 9.72e-08 NA NA
5. P A5F7B9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.19e-10 1.28e-02 NA NA
5. P Q0HUN5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.50e-10 1.04e-03 NA NA
5. P P50936 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.01e-09 2.49e-04 NA NA
5. P Q5HT16 Triosephosphate isomerase 5.08e-08 7.72e-03 NA NA
5. P Q92B79 Indole-3-glycerol phosphate synthase 1.97e-09 3.46e-06 NA NA
5. P A9HY11 Indole-3-glycerol phosphate synthase 2.23e-09 8.02e-03 NA NA
5. P A1KFN9 Thiazole synthase 7.73e-10 1.36e-02 NA NA
5. P B1XEA5 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 4.97e-05 4.36e-03 NA NA
5. P Q39RH2 Thiazole synthase 1.22e-09 1.47e-02 NA NA
5. P Q3A136 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.42e-09 1.92e-03 NA NA
5. P Q7VRR1 Pyridoxine 5'-phosphate synthase 4.43e-08 2.72e-02 NA NA
5. P Q74FL9 Thiazole synthase 2.12e-09 1.06e-02 NA NA
5. P C6E0C4 Thiazole synthase 9.78e-10 1.16e-02 NA NA
5. P A5UJF1 Geranylgeranylglyceryl phosphate synthase 1.78e-10 5.96e-04 NA NA
5. P B3Q0L3 Indole-3-glycerol phosphate synthase 4.53e-09 2.15e-05 NA NA
5. P Q4L9T7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 8.35e-11 3.01e-08 NA NA
5. P Q2YRR4 Indole-3-glycerol phosphate synthase 4.88e-09 6.32e-04 NA NA
5. P B0SJ25 Pyridoxine 5'-phosphate synthase 5.06e-08 2.85e-02 NA NA
5. P P62003 Triosephosphate isomerase 7.54e-10 1.35e-07 NA NA
5. P B9DIP2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.88e-09 1.65e-02 NA NA
5. P Q8FT67 Triosephosphate isomerase 4.62e-05 7.72e-03 NA NA
5. P A8FM94 Thiazole synthase 2.56e-09 2.38e-02 NA NA
5. P B7UJV6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.49e-10 4.45e-07 NA NA
5. P Q5HN28 Heptaprenylglyceryl phosphate synthase 1.10e-05 1.45e-02 NA NA
5. P C1C8S3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.98e-10 7.36e-07 NA NA
5. P Q39JZ7 Indole-3-glycerol phosphate synthase 2.17e-09 3.74e-05 NA NA
5. P B2UDK9 Indole-3-glycerol phosphate synthase 3.39e-09 2.47e-04 NA NA
5. P P9WFX6 Indole-3-glycerol phosphate synthase 5.09e-10 1.91e-06 NA NA
5. P Q2S1Z5 Indole-3-glycerol phosphate synthase 5.66e-09 6.88e-05 NA NA
5. P A5UA71 Thiamine-phosphate synthase 1.22e-05 2.06e-02 NA NA
5. P A5VT42 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.43e-08 4.65e-03 NA NA
5. P Q8D249 Thiazole synthase 1.10e-09 4.40e-02 NA NA
5. P B8DFG3 Heptaprenylglyceryl phosphate synthase 4.47e-06 1.55e-02 NA NA
5. P Q3IT31 Geranylgeranylglyceryl phosphate synthase 1.03e-05 2.66e-04 NA NA
5. P Q8DTR2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.17e-10 9.07e-03 NA NA
5. P Q65EG2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.01e-09 1.43e-02 NA NA
5. P P59442 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.24e-10 2.65e-07 NA NA
5. P P9WG42 Triosephosphate isomerase 5.76e-05 3.25e-02 NA NA
5. P Q8PXE2 Triosephosphate isomerase 4.14e-10 3.04e-06 NA NA
5. P A9R0S6 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.29e-07 6.92e-04 NA NA
5. P Q8NYC4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.75e-10 2.25e-04 NA NA
5. P B7JBC0 Indole-3-glycerol phosphate synthase 5.74e-09 1.93e-05 NA NA
5. P A7GYQ7 Indole-3-glycerol phosphate synthase 5.05e-10 7.96e-03 NA NA
5. P Q5E317 Pyridoxine 5'-phosphate synthase 3.19e-08 2.78e-02 NA NA
5. P Q9UWN5 Triosephosphate isomerase 1.42e-10 5.63e-04 NA NA
5. P B7I0F0 Indole-3-glycerol phosphate synthase 1.39e-09 1.38e-04 NA NA
5. P B5YJ73 Thiazole synthase 4.36e-10 4.98e-02 NA NA
5. P B8DET0 Thiamine-phosphate synthase 5.58e-09 3.56e-02 NA NA
5. P A7NKL7 Tryptophan synthase alpha chain 4.35e-08 1.71e-02 NA NA
5. P Q3IT10 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.66e-09 4.40e-02 NA NA
5. P C1AT55 Indole-3-glycerol phosphate synthase 6.92e-10 2.03e-06 NA NA
5. P Q57AH4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.33e-08 4.65e-03 NA NA
5. P B1LGI8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.56e-10 4.00e-07 NA NA
5. P A0QHH0 Indole-3-glycerol phosphate synthase 1.57e-09 7.02e-07 NA NA
5. P B2SL03 Indole-3-glycerol phosphate synthase 7.38e-09 1.28e-04 NA NA
5. P Q2FN18 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.42e-09 1.93e-02 NA NA
5. P B1ZX57 Imidazole glycerol phosphate synthase subunit HisF 1.75e-09 7.78e-03 NA NA
5. P Q47AC7 Indole-3-glycerol phosphate synthase 3.06e-09 5.31e-04 NA NA
5. P B0CEU2 Indole-3-glycerol phosphate synthase 1.78e-08 4.49e-04 NA NA
5. P B8FBL5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.48e-08 3.88e-03 NA NA
5. P A6U311 Heptaprenylglyceryl phosphate synthase 1.39e-05 3.63e-02 NA NA
5. P B2HP86 Triosephosphate isomerase 4.34e-05 2.33e-02 NA NA
5. P A4Y084 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.93e-08 2.49e-02 NA NA
5. P Q9HSC1 Indole-3-glycerol phosphate synthase 2.75e-09 1.54e-04 NA NA
5. P Q49YV0 Heptaprenylglyceryl phosphate synthase 8.75e-06 1.72e-03 NA NA
5. P Q9HN14 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.67e-09 2.37e-03 NA NA
5. P Q5E634 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.69e-09 1.49e-02 NA NA
5. P A5I244 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.46e-09 3.66e-02 NA NA
5. P Q3ZYM9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.42e-09 2.87e-03 NA NA
5. P A5EVG3 Indole-3-glycerol phosphate synthase 3.12e-09 1.83e-06 NA NA
5. P Q8XS01 Indole-3-glycerol phosphate synthase 2 4.69e-09 1.03e-04 NA NA
5. P Q0S0J3 Triosephosphate isomerase 5.29e-05 7.14e-03 NA NA
5. P A1BHS2 Tryptophan synthase alpha chain 3.59e-07 7.42e-03 NA NA
5. P A6Q3P0 Indole-3-glycerol phosphate synthase 7.60e-10 1.03e-03 NA NA
5. P P9WG43 Triosephosphate isomerase 4.50e-05 3.25e-02 NA NA
5. P Q74HT0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.12e-09 2.98e-07 NA NA
5. P Q8NWU1 Tryptophan synthase alpha chain 7.50e-05 3.40e-02 NA NA
5. P A5IWA1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.87e-09 6.31e-03 NA NA
5. P O69190 Pyridoxal 5'-phosphate synthase subunit PdxS (Fragment) 2.05e-08 2.15e-03 NA NA
5. P Q8XNZ3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.71e-11 1.15e-04 NA NA
5. P Q82AA1 Phosphoribosyl isomerase A 1.05e-08 2.28e-02 NA NA
5. P B0KK35 Indole-3-glycerol phosphate synthase 5.71e-09 1.95e-05 NA NA
5. P B2SZ04 Indole-3-glycerol phosphate synthase 7.45e-09 6.03e-05 NA NA
5. P Q46GE2 Orotidine 5'-phosphate decarboxylase 1.45e-10 9.00e-03 NA NA
5. P Q8Y6Q4 Indole-3-glycerol phosphate synthase 2.01e-09 1.28e-05 NA NA
5. P Q2GDS9 Thiazole synthase 2.94e-10 2.34e-02 NA NA
5. P A6Q4V9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.24e-08 2.19e-03 NA NA
5. P A9AJ43 Indole-3-glycerol phosphate synthase 2.68e-09 2.81e-05 NA NA
5. P A3Q127 Phosphoribosyl isomerase A 1.35e-08 6.11e-03 NA NA
5. P Q9A746 Thiazole synthase 2.26e-09 5.72e-04 NA NA
5. P Q5LU97 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1 1.35e-08 5.67e-04 NA NA
5. P A1KJ27 Indole-3-glycerol phosphate synthase 3.72e-10 3.60e-06 NA NA
5. P Q6GH35 Indole-3-glycerol phosphate synthase 2.07e-09 8.23e-04 NA NA
5. P B0TDM8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.22e-09 2.78e-02 NA NA
5. P Q8FY07 Imidazole glycerol phosphate synthase subunit HisF 3.67e-09 4.88e-02 NA NA
5. P Q8EH78 Pyridoxine 5'-phosphate synthase 2.51e-08 3.38e-02 NA NA
5. P A8Z5Y2 Tryptophan synthase alpha chain 9.66e-04 1.65e-04 NA NA
5. P Q668J7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.05e-10 2.21e-04 NA NA
5. P B7GFU9 Heptaprenylglyceryl phosphate synthase 3.94e-07 9.16e-04 NA NA
5. P B1YBK5 Indole-3-glycerol phosphate synthase 1.35e-08 8.02e-03 NA NA
5. P Q81TM0 Indole-3-glycerol phosphate synthase 1.30e-09 6.14e-05 NA NA
5. P B7H4U6 Heptaprenylglyceryl phosphate synthase 4.90e-07 5.86e-04 NA NA
5. P Q92AP8 Heptaprenylglyceryl phosphate synthase 3.92e-06 2.95e-02 NA NA
5. P P62002 Triosephosphate isomerase 3.81e-10 1.35e-07 NA NA
5. P B3EG28 Indole-3-glycerol phosphate synthase 5.82e-10 7.19e-05 NA NA
5. P Q5HU56 Thiazole synthase 2.16e-09 1.40e-02 NA NA
5. P Q8Z080 Pyridoxine 5'-phosphate synthase 1.80e-08 4.27e-02 NA NA
5. P C1CSU8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.01e-10 7.36e-07 NA NA
5. P C1CG44 Indole-3-glycerol phosphate synthase 1.31e-09 4.54e-06 NA NA
5. P O35006 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.26e-08 4.09e-02 NA NA
5. P Q1D282 Thiamine-phosphate synthase 2.86e-09 4.47e-02 NA NA
5. P Q6GFF1 Heptaprenylglyceryl phosphate synthase 7.48e-07 3.63e-02 NA NA
5. P Q2FDI7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.44e-09 3.36e-03 NA NA
5. P Q2YZ70 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.79e-09 1.80e-02 NA NA
5. P A2RYI3 Indole-3-glycerol phosphate synthase 3.38e-09 1.91e-04 NA NA
5. P A7I2Y2 Indole-3-glycerol phosphate synthase 7.12e-10 1.85e-03 NA NA
5. P Q1Q803 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.26e-08 3.72e-02 NA NA
5. P B2I669 Pyridoxine 5'-phosphate synthase 5.39e-07 1.96e-02 NA NA
5. P Q3V7I6 Pyridoxine 5'-phosphate synthase 2.12e-08 7.42e-03 NA NA
5. P A5ISQ5 Tryptophan synthase alpha chain 6.55e-05 2.43e-02 NA NA
5. P P20578 Indole-3-glycerol phosphate synthase 5.23e-09 7.98e-05 NA NA
5. P Q2G6R0 Indole-3-glycerol phosphate synthase 5.23e-09 7.84e-04 NA NA
5. P P0C882 Geranylgeranylglyceryl phosphate synthase 3.08e-10 8.79e-04 NA NA
5. P A2BSL8 Indole-3-glycerol phosphate synthase 1.24e-08 5.79e-03 NA NA
5. P B1MC85 Triosephosphate isomerase 5.43e-05 4.27e-02 NA NA
5. P A1UHK4 Phosphoribosyl isomerase A 1.35e-08 6.11e-03 NA NA
5. P B6YQ29 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.02e-10 2.06e-02 NA NA
5. P A6UZF2 Indole-3-glycerol phosphate synthase 5.07e-09 1.08e-05 NA NA
5. P Q7V958 Putative imidazole glycerol phosphate synthase subunit hisF2 1.08e-09 4.80e-03 NA NA
5. P Q2G348 Thiazole synthase 1.84e-09 4.43e-02 NA NA
5. P B7LRJ1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.50e-10 2.89e-07 NA NA
5. P B2SWK7 Thiazole synthase 2.30e-09 1.55e-02 NA NA
5. P P70937 Indole-3-glycerol phosphate synthase 3.72e-09 7.40e-04 NA NA
5. P Q8PHF5 Thiazole synthase 2.45e-09 1.84e-02 NA NA
5. P Q8ZLQ7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 1.67e-10 5.67e-05 NA NA
5. P A8LHX5 Imidazole glycerol phosphate synthase subunit HisF 1.61e-09 5.57e-03 NA NA
5. P A1TKZ3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.72e-09 1.86e-02 NA NA
5. P B1H0E7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.68e-09 2.49e-02 NA NA
5. P A0QLT3 Thiazole synthase 7.75e-10 3.18e-02 NA NA
5. P P94327 Indole-3-glycerol phosphate synthase 5.02e-09 1.63e-03 NA NA
5. P C6E7F5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.94e-09 1.80e-04 NA NA
5. P B6JCG4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.00e-08 1.25e-02 NA NA
5. P B5EQF1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.86e-10 2.03e-03 NA NA
5. P Q5HQR7 3-dehydroquinate dehydratase 4.21e-06 1.30e-02 NA NA
5. P C3L541 Heptaprenylglyceryl phosphate synthase 4.22e-07 2.01e-04 NA NA
5. P Q8CQ69 3-hexulose-6-phosphate synthase 7.17e-13 1.74e-02 NA NA
5. P B1LE43 3-dehydroquinate dehydratase 3.01e-09 1.42e-03 NA NA
5. P C1KZ34 Thiamine-phosphate synthase 5.53e-09 1.51e-02 NA NA
5. P Q8X9G9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.28e-10 7.88e-07 NA NA
5. P B1L872 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-07 5.77e-04 NA NA
5. P A3M785 Indole-3-glycerol phosphate synthase 3.47e-09 6.01e-04 NA NA
5. P C7PEQ0 Geranylgeranylglyceryl phosphate synthase 7.10e-10 9.71e-04 NA NA
5. P Q4FPV8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.49e-08 1.90e-02 NA NA
5. P Q8KBW1 Indole-3-glycerol phosphate synthase 7.28e-10 3.00e-04 NA NA
5. P O29276 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.09e-08 5.22e-04 NA NA
5. P B7K0H0 Indole-3-glycerol phosphate synthase 9.29e-09 8.94e-03 NA NA
5. P A6TYA2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.78e-10 4.53e-04 NA NA
5. P Q5JDY1 Geranylgeranylglyceryl phosphate synthase 1.10e-10 4.53e-02 NA NA
5. P Q5X6S0 Indole-3-glycerol phosphate synthase 4.08e-09 3.55e-04 NA NA
5. P A2SQR0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.58e-09 1.51e-02 NA NA
5. P A7GKR4 Thiamine-phosphate synthase 2.43e-09 7.31e-03 NA NA
5. P Q7CYR2 Indole-3-glycerol phosphate synthase 9.33e-09 2.09e-05 NA NA
5. P A4XLM3 Tryptophan synthase alpha chain 4.68e-05 4.20e-03 NA NA
5. P Q8F9R5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.38e-09 1.35e-02 NA NA
5. P Q5NPJ8 Thiazole synthase 1.10e-09 3.25e-02 NA NA
5. P Q7TV44 Indole-3-glycerol phosphate synthase 3.15e-09 3.99e-04 NA NA
5. P P66982 Tryptophan synthase alpha chain 7.60e-05 2.43e-02 NA NA
5. P Q040Z7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.11e-09 3.84e-07 NA NA
5. P Q6L2N4 Geranylgeranylglyceryl phosphate synthase 8.32e-10 5.63e-04 NA NA
5. P Q5HJ50 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.72e-10 6.22e-04 NA NA
5. P A0R981 Thiamine-phosphate synthase 3.92e-09 8.02e-03 NA NA
5. P P65520 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 3.11e-10 7.36e-07 NA NA
5. P B7JA18 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.10e-09 2.03e-03 NA NA
5. P Q5N575 Indole-3-glycerol phosphate synthase 8.51e-09 1.18e-03 NA NA
5. P Q6MT55 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.92e-10 1.02e-08 NA NA
5. P A9BBR3 Indole-3-glycerol phosphate synthase 5.10e-09 3.94e-03 NA NA
5. P Q71VW2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.62e-10 3.04e-06 NA NA
5. P Q8TUT9 Triosephosphate isomerase 1.39e-10 7.44e-05 NA NA
5. P Q8KPR4 Indole-3-glycerol phosphate synthase 1.09e-08 1.18e-03 NA NA
5. P P19583 Triosephosphate isomerase 4.36e-05 1.20e-02 NA NA
5. P Q8ZYX2 Indole-3-glycerol phosphate synthase 2.46e-08 2.59e-03 NA NA
5. P B7JES8 Indole-3-glycerol phosphate synthase 1.32e-09 6.14e-05 NA NA
5. P O87007 3-dehydroquinate dehydratase 3.77e-09 6.98e-03 NA NA
5. P Q2FH63 Tryptophan synthase alpha chain 6.48e-05 3.40e-02 NA NA
5. P B8HP79 Indole-3-glycerol phosphate synthase 1.99e-08 4.60e-02 NA NA
5. P A5G535 Pyridoxine 5'-phosphate synthase 3.93e-08 3.88e-02 NA NA
5. P Q5NL34 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 3.56e-08 4.31e-02 NA NA
5. P Q5PLF1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 1.75e-10 4.75e-05 NA NA
5. P B7IUW3 Heptaprenylglyceryl phosphate synthase 4.01e-07 4.45e-04 NA NA
5. P A4YJ26 Geranylgeranylglyceryl phosphate synthase 1.96e-09 4.15e-02 NA NA
5. P Q6AF68 Indole-3-glycerol phosphate synthase 5.62e-10 1.46e-04 NA NA
5. P Q0AQ76 Thiazole synthase 2.12e-09 3.58e-03 NA NA
5. P Q8NVT0 Heptaprenylglyceryl phosphate synthase 1.27e-05 3.35e-02 NA NA
5. P Q5HBN7 Pyridoxine 5'-phosphate synthase 2.09e-08 1.78e-02 NA NA
5. P Q8CPX1 3-dehydroquinate dehydratase 3.97e-06 1.30e-02 NA NA
5. P A1BDW1 Indole-3-glycerol phosphate synthase 5.59e-10 9.09e-04 NA NA
5. P Q57CZ8 Indole-3-glycerol phosphate synthase 4.93e-09 6.32e-04 NA NA
5. P Q6G9I6 Tryptophan synthase alpha chain 5.36e-05 3.40e-02 NA NA
5. P C1CT53 Indole-3-glycerol phosphate synthase 1.18e-09 3.46e-06 NA NA
5. P Q7M831 Indole-3-glycerol phosphate synthase 6.08e-10 3.83e-04 NA NA
5. P B9L7G2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.19e-09 5.11e-03 NA NA
5. P Q6CQL7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.37e-07 1.68e-02 NA NA
5. P Q2K879 Indole-3-glycerol phosphate synthase 7.84e-09 3.91e-05 NA NA
5. P A8LX58 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.01e-08 5.53e-04 NA NA
5. P Q185B2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.28e-10 7.44e-05 NA NA
5. P Q30PQ5 Triosephosphate isomerase 1.20e-05 2.60e-02 NA NA
5. P B5EDR5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.09e-08 1.53e-04 NA NA
5. P B9JXW8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.60e-08 8.03e-04 NA NA
5. P Q8R884 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.29e-09 1.67e-04 NA NA
5. P A5INE5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.80e-08 1.03e-02 NA NA
5. P Q03CY1 Indole-3-glycerol phosphate synthase 1.45e-09 1.30e-04 NA NA
5. P A0PXP7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.07e-09 4.67e-02 NA NA
5. P Q98CT3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.98e-08 3.96e-04 NA NA
5. P Q6AMS4 Indole-3-glycerol phosphate synthase 6.37e-10 1.04e-05 NA NA
5. P Q28NK3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.65e-09 4.31e-05 NA NA
5. P B2S5Z1 Indole-3-glycerol phosphate synthase 4.89e-09 6.32e-04 NA NA
5. P B0T799 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.40e-08 4.35e-05 NA NA
5. P A4T9N5 Indole-3-glycerol phosphate synthase 4.46e-10 4.02e-06 NA NA
5. P B3R703 Indole-3-glycerol phosphate synthase 5.03e-09 1.68e-03 NA NA
5. P A2SSK1 Geranylgeranylglyceryl phosphate synthase 4.04e-07 6.11e-03 NA NA
5. P Q46WL7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.19e-09 3.02e-02 NA NA
5. P B1AIG9 Triosephosphate isomerase 2.22e-04 5.53e-04 NA NA
5. P Q48907 3-hexulose-6-phosphate synthase 6.86e-11 8.34e-03 NA NA
5. P A7ZGB2 Imidazole glycerol phosphate synthase subunit HisF 3.66e-09 2.89e-02 NA NA
5. P C5D4J0 Heptaprenylglyceryl phosphate synthase 3.14e-07 4.34e-04 NA NA
5. P C5VXY0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.09e-10 1.99e-06 NA NA
5. P B5ZPY7 Indole-3-glycerol phosphate synthase 1.01e-08 2.23e-04 NA NA
5. P Q1MGE1 Indole-3-glycerol phosphate synthase 9.69e-09 5.92e-03 NA NA
5. P B1I7S9 Indole-3-glycerol phosphate synthase 1.37e-09 7.41e-06 NA NA
5. P C1A4L9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.51e-09 7.66e-03 NA NA
5. P Q46DY6 Triosephosphate isomerase 5.34e-10 2.62e-05 NA NA
5. P C5CBK6 Indole-3-glycerol phosphate synthase 5.91e-10 1.17e-04 NA NA
5. P Q5LR59 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2 3.62e-08 1.80e-03 NA NA
5. P Q8THC4 3-dehydroquinate dehydratase 8.30e-09 4.84e-02 NA NA
5. P Q1LT71 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.37e-08 3.73e-03 NA NA
5. P B8GHM9 Geranylgeranylglyceryl phosphate synthase 1.10e-06 8.17e-04 NA NA
5. P A8Z242 Indole-3-glycerol phosphate synthase 3.64e-09 2.41e-04 NA NA
5. P B2HQX7 Indole-3-glycerol phosphate synthase 4.39e-10 3.04e-06 NA NA
5. P Q2VYI9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.97e-09 1.43e-02 NA NA
5. P Q0TUP9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.05e-10 1.15e-04 NA NA
5. P A5GRL0 Indole-3-glycerol phosphate synthase 3.34e-09 7.90e-03 NA NA
5. P Q7WDY0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.59e-09 1.62e-02 NA NA
5. P Q5M348 Indole-3-glycerol phosphate synthase 1.05e-09 1.10e-05 NA NA
5. P Q3ICF4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.04e-09 1.45e-02 NA NA
5. P B0VUS0 Indole-3-glycerol phosphate synthase 2.78e-09 7.64e-04 NA NA
5. P A2SSN5 Triosephosphate isomerase 2.72e-10 3.64e-03 NA NA
5. P Q32BB6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.27e-10 4.04e-07 NA NA
5. P Q63GK3 Thiamine-phosphate synthase 3.91e-09 8.02e-03 NA NA
5. P Q5WY75 Indole-3-glycerol phosphate synthase 4.05e-09 3.21e-04 NA NA
5. P Q5HEL6 Heptaprenylglyceryl phosphate synthase 1.34e-05 3.35e-02 NA NA
5. P A1RJ17 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.95e-10 7.46e-04 NA NA
5. P B1XX77 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.55e-09 2.29e-02 NA NA
5. P A0KWB1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.88e-10 2.02e-03 NA NA
5. P B8DD13 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.40e-10 3.81e-05 NA NA
5. P Q7WEK6 Indole-3-glycerol phosphate synthase 2.98e-09 4.16e-03 NA NA
5. P B1IQQ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.27e-10 2.65e-07 NA NA
5. P B1MBV4 Indole-3-glycerol phosphate synthase 5.93e-10 6.53e-05 NA NA
5. P Q0K6I0 Indole-3-glycerol phosphate synthase 5.39e-09 1.76e-03 NA NA
5. P Q57843 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 2.03e-09 4.99e-03 NA NA
5. P A1UHJ6 Indole-3-glycerol phosphate synthase 5.80e-10 5.41e-06 NA NA
5. P Q3BYB5 Indole-3-glycerol phosphate synthase 7.58e-09 1.30e-04 NA NA
5. P B3Q6M9 Indole-3-glycerol phosphate synthase 4.97e-09 1.96e-04 NA NA
5. P B1VH82 Tryptophan synthase alpha chain 8.34e-08 1.89e-02 NA NA
5. P A9WQA3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.85e-09 1.66e-02 NA NA
5. P Q9PK66 Triosephosphate isomerase 3.16e-05 1.67e-02 NA NA
5. P Q8NWU3 Indole-3-glycerol phosphate synthase 3.73e-09 2.41e-04 NA NA
5. P O68816 Tryptophan synthase alpha chain 5.68e-08 3.82e-03 NA NA
5. P A4WIJ6 Triosephosphate isomerase 1.59e-10 1.05e-06 NA NA
5. P Q8TMD6 Thiamine-phosphate synthase 3.51e-09 1.04e-02 NA NA
5. P Q5F645 Indole-3-glycerol phosphate synthase 7.42e-09 3.91e-03 NA NA
5. P Q72NP6 Indole-3-glycerol phosphate synthase 5.97e-10 3.05e-05 NA NA
5. P Q9YEF5 Geranylgeranylglyceryl phosphate synthase 7.38e-10 1.68e-04 NA NA
5. P B4RU63 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.02e-10 2.65e-03 NA NA
5. P Q1QRX1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.92e-08 7.84e-03 NA NA
5. P Q3M9L4 Pyridoxine 5'-phosphate synthase 1.89e-08 3.25e-02 NA NA
5. P O68602 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.53e-09 5.27e-03 NA NA
5. P Q8YA44 Thiamine-phosphate synthase 6.87e-09 1.54e-02 NA NA
5. P Q5WK54 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.90e-11 5.10e-07 NA NA
5. P B8EJS1 Indole-3-glycerol phosphate synthase 4.88e-09 1.62e-04 NA NA
5. P C3PBN9 Heptaprenylglyceryl phosphate synthase 4.68e-07 2.01e-04 NA NA
5. P Q31KC5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.89e-11 6.12e-08 NA NA
5. P A0QX95 Indole-3-glycerol phosphate synthase 8.64e-10 5.62e-06 NA NA
5. P B3R795 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.86e-09 3.25e-02 NA NA
5. P A5IK84 Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit 6.99e-09 1.26e-02 NA NA
5. P B0U2A9 Pyridoxine 5'-phosphate synthase 6.75e-05 4.18e-02 NA NA
5. P Q53726 Heptaprenylglyceryl phosphate synthase 1.29e-05 3.35e-02 NA NA
5. P Q3SGS2 Indole-3-glycerol phosphate synthase 2.52e-09 1.51e-03 NA NA
5. P Q8DNM6 Indole-3-glycerol phosphate synthase 1.31e-09 4.54e-06 NA NA
5. P C3P3T8 Indole-3-glycerol phosphate synthase 1.27e-09 6.14e-05 NA NA
5. P Q0SHZ5 Indole-3-glycerol phosphate synthase 4.71e-10 4.46e-06 NA NA
5. P C1L0D5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 6.31e-10 7.48e-06 NA NA
5. P Q9HQS4 Triosephosphate isomerase 1.61e-09 8.63e-05 NA NA
5. P P62355 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.29e-09 3.39e-03 NA NA
5. P Q65DK0 Thiamine-phosphate synthase 7.95e-09 5.88e-03 NA NA
5. P A4FLL0 Indole-3-glycerol phosphate synthase 5.79e-10 1.07e-06 NA NA
5. P A7HXZ6 Indole-3-glycerol phosphate synthase 4.11e-09 1.13e-04 NA NA
5. P Q5HIA5 3-hexulose-6-phosphate synthase 1.40e-12 3.33e-02 NA NA
5. P Q975W8 Geranylgeranylglyceryl phosphate synthase 3.96e-10 2.76e-03 NA NA
5. P Q2IWB0 Indole-3-glycerol phosphate synthase 3.65e-09 6.30e-05 NA NA
5. P B2HVE7 Indole-3-glycerol phosphate synthase 2.81e-09 9.47e-04 NA NA
5. P B7JM94 Heptaprenylglyceryl phosphate synthase 4.61e-07 2.01e-04 NA NA
5. P C5A615 Geranylgeranylglyceryl phosphate synthase 1.30e-10 2.15e-03 NA NA
5. P Q7W049 Thiamine-phosphate synthase 2.50e-10 4.36e-03 NA NA
5. P Q4L904 Thiazole synthase 1.11e-09 1.16e-02 NA NA
5. P C6C1D1 Tryptophan synthase alpha chain 3.32e-05 6.06e-03 NA NA
5. P Q07NF6 Indole-3-glycerol phosphate synthase 4.28e-09 7.27e-04 NA NA
5. P Q8G6D5 Triosephosphate isomerase 3.92e-05 2.98e-02 NA NA
5. P Q4J8X3 Indole-3-glycerol phosphate synthase 2.19e-10 9.92e-05 NA NA
5. P Q2NET5 Geranylgeranylglyceryl phosphate synthase 1.69e-10 1.37e-03 NA NA
5. P B1W0N8 Indole-3-glycerol phosphate synthase 1.07e-09 4.81e-07 NA NA
5. P B9LAF4 Indole-3-glycerol phosphate synthase 8.01e-10 7.64e-04 NA NA
5. P B3QTV1 Pyridoxine 5'-phosphate synthase 4.12e-08 2.28e-02 NA NA
5. P C6E5P6 Pyridoxine 5'-phosphate synthase 3.10e-08 1.89e-02 NA NA
5. P A3MFQ4 Indole-3-glycerol phosphate synthase 3.09e-09 1.91e-04 NA NA
5. P Q2NHB3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.15e-09 1.27e-02 NA NA
5. P Q97P30 Indole-3-glycerol phosphate synthase 1.25e-09 5.07e-06 NA NA
5. P B6I1U1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.50e-10 4.00e-07 NA NA
5. P Q49WT7 3-hexulose-6-phosphate synthase 1 9.81e-13 3.83e-02 NA NA
5. P Q47R37 Thiazole synthase 1.22e-09 1.44e-02 NA NA
5. P B0SXB0 Thiazole synthase 2.24e-09 9.01e-04 NA NA
5. P A9A799 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.80e-09 1.33e-03 NA NA
5. P Q1IZA2 Triosephosphate isomerase 3.82e-09 2.74e-02 NA NA
5. P A4FYB3 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.80e-09 1.44e-03 NA NA
5. P Q81IG8 Thiamine-phosphate synthase 4.24e-09 1.39e-03 NA NA
5. P A4X9Q0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.13e-08 2.63e-03 NA NA
5. P P65523 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.00e-10 5.35e-04 NA NA
5. P Q9ZFA7 Indole-3-glycerol phosphate synthase 3.60e-09 3.70e-04 NA NA
5. P Q9RUG0 Indole-3-glycerol phosphate synthase 8.23e-09 1.19e-02 NA NA
5. P Q0T067 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.22e-10 2.65e-07 NA NA
5. P Q8YE36 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.72e-08 4.65e-03 NA NA
5. P A2RK21 Indole-3-glycerol phosphate synthase 1.56e-09 1.33e-06 NA NA
5. P A7ZES8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.38e-09 5.03e-03 NA NA
5. P C1AK93 Thiazole synthase 8.09e-10 1.36e-02 NA NA
5. P B2UQA2 Imidazole glycerol phosphate synthase subunit HisF 2.79e-09 7.42e-03 NA NA
5. P B7V609 Indole-3-glycerol phosphate synthase 4.93e-09 1.61e-05 NA NA
5. P Q49XH6 Indole-3-glycerol phosphate synthase 4.03e-09 1.83e-03 NA NA
5. P A5V9V9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.70e-08 2.78e-03 NA NA
5. P Q8PLG7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.29e-10 2.49e-02 NA NA
5. P Q2RHX4 Thiazole synthase 7.51e-10 2.13e-02 NA NA
5. P C5BMF4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.32e-08 4.00e-03 NA NA
5. P B8GWP9 Indole-3-glycerol phosphate synthase 2.11e-09 2.75e-04 NA NA
5. P B9DVU8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.24e-10 5.26e-04 NA NA
5. P Q6LZM2 Orotidine 5'-phosphate decarboxylase 1.26e-09 1.83e-03 NA NA
5. P A0AMC4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.20e-10 1.21e-04 NA NA
5. P A8FEK0 Indole-3-glycerol phosphate synthase 5.06e-09 1.00e-05 NA NA
5. P Q7TU64 Indole-3-glycerol phosphate synthase 2.25e-08 8.58e-04 NA NA
5. P B1VTI8 2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase 2.95e-09 1.07e-08 NA NA
5. P A1KAV5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.34e-09 2.42e-02 NA NA
5. P Q71YQ8 Heptaprenylglyceryl phosphate synthase 4.68e-06 2.19e-02 NA NA
5. P Q1ILG3 Thiamine-phosphate synthase 1.97e-10 1.97e-02 NA NA
5. P B7INA2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.07e-09 4.74e-02 NA NA
5. P A0AFC5 Thiamine-phosphate synthase 3.62e-09 1.17e-02 NA NA
5. P B2KEC4 Pyridoxine 5'-phosphate synthase 7.52e-09 1.66e-03 NA NA
5. P A6U1J2 Indole-3-glycerol phosphate synthase 3.58e-09 1.75e-04 NA NA
5. P A6U559 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.11e-09 6.31e-03 NA NA
5. P Q898R2 Triosephosphate isomerase 2.93e-05 3.83e-02 NA NA
5. P Q56319 Indole-3-glycerol phosphate synthase 1.57e-08 1.66e-03 NA NA
5. P B0U1P0 Indole-3-glycerol phosphate synthase 5.91e-09 1.64e-04 NA NA
5. P Q1IFZ9 Indole-3-glycerol phosphate synthase 4.63e-09 3.05e-05 NA NA
5. P A6QGS2 Indole-3-glycerol phosphate synthase 3.57e-09 7.27e-04 NA NA
5. P A4WX67 Indole-3-glycerol phosphate synthase 4.03e-09 1.61e-03 NA NA
5. P Q0BPX3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.43e-08 3.64e-03 NA NA
5. P Q9A727 Indole-3-glycerol phosphate synthase 1.38e-09 2.75e-04 NA NA
5. P A4SV52 Indole-3-glycerol phosphate synthase 3.54e-09 5.13e-04 NA NA
5. P P61410 Thiamine-phosphate synthase 4.60e-09 5.39e-03 NA NA
5. P A3NZP6 Indole-3-glycerol phosphate synthase 2.37e-09 1.53e-04 NA NA
5. P A9A6L5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.93e-09 1.87e-02 NA NA
5. P B9MDV7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.20e-09 2.14e-02 NA NA
5. P Q8TVJ8 Indole-3-glycerol phosphate synthase 8.74e-10 1.52e-04 NA NA
5. P Q660M6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.26e-10 2.62e-04 NA NA
5. P B9M5K2 Pyridoxine 5'-phosphate synthase 2.77e-08 1.89e-02 NA NA
5. P C1EMQ6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.15e-09 4.50e-02 NA NA
5. P Q0TCP3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.56e-10 4.00e-07 NA NA
5. P A9KL43 Indole-3-glycerol phosphate synthase 9.20e-10 1.63e-03 NA NA
5. P A5USQ4 Indole-3-glycerol phosphate synthase 1.81e-09 2.64e-05 NA NA
5. P A4VW79 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.91e-10 1.99e-06 NA NA
5. P Q92PR9 Indole-3-glycerol phosphate synthase 8.12e-09 1.89e-04 NA NA
5. P Q9JVE0 Tryptophan synthase alpha chain 1.25e-05 3.04e-02 NA NA
5. P B8GQT0 Thiazole synthase 2.95e-09 4.91e-02 NA NA
5. P D0ZLR2 2-dehydro-3-deoxy-phosphogluconate aldolase 2.89e-05 4.50e-03 NA NA
5. P Q87EX2 Indole-3-glycerol phosphate synthase 5.00e-09 4.31e-04 NA NA
5. P Q01NZ1 Thiazole synthase 1.02e-09 2.18e-02 NA NA
5. P B1YLS2 Indole-3-glycerol phosphate synthase 1.11e-09 1.27e-06 NA NA
5. P A4YVD6 Indole-3-glycerol phosphate synthase 5.02e-09 2.49e-04 NA NA
5. P B9K9S2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.22e-07 3.70e-03 NA NA
5. P Q0BIW5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.58e-09 4.03e-02 NA NA
5. P B7J2K0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.27e-10 9.71e-04 NA NA
5. P Q5GXE5 Thiazole synthase 2.31e-09 1.55e-02 NA NA
5. P O30725 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.40e-09 1.10e-03 NA NA
5. P P66989 Indole-3-glycerol phosphate synthase 4.84e-09 6.32e-04 NA NA
5. P A0LK96 Pyridoxine 5'-phosphate synthase 2.66e-08 4.76e-03 NA NA
5. P Q55508 Indole-3-glycerol phosphate synthase 3.40e-09 5.70e-03 NA NA
5. P A1R562 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.07e-08 3.01e-03 NA NA
5. P A0JC77 2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase 2.71e-09 1.07e-08 NA NA
5. P A9A3Z1 Geranylgeranylglyceryl phosphate synthase 3.08e-07 2.74e-02 NA NA
5. P Q494D7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.35e-09 5.88e-03 NA NA
5. P Q3KJI6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.81e-09 3.76e-03 NA NA
5. P P05324 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.02e-09 1.28e-02 NA NA
5. P A1RUV7 Triosephosphate isomerase 1.85e-10 1.63e-06 NA NA
5. P P71340 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.79e-10 7.66e-03 NA NA
5. P B5E7M5 Indole-3-glycerol phosphate synthase 1.06e-09 5.07e-06 NA NA
5. P A8Z5H4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.34e-09 3.36e-03 NA NA
5. P Q2KE60 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.40e-07 3.33e-02 NA NA
5. P Q2NHA5 Orotidine 5'-phosphate decarboxylase 1.92e-10 4.31e-04 NA NA
5. P A7I1W6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.12e-08 3.58e-04 NA NA
5. P Q2FQM4 Geranylgeranylglyceryl phosphate synthase 8.28e-07 9.71e-04 NA NA
5. P Q9UXX2 Triosephosphate isomerase 3.99e-10 5.84e-07 NA NA
5. P Q5F9Y6 Tryptophan synthase alpha chain 9.79e-05 4.43e-02 NA NA
5. P A1W434 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.26e-09 5.70e-03 NA NA
5. P Q740P4 Indole-3-glycerol phosphate synthase 4.79e-10 7.02e-07 NA NA
5. P Q8FNZ7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.68e-09 4.06e-03 NA NA
5. P B8GU31 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.33e-09 1.80e-02 NA NA
5. P A8ES24 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.34e-09 5.26e-04 NA NA
5. P Q8R7I7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 9.73e-11 8.94e-03 NA NA
5. P B7MVG9 3-dehydroquinate dehydratase 3.00e-09 9.01e-04 NA NA
5. P Q6M1A9 Geranylgeranylglyceryl phosphate synthase 1.86e-04 1.53e-02 NA NA
5. P O26652 Geranylgeranylglyceryl phosphate synthase 3.27e-10 9.32e-04 NA NA
5. P A3PZA3 Triosephosphate isomerase 4.83e-05 3.94e-02 NA NA
5. P Q3J6Q2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.66e-09 1.82e-02 NA NA
5. P Q5WGS3 Indole-3-glycerol phosphate synthase 4.48e-09 1.06e-03 NA NA
5. P A3CK30 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.00e-10 5.21e-09 NA NA
5. P A4IQ84 Indole-3-glycerol phosphate synthase 2.93e-09 1.38e-04 NA NA
5. P Q6HLU6 Indole-3-glycerol phosphate synthase 1.22e-09 1.88e-04 NA NA
5. P P46711 Triosephosphate isomerase 5.25e-05 4.15e-02 NA NA
5. P B5ERI2 Indole-3-glycerol phosphate synthase 5.77e-09 1.93e-05 NA NA
5. P Q9JVH4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.92e-09 1.50e-02 NA NA
5. P B7HGZ9 Indole-3-glycerol phosphate synthase 1.46e-09 1.67e-04 NA NA
5. P Q5HCM3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-08 3.36e-03 NA NA
5. P A9A9R9 3-dehydroquinate dehydratase 2.55e-08 4.63e-02 NA NA
5. P B0CGT9 Indole-3-glycerol phosphate synthase 5.05e-09 6.06e-04 NA NA
5. P Q9HFV5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.96e-07 1.20e-02 NA NA
5. P Q2RNA6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.68e-09 6.92e-03 NA NA
5. P B9KMV0 Indole-3-glycerol phosphate synthase 3.82e-09 1.05e-03 NA NA
5. P B2JHI8 Indole-3-glycerol phosphate synthase 2.14e-09 1.71e-04 NA NA
5. P A5CRW2 Imidazole glycerol phosphate synthase subunit HisF 2.86e-09 2.74e-02 NA NA
5. P Q57AH3 Imidazole glycerol phosphate synthase subunit HisF 5.11e-09 4.88e-02 NA NA
5. P B9DMR9 Heptaprenylglyceryl phosphate synthase 9.11e-07 3.16e-02 NA NA
5. P Q0T4L4 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 5.46e-08 9.67e-06 NA NA
5. P A0K458 Indole-3-glycerol phosphate synthase 1.84e-09 7.38e-05 NA NA
5. P A8Z245 Tryptophan synthase alpha chain 6.87e-05 3.40e-02 NA NA
5. P Q2YQY8 Imidazole glycerol phosphate synthase subunit HisF 3.70e-09 4.88e-02 NA NA
5. P A4G1P4 Indole-3-glycerol phosphate synthase 4.47e-09 1.88e-04 NA NA
5. P Q9KF39 Heptaprenylglyceryl phosphate synthase 7.70e-06 1.23e-03 NA NA
5. P Q931N1 Heptaprenylglyceryl phosphate synthase 8.07e-07 2.24e-02 NA NA
5. P Q2P0J5 Thiazole synthase 2.32e-09 1.55e-02 NA NA
5. P O74025 Triosephosphate isomerase 1.53e-10 2.14e-06 NA NA
5. P B4SLE8 Indole-3-glycerol phosphate synthase 4.00e-09 3.22e-05 NA NA
5. P O26679 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 2.26e-09 1.98e-05 NA NA
5. P C1C968 Indole-3-glycerol phosphate synthase 1.25e-09 2.31e-06 NA NA
5. P A4Y7H1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.01e-10 3.46e-04 NA NA
5. P O28965 Triosephosphate isomerase 6.53e-11 2.12e-04 NA NA
5. P A8A533 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.26e-10 2.65e-07 NA NA
5. P Q123F4 Indole-3-glycerol phosphate synthase 3.33e-09 3.55e-04 NA NA
5. P Q3Z6G5 Indole-3-glycerol phosphate synthase 1.49e-09 2.12e-04 NA NA
5. P B7M0T5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.29e-10 4.00e-07 NA NA
5. P Q3Z6V7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.30e-09 3.48e-02 NA NA
5. P Q5FA22 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.43e-08 9.50e-03 NA NA
5. P Q03HR3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.32e-10 8.63e-05 NA NA
5. P Q1JIP7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.58e-10 2.15e-04 NA NA
5. P B3GZ03 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.82e-10 9.95e-03 NA NA
5. P Q83L15 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 5.67e-08 1.08e-06 NA NA
5. P Q5HVR3 Indole-3-glycerol phosphate synthase 4.16e-10 2.89e-03 NA NA
5. P D5BCE4 Geranylgeranylglyceryl phosphate synthase 4.20e-06 2.80e-03 NA NA
5. P A7X435 Heptaprenylglyceryl phosphate synthase 7.73e-07 2.24e-02 NA NA
5. P A5IU73 Heptaprenylglyceryl phosphate synthase 1.39e-05 3.63e-02 NA NA
5. P A1SL57 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.21e-08 1.38e-04 NA NA
5. P A9N831 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.73e-10 1.58e-04 NA NA
5. P A7X764 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.21e-09 6.31e-03 NA NA
5. P Q9X7C7 Indole-3-glycerol phosphate synthase 8.33e-10 2.21e-06 NA NA
5. P P76143 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 4.53e-05 4.36e-03 NA NA
5. P Q3V7P0 Pyridoxine 5'-phosphate synthase 2.21e-08 1.11e-02 NA NA
5. P B8DZP8 Tryptophan synthase alpha chain 3.97e-04 7.31e-05 NA NA
5. P Q73BQ9 Indole-3-glycerol phosphate synthase 1.45e-09 1.31e-04 NA NA
5. P Q03JB9 Indole-3-glycerol phosphate synthase 1.01e-09 1.00e-05 NA NA
5. P Q9PH84 Pyridoxine 5'-phosphate synthase 4.98e-07 4.84e-02 NA NA
5. P P62354 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.01e-08 1.35e-02 NA NA
5. P B7H7H5 Thiamine-phosphate synthase 4.19e-09 1.50e-03 NA NA
5. P A5TZE3 Thiazole synthase 5.87e-10 9.00e-03 NA NA
5. P A3N350 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.87e-10 9.95e-03 NA NA
5. P P26939 Indole-3-glycerol phosphate synthase 5.63e-09 6.16e-04 NA NA
5. P C5D3D6 Indole-3-glycerol phosphate synthase 2.86e-04 3.26e-03 NA NA
5. P B5F7J7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.63e-10 5.38e-05 NA NA
5. P Q9K192 Indole-3-glycerol phosphate synthase 4.74e-09 5.86e-04 NA NA
5. P B0UHP4 Thiazole synthase 1.04e-09 5.27e-03 NA NA
5. P B2U1W1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.32e-10 4.00e-07 NA NA
5. P O19904 Uncharacterized protein ycf23 5.20e-12 3.96e-07 NA NA
5. P A3DDS7 Indole-3-glycerol phosphate synthase 1.89e-09 1.12e-03 NA NA
5. P Q9CLF7 Uncharacterized aldolase PM1278 1.63e-07 6.06e-04 NA NA
5. P Q18DL2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.96e-09 3.73e-04 NA NA
5. P A3CTK2 Geranylgeranylglyceryl phosphate synthase 6.62e-06 2.38e-04 NA NA
5. P Q87UG3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.93e-09 2.33e-03 NA NA
5. P B0K628 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.30e-09 1.76e-02 NA NA
5. P A6TEB4 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 3.03e-05 8.08e-03 NA NA
5. P A6QID4 Heptaprenylglyceryl phosphate synthase 1.28e-05 3.35e-02 NA NA
5. P Q10ZM7 Indole-3-glycerol phosphate synthase 9.67e-09 3.16e-03 NA NA
5. P A9MNY8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.63e-10 2.74e-05 NA NA
5. P Q3Z989 3-dehydroquinate dehydratase 3.55e-07 2.51e-02 NA NA
5. P A5FPM3 Indole-3-glycerol phosphate synthase 1.83e-09 1.14e-04 NA NA
5. P O67506 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.04e-09 7.51e-07 NA NA
5. P Q46906 Uncharacterized protein YgcP 8.54e-09 6.81e-04 NA NA
5. P Q9XBM3 Indole-3-glycerol phosphate synthase 4.55e-09 1.89e-03 NA NA
5. P B0TQY9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.70e-10 4.31e-02 NA NA
5. P A3DN81 Geranylgeranylglyceryl phosphate synthase 4.65e-09 3.64e-03 NA NA
5. P B6YWA8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.64e-08 1.16e-03 NA NA
5. P Q4FND0 Tryptophan synthase alpha chain 1.66e-07 4.03e-04 NA NA
5. P C0RFX3 Imidazole glycerol phosphate synthase subunit HisF 3.65e-09 4.67e-02 NA NA
5. P P0A762 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.53e-10 4.00e-07 NA NA
5. P C3MBC2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.29e-08 3.00e-02 NA NA
5. P Q2KU99 Indole-3-glycerol phosphate synthase 2.10e-09 1.55e-02 NA NA
5. P Q4A094 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.09e-10 8.83e-06 NA NA
5. P Q92NT6 Pyridoxine 5'-phosphate synthase 1.24e-08 1.79e-02 NA NA
5. P D2QS27 Geranylgeranylglyceryl phosphate synthase 1.56e-09 1.60e-03 NA NA
5. P Q8TYD6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.34e-09 5.40e-04 NA NA
5. P B1ZNA6 Pyridoxine 5'-phosphate synthase 3.02e-08 4.06e-03 NA NA
5. P B8I0V0 Indole-3-glycerol phosphate synthase 4.89e-10 7.76e-06 NA NA
5. P Q63EC9 Indole-3-glycerol phosphate synthase 1.18e-09 6.82e-05 NA NA
5. P Q9PMQ6 Triosephosphate isomerase 5.17e-08 8.27e-03 NA NA
5. P P60581 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.46e-08 1.84e-05 NA NA
5. P Q723Y9 Thiamine-phosphate synthase 5.26e-09 1.55e-02 NA NA
5. P Q9WYG8 Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit 6.53e-09 1.26e-02 NA NA
5. P B0CJI6 Imidazole glycerol phosphate synthase subunit HisF 3.63e-09 4.88e-02 NA NA
5. P B4RCS1 Thiazole synthase 1.53e-09 6.22e-04 NA NA
5. P A2BY04 Indole-3-glycerol phosphate synthase 2.10e-08 2.64e-04 NA NA
5. P Q6GJZ8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.77e-10 6.22e-04 NA NA
5. P B7NKT4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.24e-10 7.73e-07 NA NA
5. P Q8Z2T5 Sulfofructosephosphate aldolase 1.31e-07 1.60e-03 NA NA
5. P P65517 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.71e-10 4.53e-04 NA NA
5. P Q9KR62 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.11e-10 1.16e-02 NA NA
5. P A7ZA58 Thiamine-phosphate synthase 9.08e-09 1.57e-02 NA NA
5. P P0DC69 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.67e-10 6.27e-04 NA NA
5. P Q7RXQ8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.14e-07 5.35e-03 NA NA
5. P A8FWD0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.06e-10 3.67e-03 NA NA
5. P Q2YU68 Heptaprenylglyceryl phosphate synthase 7.87e-07 4.00e-02 NA NA
5. P B7IM74 Indole-3-glycerol phosphate synthase 1.41e-09 7.44e-05 NA NA
5. P Q1JDM7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.66e-10 6.27e-04 NA NA
5. P A7FMK1 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.31e-07 3.32e-04 NA NA
5. P Q50757 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.65e-10 1.10e-02 NA NA
5. P P05194 3-dehydroquinate dehydratase 3.14e-09 1.42e-03 NA NA
5. P Q47QS4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.12e-08 2.66e-02 NA NA
5. P A5VBA0 Indole-3-glycerol phosphate synthase 1.81e-09 1.14e-04 NA NA
5. P Q7V7D2 Triosephosphate isomerase 4.01e-06 4.37e-02 NA NA
5. P Q1BSD2 Indole-3-glycerol phosphate synthase 2.47e-09 7.38e-05 NA NA
5. P A4FLL9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.82e-09 2.12e-03 NA NA
5. P Q7VU67 Indole-3-glycerol phosphate synthase 2.26e-09 4.10e-03 NA NA
5. P B5XSS5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.88e-10 6.82e-07 NA NA
5. P A4VZZ4 Triosephosphate isomerase 4.47e-05 2.72e-02 NA NA
5. P B4S9B0 Triosephosphate isomerase 1.60e-06 4.47e-02 NA NA
5. P A7NMZ8 Indole-3-glycerol phosphate synthase 1.63e-09 1.46e-04 NA NA
5. P Q5WJ32 Heptaprenylglyceryl phosphate synthase 3.71e-07 7.60e-03 NA NA
5. P Q04IY7 Indole-3-glycerol phosphate synthase 1.19e-09 4.54e-06 NA NA
5. P A1W035 Thiazole synthase 3.05e-09 1.38e-02 NA NA
5. P A6WP21 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.26e-10 1.35e-03 NA NA
5. P B7HT70 Thiamine-phosphate synthase 3.88e-09 1.75e-02 NA NA
5. P A7ZSB6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.26e-10 2.23e-06 NA NA
5. P B0RPJ1 Thiazole synthase 2.28e-09 2.60e-02 NA NA
5. P B8GJY2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.65e-09 1.51e-02 NA NA
5. P A3Q119 Indole-3-glycerol phosphate synthase 5.00e-10 5.41e-06 NA NA
5. P B7N529 3-dehydroquinate dehydratase 3.17e-09 8.72e-04 NA NA
5. P A8AW03 Indole-3-glycerol phosphate synthase 1.00e-09 5.44e-04 NA NA
5. P P64359 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.97e-09 6.31e-03 NA NA
5. P B8JDL2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.25e-09 4.74e-02 NA NA
5. P A6US29 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.92e-09 3.11e-02 NA NA
5. P B8F667 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.16e-10 9.55e-04 NA NA
5. P C3K6V2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.36e-09 2.59e-03 NA NA
5. P Q7WF72 Thiamine-phosphate synthase 5.93e-10 6.45e-03 NA NA
5. P A4TQL9 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.27e-07 6.92e-04 NA NA
5. P B9J2L5 Thiamine-phosphate synthase 3.95e-09 1.75e-02 NA NA
5. P Q8EWM9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.72e-10 1.62e-09 NA NA
5. P Q81Z95 Thiamine-phosphate synthase 4.16e-09 3.38e-02 NA NA
5. P Q8ZCG8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.87e-10 6.88e-05 NA NA
5. P A5CZ73 Imidazole glycerol phosphate synthase subunit HisF 1.62e-09 4.63e-02 NA NA
5. P Q8ESU2 Indole-3-glycerol phosphate synthase 1.74e-09 8.71e-05 NA NA
5. P A8A9K6 Geranylgeranylglyceryl phosphate synthase 2.70e-10 2.51e-04 NA NA
5. P Q9Y8T7 Indole-3-glycerol phosphate synthase 7.06e-09 2.22e-02 NA NA
5. P A6T4L2 3-dehydroquinate dehydratase 3.05e-08 5.58e-04 NA NA
5. P A2RKU2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.74e-10 1.45e-04 NA NA
5. P Q2FFI9 Heptaprenylglyceryl phosphate synthase 1.31e-05 3.61e-02 NA NA
5. P Q3ABS1 Indole-3-glycerol phosphate synthase 1.19e-09 9.09e-04 NA NA
5. P A5EK25 Indole-3-glycerol phosphate synthase 5.98e-09 6.32e-04 NA NA
5. P Q85G31 Thiazole synthase 2.18e-09 4.98e-02 NA NA
5. P B8E9A0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.17e-10 1.35e-03 NA NA
5. P Q87LP2 Pyridoxine 5'-phosphate synthase 1.83e-08 4.27e-02 NA NA
5. P A9M9R8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.22e-07 4.65e-03 NA NA
5. P B7I441 Indole-3-glycerol phosphate synthase 3.41e-09 6.01e-04 NA NA
5. P B5EHA6 Pyridoxine 5'-phosphate synthase 2.51e-08 7.09e-03 NA NA
5. P O26232 Orotidine 5'-phosphate decarboxylase 1.24e-10 2.69e-04 NA NA
5. P P71350 Thiamine-phosphate synthase 5.52e-08 1.43e-02 NA NA
5. P B5YIB4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.79e-09 2.01e-04 NA NA
5. P A1U5H6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.42e-09 1.38e-02 NA NA
5. P B2K3F7 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 2.03e-07 3.32e-04 NA NA
5. P Q71Z38 Indole-3-glycerol phosphate synthase 1.51e-09 4.58e-06 NA NA
5. P Q3KM32 Triosephosphate isomerase 3.15e-05 3.23e-02 NA NA
5. P Q8EMP6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.61e-10 1.17e-04 NA NA
5. P Q6B8L2 Tryptophan synthase alpha chain 1.08e-07 5.44e-03 NA NA
5. P Q7W3U2 Thiamine-phosphate synthase 3.56e-10 4.36e-03 NA NA
5. P P18304 Indole-3-glycerol phosphate synthase 1.96e-09 2.59e-03 NA NA
5. P Q8EFB5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.66e-10 2.82e-03 NA NA
5. P Q2N8I7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.10e-08 5.09e-04 NA NA
5. P B1LF98 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.59e-07 1.48e-02 NA NA
5. P A6UW70 Geranylgeranylglyceryl phosphate synthase 2.06e-04 5.09e-04 NA NA
5. P A4IJY4 Heptaprenylglyceryl phosphate synthase 5.82e-06 6.87e-03 NA NA
5. P Q2G157 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.71e-10 6.22e-04 NA NA
5. P B8GWN0 Thiazole synthase 2.25e-09 5.72e-04 NA NA
5. P Q46WU7 Indole-3-glycerol phosphate synthase 5.45e-09 2.67e-03 NA NA
5. P A1WH73 Indole-3-glycerol phosphate synthase 2.20e-09 3.86e-02 NA NA
5. P Q7N8D1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2 9.81e-09 4.68e-04 NA NA
5. P Q6LZE3 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.86e-09 1.60e-03 NA NA
5. P A5G8T0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.06e-08 4.20e-05 NA NA
5. P Q5NQ36 Indole-3-glycerol phosphate synthase 6.32e-09 1.45e-04 NA NA
5. P Q0HJ98 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.32e-10 1.66e-03 NA NA
5. P Q9L7R9 Sulfofructosephosphate aldolase 1.29e-07 1.69e-03 NA NA
5. P B9MKC6 Tryptophan synthase alpha chain 3.58e-04 1.11e-02 NA NA
5. P A9M2Q6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.02e-09 1.03e-02 NA NA
5. P Q9L6B4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.80e-10 7.25e-03 NA NA
5. P A5FFX7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.38e-10 3.82e-03 NA NA
5. P A1KSN7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.13e-08 7.54e-03 NA NA
5. P Q99SY1 Heptaprenylglyceryl phosphate synthase 6.72e-07 3.63e-02 NA NA
5. P A6QBN6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.67e-09 4.92e-04 NA NA
5. P Q0VPJ0 Tryptophan synthase alpha chain 5.87e-04 2.29e-02 NA NA
5. P A8ZZX0 Indole-3-glycerol phosphate synthase 1.62e-09 7.78e-05 NA NA
5. P B4SDV8 Indole-3-glycerol phosphate synthase 8.72e-10 2.17e-03 NA NA
5. P Q972A1 Indole-3-glycerol phosphate synthase 5.12e-10 4.34e-04 NA NA
5. P Q5PJE3 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.07e-07 1.74e-03 NA NA
5. P C4ZYF5 3-dehydroquinate dehydratase 3.05e-09 1.42e-03 NA NA
5. P A5ULP6 Triosephosphate isomerase 9.19e-10 4.90e-07 NA NA
5. P Q6G9I9 Indole-3-glycerol phosphate synthase 3.69e-09 2.41e-04 NA NA
5. P Q2YS94 3-hexulose-6-phosphate synthase 1.37e-12 4.03e-02 NA NA
5. P Q6HP17 Thiamine-phosphate synthase 4.06e-09 1.37e-02 NA NA
5. P A5G7P4 Thiazole synthase 1.04e-09 2.38e-02 NA NA
5. P Q7NUI6 Indole-3-glycerol phosphate synthase 5.26e-09 8.99e-06 NA NA
5. P Q81GG7 Indole-3-glycerol phosphate synthase 1.25e-09 5.40e-04 NA NA
5. P A1S6Z5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.49e-10 1.70e-02 NA NA
5. P B1JE34 Indole-3-glycerol phosphate synthase 4.26e-09 5.05e-04 NA NA
5. P Q8ZKQ0 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.05e-07 1.68e-03 NA NA
5. P Q319J2 Indole-3-glycerol phosphate synthase 1.14e-08 4.43e-03 NA NA
5. P A6UTT2 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 2.20e-09 3.81e-05 NA NA
5. P Q4L677 Indole-3-glycerol phosphate synthase 2.51e-09 4.67e-05 NA NA
5. P A8LGR8 Indole-3-glycerol phosphate synthase 6.37e-10 3.08e-05 NA NA
5. P B4S3G9 Pyridoxine 5'-phosphate synthase 7.33e-08 6.98e-03 NA NA
5. P Q47QR5 Indole-3-glycerol phosphate synthase 9.97e-10 7.12e-08 NA NA
5. P A9BHQ5 Indole-3-glycerol phosphate synthase 2.81e-09 2.67e-03 NA NA
5. P A5GMK4 Indole-3-glycerol phosphate synthase 1.34e-08 6.92e-03 NA NA
5. P A4QEG0 Triosephosphate isomerase 4.67e-05 1.27e-02 NA NA
5. P A7HSH0 Imidazole glycerol phosphate synthase subunit HisF 4.42e-09 3.30e-02 NA NA
5. P Q8TXM0 Geranylgeranylglyceryl phosphate synthase 4.89e-10 8.91e-06 NA NA
5. P P66991 Indole-3-glycerol phosphate synthase 2.30e-09 1.75e-04 NA NA
5. P A5VXL5 Indole-3-glycerol phosphate synthase 5.00e-09 3.26e-04 NA NA
5. P A7H2Z6 Thiazole synthase 3.35e-09 1.63e-02 NA NA
5. P P30300 Glycerol uptake operon antiterminator regulatory protein 1.34e-09 8.79e-05 NA NA
5. P A4JB67 Indole-3-glycerol phosphate synthase 4.66e-09 5.43e-05 NA NA
5. P Q38V36 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.75e-10 7.19e-05 NA NA
5. P Q9PNP6 Thiazole synthase 2.35e-09 1.74e-02 NA NA
5. P B3DRW0 Triosephosphate isomerase 4.08e-05 2.98e-02 NA NA
5. P Q939I2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.57e-10 3.59e-07 NA NA
5. P Q9RL78 Indole-3-glycerol phosphate synthase 3.82e-09 7.27e-04 NA NA
5. P B4RPF1 Indole-3-glycerol phosphate synthase 4.09e-09 7.25e-03 NA NA
5. P B3QPB1 Tryptophan synthase alpha chain 2.57e-07 1.56e-03 NA NA
5. P O74067 Triosephosphate isomerase 1.00e-09 5.17e-06 NA NA
5. P Q12X87 Orotidine 5'-phosphate decarboxylase 1.21e-10 3.26e-03 NA NA
5. P B1YJ15 Heptaprenylglyceryl phosphate synthase 6.06e-07 1.53e-04 NA NA
5. P C0QRW6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.01e-08 2.91e-02 NA NA
5. P A9BS06 Indole-3-glycerol phosphate synthase 3.23e-09 8.21e-03 NA NA
5. P O34790 Heptaprenylglyceryl phosphate synthase 3.58e-07 2.19e-03 NA NA
5. P Q06121 Indole-3-glycerol phosphate synthase 6.55e-10 9.00e-03 NA NA
5. P P20577 Indole-3-glycerol phosphate synthase 8.67e-09 1.57e-05 NA NA
5. P A7MX07 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.78e-09 1.38e-02 NA NA
5. P C1KVS7 Indole-3-glycerol phosphate synthase 1.98e-09 4.58e-06 NA NA
5. P A0RQL2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.62e-09 6.95e-06 NA NA
5. P A7ZEZ4 Triosephosphate isomerase 3.08e-08 1.89e-03 NA NA
5. P C5B754 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.23e-10 1.42e-05 NA NA
5. P A8Z2S0 Heptaprenylglyceryl phosphate synthase 1.28e-05 3.61e-02 NA NA
5. P Q9CC56 Phosphoribosyl isomerase A 1.03e-08 2.11e-02 NA NA
5. P B3CLF3 Pyridoxine 5'-phosphate synthase 8.21e-08 4.96e-04 NA NA
5. P Q1C134 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.29e-07 6.92e-04 NA NA
5. P B9JX64 Indole-3-glycerol phosphate synthase 5.37e-09 2.31e-05 NA NA
5. P B0SBH6 Pyridoxine 5'-phosphate synthase 7.21e-08 2.85e-02 NA NA
5. P A4QH48 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.58e-10 5.87e-05 NA NA
5. P Q96YZ9 Triosephosphate isomerase 8.47e-10 6.22e-04 NA NA
5. P P51373 Uncharacterized protein ycf23 3.51e-12 4.92e-04 NA NA
5. P P36187 Triosephosphate isomerase 2.28e-06 1.89e-03 NA NA
5. P A3CV22 Triosephosphate isomerase 2.29e-10 8.79e-05 NA NA
5. P A7FU80 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.56e-09 3.66e-02 NA NA
5. P Q9Z4X0 Indole-3-glycerol phosphate synthase 2 3.19e-10 2.54e-06 NA NA
5. P Q2FH66 Indole-3-glycerol phosphate synthase 3.59e-09 2.41e-04 NA NA
5. P B9DJG9 3-dehydroquinate dehydratase 2.05e-08 1.16e-02 NA NA
5. P A0JVL1 Indole-3-glycerol phosphate synthase 6.95e-10 2.29e-05 NA NA
5. P Q1XDB4 Uncharacterized protein ycf23 5.86e-12 7.54e-03 NA NA
5. P A9A8T4 Geranylgeranylglyceryl phosphate synthase 1.67e-04 6.16e-04 NA NA
5. P Q8THB0 Triosephosphate isomerase 4.37e-10 2.25e-06 NA NA
5. P Q2YXU9 Indole-3-glycerol phosphate synthase 3.60e-09 7.90e-04 NA NA
5. P B1YRW0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.48e-09 4.03e-02 NA NA
5. P Q2YQY9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.93e-08 4.65e-03 NA NA
5. P Q21SE8 Indole-3-glycerol phosphate synthase 2.44e-09 1.45e-04 NA NA
5. P B5Y1W9 3-dehydroquinate dehydratase 2.19e-08 3.70e-04 NA NA
5. P Q2FJU6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.80e-10 6.22e-04 NA NA
5. P Q48NP7 Indole-3-glycerol phosphate synthase 5.75e-09 1.64e-05 NA NA
5. P Q0T478 3-dehydroquinate dehydratase 3.08e-09 2.17e-03 NA NA
5. P P03964 Indole-3-glycerol phosphate synthase 1.62e-09 2.25e-06 NA NA
5. P B0R3Y0 Fructose-bisphosphate aldolase class 1 1.07e-09 1.18e-05 NA NA
5. P Q0BIM8 Indole-3-glycerol phosphate synthase 2.63e-09 4.24e-05 NA NA
5. P A6U1J5 Tryptophan synthase alpha chain 7.57e-05 2.43e-02 NA NA
5. P Q7TTU3 Indole-3-glycerol phosphate synthase 4.53e-09 3.34e-03 NA NA
5. P Q6G827 Heptaprenylglyceryl phosphate synthase 1.21e-05 3.35e-02 NA NA
5. P A0QQL0 Thiazole synthase 1.03e-09 2.87e-02 NA NA
5. P Q65M66 3-dehydroquinate dehydratase 3.38e-09 1.13e-02 NA NA
5. P Q7W2Y0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.06e-09 1.62e-02 NA NA
5. P B3W6W8 Indole-3-glycerol phosphate synthase 1.29e-09 2.36e-04 NA NA
5. P P9WG72 Thiazole synthase 8.75e-10 1.36e-02 NA NA
5. P A8MCN3 Triosephosphate isomerase 3.33e-10 1.24e-06 NA NA
5. P A8FAP9 Heptaprenylglyceryl phosphate synthase 6.00e-07 1.26e-03 NA NA
5. P C0RFX2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.69e-08 4.65e-03 NA NA
5. P Q8XVE6 Indole-3-glycerol phosphate synthase 1 5.54e-09 1.11e-02 NA NA
5. P A3NDZ3 Indole-3-glycerol phosphate synthase 2.42e-09 1.32e-04 NA NA
5. P Q5P2G1 Indole-3-glycerol phosphate synthase 4.66e-09 5.22e-04 NA NA
5. P A6USC8 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.62e-09 5.31e-04 NA NA
5. P Q5YNQ2 Thiazole synthase 6.32e-10 1.23e-02 NA NA
5. P Q7A774 3-hexulose-6-phosphate synthase 1.38e-12 3.33e-02 NA NA
5. P P65519 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.93e-10 1.97e-08 NA NA
5. P A5U2E0 Triosephosphate isomerase 4.81e-05 3.25e-02 NA NA
5. P P60583 Phosphoribosyl isomerase A 8.53e-09 2.91e-02 NA NA
5. P P59441 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.11e-10 1.62e-04 NA NA
5. P Q11CK8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.54e-08 3.85e-03 NA NA
5. P P59457 Tryptophan synthase alpha chain 1.47e-05 1.91e-02 NA NA
5. P B9JFD8 Indole-3-glycerol phosphate synthase 6.75e-09 9.39e-04 NA NA
5. P B5Y6I1 Thiamine-phosphate synthase 1.09e-09 2.49e-02 NA NA
5. P B4EZY9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.13e-10 1.06e-05 NA NA
5. P B8ZN61 Indole-3-glycerol phosphate synthase 1.42e-09 5.07e-06 NA NA
5. P B6EGV5 Thiazole synthase 4.06e-10 8.47e-03 NA NA
5. P Q5V138 Indole-3-glycerol phosphate synthase 7.23e-09 4.27e-04 NA NA
5. P Q82A84 Indole-3-glycerol phosphate synthase 1.25e-10 3.04e-06 NA NA
5. P Q92EW5 Thiamine-phosphate synthase 5.75e-09 1.07e-02 NA NA
5. P Q3K3Z4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.19e-10 2.83e-08 NA NA
5. P A0LJ58 Indole-3-glycerol phosphate synthase 7.57e-10 6.82e-05 NA NA
5. P A5VT43 Imidazole glycerol phosphate synthase subunit HisF 3.58e-09 4.88e-02 NA NA
5. P C1KW59 Heptaprenylglyceryl phosphate synthase 4.93e-06 2.03e-02 NA NA
5. P B8ZRB9 Indole-3-glycerol phosphate synthase 5.09e-10 2.21e-06 NA NA
5. P B5ED95 Thiazole synthase 1.04e-09 1.35e-02 NA NA
5. P B9E149 Indole-3-glycerol phosphate synthase 6.32e-09 6.75e-04 NA NA
5. P A6Q1C9 Thiazole synthase 1.36e-10 1.70e-02 NA NA
5. P A0LTS5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-08 2.87e-04 NA NA
5. P A1KAT2 Indole-3-glycerol phosphate synthase 5.20e-09 4.80e-04 NA NA
5. P A1B387 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.84e-09 1.42e-03 NA NA
5. P Q6F7A5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.98e-09 3.88e-02 NA NA
5. P Q2J8L2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.04e-08 3.63e-02 NA NA
5. P A6TVU7 Thiazole synthase 5.53e-10 1.67e-02 NA NA
5. P Q2GJT4 Pyridoxine 5'-phosphate synthase 2.26e-08 2.60e-02 NA NA
5. P Q9HLB6 Triosephosphate isomerase 3.03e-08 1.25e-05 NA NA
5. P Q51843 Pyridoxine 5'-phosphate synthase 6.65e-08 4.40e-02 NA NA
5. P Q4K503 Indole-3-glycerol phosphate synthase 5.41e-09 2.94e-05 NA NA
5. P C0R576 Pyridoxine 5'-phosphate synthase 4.35e-08 2.10e-03 NA NA
5. P B3GX82 Thiamine-phosphate synthase 4.32e-08 1.45e-02 NA NA
5. P B4UDJ9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.17e-09 4.74e-02 NA NA
5. P P9WFX7 Indole-3-glycerol phosphate synthase 4.23e-10 3.60e-06 NA NA
5. P B6JG29 Indole-3-glycerol phosphate synthase 3.66e-09 2.41e-04 NA NA
5. P Q2FYR3 Tryptophan synthase alpha chain 7.13e-05 3.40e-02 NA NA
5. P Q0I131 Thiamine-phosphate synthase 2.42e-08 2.70e-02 NA NA
5. P B0SYZ4 Indole-3-glycerol phosphate synthase 8.43e-10 2.61e-03 NA NA
5. P A7WXZ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.75e-10 4.53e-04 NA NA
5. P B2FKL1 Indole-3-glycerol phosphate synthase 4.82e-09 1.57e-04 NA NA
5. P Q9LBW4 3-hexulose-6-phosphate synthase 1.74e-11 5.49e-04 NA NA
5. P A3PHK7 Indole-3-glycerol phosphate synthase 3.13e-09 5.53e-04 NA NA
5. P Q8CPB2 Indole-3-glycerol phosphate synthase 3.42e-09 2.97e-04 NA NA
5. P Q8D8Q4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.11e-09 6.71e-03 NA NA
5. P C0Z4C0 Heptaprenylglyceryl phosphate synthase 1.07e-05 1.10e-02 NA NA
5. P Q82A81 Tryptophan synthase alpha chain 4.17e-08 1.38e-02 NA NA
5. P Q8Y6C8 Heptaprenylglyceryl phosphate synthase 3.60e-06 3.50e-02 NA NA
5. P Q6GCF3 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.79e-10 2.25e-04 NA NA
5. P Q3BQ15 Thiazole synthase 2.15e-09 2.70e-02 NA NA
5. P Q8F7V2 Indole-3-glycerol phosphate synthase 7.06e-10 3.05e-05 NA NA
5. P A0LA39 Indole-3-glycerol phosphate synthase 1.74e-09 1.30e-05 NA NA
5. P A7Z618 Indole-3-glycerol phosphate synthase 1.42e-09 8.56e-05 NA NA
5. P B1XSZ1 Indole-3-glycerol phosphate synthase 2.89e-09 2.10e-02 NA NA
5. P Q11HU1 Indole-3-glycerol phosphate synthase 6.96e-09 3.96e-04 NA NA
5. P Q12VH4 Geranylgeranylglyceryl phosphate synthase 2.26e-10 4.21e-02 NA NA
5. P Q1ISJ1 Indole-3-glycerol phosphate synthase 2.47e-09 4.60e-04 NA NA
5. P Q12UK2 Triosephosphate isomerase 2.53e-10 3.88e-05 NA NA
5. P Q0W6K5 Geranylgeranylglyceryl phosphate synthase 7.42e-07 5.48e-03 NA NA
5. P Q5V4J7 Triosephosphate isomerase 1.17e-09 2.03e-03 NA NA
5. P Q02YU5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.65e-10 1.20e-04 NA NA
5. P P40545 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.66e-07 3.40e-02 NA NA
5. P B3E618 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.12e-08 1.18e-05 NA NA
5. P A1KRV4 Indole-3-glycerol phosphate synthase 4.31e-09 3.82e-03 NA NA
5. P B8EM84 Imidazole glycerol phosphate synthase subunit HisF 7.50e-10 2.12e-03 NA NA
5. P C4XSN4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.41e-08 2.18e-02 NA NA
5. P Q13E39 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.11e-08 2.43e-03 NA NA
5. P A3PI63 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.79e-09 3.40e-04 NA NA
5. P Q311P4 Thiazole synthase 1.48e-09 9.50e-03 NA NA
5. P Q39YP3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.68e-08 3.58e-05 NA NA
5. P Q9X0C7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.04e-07 5.77e-04 NA NA
5. P Q8RDN5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.55e-11 4.02e-06 NA NA
5. P A5GSQ4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.08e-09 2.85e-02 NA NA
5. P Q73EM5 Heptaprenylglyceryl phosphate synthase 4.46e-07 1.57e-04 NA NA
5. P Q9KSW9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.95e-09 4.84e-02 NA NA
5. P Q5NMD5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.62e-08 5.77e-04 NA NA
5. P A6WX53 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.80e-08 5.35e-03 NA NA
5. P P65521 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2 3.12e-10 7.36e-07 NA NA
5. P B7NDK1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.53e-10 4.00e-07 NA NA
5. P Q1B7G8 Phosphoribosyl isomerase A 1.25e-08 6.11e-03 NA NA
5. P A9L4B9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.33e-10 3.73e-04 NA NA
5. P Q63QH0 Indole-3-glycerol phosphate synthase 2.26e-09 1.53e-04 NA NA
5. P O29828 Uncharacterized protein AF_0419 1.58e-09 6.66e-03 NA NA
5. P Q1D4M2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.64e-09 2.10e-03 NA NA
5. P C1ANN3 Indole-3-glycerol phosphate synthase 4.87e-10 3.60e-06 NA NA
5. P A1W2Z8 Indole-3-glycerol phosphate synthase 3.65e-09 1.92e-03 NA NA
5. P A1UWA0 Indole-3-glycerol phosphate synthase 3.50e-09 1.91e-04 NA NA
5. P Q9HK02 Indole-3-glycerol phosphate synthase 1.14e-06 1.23e-04 NA NA
5. P Q3AV87 Indole-3-glycerol phosphate synthase 1.01e-08 2.24e-02 NA NA
5. P A9M5F4 Indole-3-glycerol phosphate synthase 4.96e-09 6.32e-04 NA NA
5. P C4XI54 Tryptophan synthase alpha chain 2.80e-04 8.87e-03 NA NA
5. P Q2KTT2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.06e-09 5.11e-03 NA NA
5. P B9KPC9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.73e-09 3.40e-04 NA NA
5. P Q98ME3 Indole-3-glycerol phosphate synthase 1.28e-08 3.52e-04 NA NA
5. P Q9K0H3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.19e-08 3.74e-02 NA NA
5. P Q13TW4 Indole-3-glycerol phosphate synthase 7.48e-09 7.71e-05 NA NA
5. P A4YGQ6 Triosephosphate isomerase 5.92e-10 3.37e-04 NA NA
5. P Q5PG85 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 1.55e-10 9.94e-06 NA NA
5. P Q8Y3N4 Putative N-acetylmannosamine-6-phosphate 2-epimerase 6.71e-10 2.07e-05 NA NA
5. P B9MBS5 Indole-3-glycerol phosphate synthase 2.86e-09 2.34e-02 NA NA
5. P B3QLY7 Indole-3-glycerol phosphate synthase 3.60e-10 1.92e-03 NA NA
5. P P72776 Pyridoxine 5'-phosphate synthase 2.60e-08 3.07e-02 NA NA
5. P A6WC54 Triosephosphate isomerase 3.72e-05 4.84e-02 NA NA
5. P B4S4Z8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.38e-08 2.78e-02 NA NA
5. P B5YD09 Tryptophan synthase alpha chain 4.05e-05 2.37e-05 NA NA
5. P B1IRU3 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.69e-07 7.72e-03 NA NA
5. P B7MBY5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.50e-10 4.00e-07 NA NA
5. P Q5XDY5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.79e-10 1.40e-04 NA NA
5. P A4VHK1 Indole-3-glycerol phosphate synthase 3.82e-09 3.98e-05 NA NA
5. P Q12WC6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.93e-10 2.31e-02 NA NA
5. P Q9UZN7 Geranylgeranylglyceryl phosphate synthase 2.26e-10 1.07e-02 NA NA
5. P C1D7J7 Indole-3-glycerol phosphate synthase 1.83e-09 9.67e-06 NA NA
5. P Q215B9 Indole-3-glycerol phosphate synthase 5.50e-09 9.09e-04 NA NA
5. P Q9HSB8 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase 1.99e-10 1.30e-03 NA NA
5. P A8G6A7 Indole-3-glycerol phosphate synthase 3.97e-09 8.21e-03 NA NA
5. P Q8TLP4 Tryptophan synthase alpha chain 5.48e-08 2.08e-02 NA NA
5. P P58791 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-07 5.79e-03 NA NA
5. P C5BV85 Indole-3-glycerol phosphate synthase 8.61e-10 2.04e-05 NA NA
5. P B1MBX5 Phosphoribosyl isomerase A 8.88e-09 4.99e-03 NA NA
5. P A2CB59 Indole-3-glycerol phosphate synthase 3.38e-09 1.81e-04 NA NA
5. P A0RB62 Indole-3-glycerol phosphate synthase 1.21e-09 2.29e-05 NA NA
5. P Q4ZLQ1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.12e-09 1.90e-02 NA NA
5. P B1JLQ4 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.25e-07 3.32e-04 NA NA
5. P Q62DD0 Indole-3-glycerol phosphate synthase 3.96e-09 1.91e-04 NA NA
5. P Q8PV88 Orotidine 5'-phosphate decarboxylase 8.53e-11 4.36e-03 NA NA
5. P A6TM74 Indole-3-glycerol phosphate synthase 1.82e-09 3.91e-05 NA NA
5. P Q0SMK9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.78e-10 2.41e-04 NA NA
5. P B0SDS6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.54e-09 3.34e-03 NA NA
5. P A8H5E4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.72e-10 4.40e-02 NA NA
5. P A1BE95 Pyridoxine 5'-phosphate synthase 7.94e-08 4.43e-02 NA NA
5. P P26720 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.22e-08 8.73e-03 NA NA
5. P Q8KU93 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.86e-10 2.24e-07 NA NA
5. P B1WQE4 Indole-3-glycerol phosphate synthase 1.25e-08 7.40e-04 NA NA
5. P Q8PD70 Indole-3-glycerol phosphate synthase 6.90e-09 6.82e-05 NA NA
5. P Q8DVF5 Indole-3-glycerol phosphate synthase 8.77e-10 1.41e-05 NA NA
5. P B1HTW4 Heptaprenylglyceryl phosphate synthase 4.10e-07 1.12e-03 NA NA
5. P P50921 Triosephosphate isomerase 5.13e-05 3.21e-02 NA NA
5. P C1D7L7 Pyridoxine 5'-phosphate synthase 5.47e-08 3.09e-02 NA NA
5. P Q97AR4 Geranylgeranylglyceryl phosphate synthase 4.74e-10 3.55e-04 NA NA
5. P C6BSE3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 5.44e-09 9.87e-04 NA NA
5. P P60582 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.55e-08 2.60e-02 NA NA
5. P Q1J8K5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.78e-10 7.34e-04 NA NA
5. P Q4JAS3 Geranylgeranylglyceryl phosphate synthase 1.64e-04 9.63e-04 NA NA
5. P P66988 Indole-3-glycerol phosphate synthase 5.09e-09 6.32e-04 NA NA
5. P C3MCF2 Indole-3-glycerol phosphate synthase 7.39e-09 6.81e-04 NA NA
5. P Q10184 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.07e-07 1.94e-03 NA NA
5. P P65516 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.73e-10 4.53e-04 NA NA
5. P B0K2U1 Indole-3-glycerol phosphate synthase 1.63e-09 2.00e-05 NA NA
5. P Q1CJY8 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.91e-10 6.88e-05 NA NA
5. P B5YSV0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.52e-10 7.88e-07 NA NA
5. P Q58647 Geranylgeranylglyceryl phosphate synthase 1.62e-04 2.71e-04 NA NA
5. P B9DIJ5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.32e-10 4.58e-06 NA NA
5. P A1RXV6 Geranylgeranylglyceryl phosphate synthase 2.92e-10 1.77e-04 NA NA
5. P C4LFI3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.26e-09 3.04e-02 NA NA
5. P Q0SSM0 Thiazole synthase 5.47e-10 1.27e-02 NA NA
5. P A5IG82 Indole-3-glycerol phosphate synthase 3.81e-09 3.89e-04 NA NA
5. P Q8DLN9 Tryptophan synthase alpha chain 1.81e-08 3.35e-02 NA NA
5. P A1AGB7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.31e-10 4.00e-07 NA NA
5. P Q9A230 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.17e-08 1.83e-04 NA NA
5. P Q5YTQ6 Triosephosphate isomerase 5.03e-05 1.54e-02 NA NA
5. P B1XHJ6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.54e-10 4.00e-07 NA NA
5. P A1T8W5 Phosphoribosyl isomerase A 1.67e-08 2.87e-03 NA NA
5. P B2I6S5 Indole-3-glycerol phosphate synthase 4.84e-09 4.31e-04 NA NA
5. P B9LAE4 Pyridoxine 5'-phosphate synthase 7.72e-08 2.83e-02 NA NA
5. P Q8Z2X9 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.14e-07 1.98e-03 NA NA
5. P Q01999 Indole-3-glycerol phosphate synthase 1.20e-09 4.33e-06 NA NA
5. P A4SG41 Indole-3-glycerol phosphate synthase 7.67e-10 3.02e-05 NA NA
5. P A6QDV0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.71e-10 6.22e-04 NA NA
5. P B1JFV9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.96e-10 5.77e-05 NA NA
5. P Q2JP46 Pyridoxine 5'-phosphate synthase 3.46e-08 1.62e-02 NA NA
5. P Q21NH6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.62e-09 7.78e-03 NA NA
5. P O74044 Triosephosphate isomerase 1.42e-09 1.81e-06 NA NA
5. P A8ZUC6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.39e-08 9.29e-03 NA NA
5. P B3QQ93 Pyridoxine 5'-phosphate synthase 5.62e-08 2.47e-02 NA NA
5. P A0PP28 Indole-3-glycerol phosphate synthase 4.59e-10 4.06e-06 NA NA
5. P Q48VD6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.68e-10 6.27e-04 NA NA
5. P A7H5C4 Triosephosphate isomerase 1.47e-04 8.34e-03 NA NA
5. P Q3ZZ14 Indole-3-glycerol phosphate synthase 1.39e-09 1.75e-04 NA NA
5. P A9MZG5 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.07e-07 1.04e-03 NA NA
5. P A8A070 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.69e-07 7.72e-03 NA NA
5. P C1CMD5 Indole-3-glycerol phosphate synthase 2.00e-09 5.07e-06 NA NA
5. P Q30SM1 Indole-3-glycerol phosphate synthase 5.38e-10 2.92e-04 NA NA
5. P Q1CN19 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.35e-07 6.92e-04 NA NA
5. P Q8AAD6 Indole-3-glycerol phosphate synthase 8.13e-09 2.19e-04 NA NA
5. P Q9PI11 Indole-3-glycerol phosphate synthase 4.00e-10 2.89e-03 NA NA
5. P O27694 Indole-3-glycerol phosphate synthase 4.53e-09 2.39e-03 NA NA
5. P Q0IC57 Indole-3-glycerol phosphate synthase 4.13e-09 2.20e-03 NA NA
5. P Q0SHY5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.87e-09 3.86e-02 NA NA
5. P Q8P632 Thiazole synthase 2.35e-09 2.60e-02 NA NA
5. P B8FUD4 Thiamine-phosphate synthase 4.74e-10 4.18e-02 NA NA
5. P Q7VSY7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.47e-09 1.62e-02 NA NA
5. P A8LGR0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.51e-09 1.26e-02 NA NA
5. P B0K8T4 Indole-3-glycerol phosphate synthase 1.72e-09 3.68e-05 NA NA
5. P A0PYE7 3-dehydroquinate dehydratase 5.48e-09 1.13e-02 NA NA
5. P A9HWC3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.83e-09 2.24e-02 NA NA
5. P C3L627 Thiamine-phosphate synthase 4.11e-09 3.38e-02 NA NA
5. P A7X240 Tryptophan synthase alpha chain 7.88e-05 2.43e-02 NA NA
5. P B1XSV2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.15e-08 1.75e-02 NA NA
5. P Q6GH32 Tryptophan synthase alpha chain 6.83e-05 4.40e-02 NA NA
5. P Q39UG0 Pyridoxine 5'-phosphate synthase 3.93e-08 2.03e-02 NA NA
5. P O30724 Imidazole glycerol phosphate synthase subunit HisF 4.20e-09 1.11e-02 NA NA
5. P A7GKI9 Heptaprenylglyceryl phosphate synthase 5.77e-07 6.56e-03 NA NA
5. P B5XJP1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.60e-10 7.77e-04 NA NA
5. P Q02TB5 Indole-3-glycerol phosphate synthase 4.72e-09 1.19e-05 NA NA
5. P Q87QK7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.68e-09 8.60e-03 NA NA
5. P Q97U03 Uncharacterized aldolase SSO3226 2.70e-09 1.93e-04 NA NA
5. P Q6HP96 Heptaprenylglyceryl phosphate synthase 4.56e-07 2.38e-04 NA NA
5. P B0JTM2 Indole-3-glycerol phosphate synthase 9.51e-09 2.45e-02 NA NA
5. P Q5PH79 3-dehydroquinate dehydratase 3.49e-09 8.40e-03 NA NA
5. P P60668 Putative N-acetylmannosamine-6-phosphate 2-epimerase 9.45e-11 1.18e-05 NA NA
5. P P46212 Pyridoxine 5'-phosphate synthase (Fragment) 6.02e-08 1.36e-02 NA NA
5. P A5UGT0 Thiamine-phosphate synthase 3.94e-08 1.97e-02 NA NA
5. P Q97VM8 Triosephosphate isomerase 6.63e-10 2.15e-04 NA NA
5. P Q8ZX28 Triosephosphate isomerase 1.30e-10 1.08e-06 NA NA
5. P P66941 Triosephosphate isomerase 5.01e-05 3.25e-02 NA NA
5. P B1JED2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.50e-09 2.26e-02 NA NA
5. P A6WC91 Indole-3-glycerol phosphate synthase 7.78e-10 3.45e-05 NA NA
5. P B0UHR6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.84e-08 2.34e-04 NA NA
5. P A7H4P0 Indole-3-glycerol phosphate synthase 4.37e-10 3.16e-03 NA NA
5. P P66990 Indole-3-glycerol phosphate synthase 3.37e-09 1.75e-04 NA NA
5. P P16250 Phosphoribosyl isomerase A 9.04e-09 3.82e-03 NA NA
5. P A1JJ51 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.70e-07 3.93e-04 NA NA
5. P Q58328 Indole-3-glycerol phosphate synthase 6.02e-10 2.65e-03 NA NA
5. P A2C9H8 Triosephosphate isomerase 4.07e-05 1.84e-02 NA NA
5. P Q11VM2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.24e-10 6.11e-03 NA NA
5. P O51589 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.30e-10 9.71e-04 NA NA
5. P Q5N1J0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.01e-11 6.12e-08 NA NA
5. P Q8PQ47 Indole-3-glycerol phosphate synthase 7.67e-09 2.43e-04 NA NA
5. P Q0C639 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.93e-08 4.80e-06 NA NA
5. P Q74AI3 Tryptophan synthase alpha chain 7.08e-04 1.25e-02 NA NA
5. P A6QGS5 Tryptophan synthase alpha chain 6.47e-05 3.40e-02 NA NA
5. P Q7VKN0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.22e-10 5.58e-04 NA NA
5. P A4J147 Indole-3-glycerol phosphate synthase 3.05e-09 1.18e-03 NA NA
5. P Q82SJ7 Pyridoxine 5'-phosphate synthase 2.78e-08 3.88e-02 NA NA
5. P Q7MA77 Triosephosphate isomerase 6.09e-06 4.15e-02 NA NA
5. P Q9CF39 3-dehydroquinate dehydratase 1.35e-03 3.23e-03 NA NA
5. P Q2SUI0 Indole-3-glycerol phosphate synthase 2.46e-09 1.03e-04 NA NA
5. P A6VHZ5 Geranylgeranylglyceryl phosphate synthase 1.71e-04 1.19e-03 NA NA
5. P Q3B2C7 Indole-3-glycerol phosphate synthase 2.44e-09 4.75e-05 NA NA
5. P Q8PT96 Tryptophan synthase alpha chain 3.89e-08 2.55e-02 NA NA
5. P P36186 Triosephosphate isomerase 2.20e-06 1.29e-02 NA NA
5. P C4KZ66 Indole-3-glycerol phosphate synthase 4.79e-09 2.53e-05 NA NA
5. P Q2FYR6 Indole-3-glycerol phosphate synthase 4.09e-09 2.41e-04 NA NA
5. P B8IPH4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.93e-08 1.30e-04 NA NA
5. P B4RJN4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.48e-08 2.18e-02 NA NA
5. P Q2RT48 Indole-3-glycerol phosphate synthase 2.55e-09 1.92e-03 NA NA
5. P P64360 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.05e-08 6.31e-03 NA NA
5. P Q8NUI2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 9.03e-09 3.36e-03 NA NA
5. P A7Z259 Heptaprenylglyceryl phosphate synthase 5.34e-07 2.37e-03 NA NA
5. P Q8CRT8 Heptaprenylglyceryl phosphate synthase 1.13e-05 1.45e-02 NA NA
5. P A4YHD8 Indole-3-glycerol phosphate synthase 2.57e-10 3.10e-04 NA NA
5. P Q1C5U6 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.95e-10 6.88e-05 NA NA
5. P Q8DGQ5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 5.85e-11 4.21e-06 NA NA
5. P Q8XAZ1 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.61e-07 9.47e-04 NA NA
5. P Q63GS5 Heptaprenylglyceryl phosphate synthase 5.25e-07 6.22e-04 NA NA
5. P Q1GEZ5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2 1.80e-08 2.57e-04 NA NA
5. P Q8ZCP4 Pyridoxine 5'-phosphate synthase 2.24e-08 1.11e-02 NA NA
5. P Q3AL94 Indole-3-glycerol phosphate synthase 3.64e-09 5.97e-03 NA NA
5. P A1UFP1 Triosephosphate isomerase 4.82e-05 3.94e-02 NA NA
5. P Q9CGC2 Putative N-acetylmannosamine-6-phosphate 2-epimerase 4.73e-10 1.75e-05 NA NA
5. P Q6A6A0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.74e-10 1.00e-07 NA NA
5. P Q0VM71 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.38e-09 2.45e-02 NA NA
5. P A4FZ85 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.17e-09 1.65e-02 NA NA
5. P A9VRG1 Heptaprenylglyceryl phosphate synthase 4.89e-07 3.13e-03 NA NA
5. P B4S6H5 Tryptophan synthase alpha chain 1.70e-07 2.83e-02 NA NA
5. P Q4FUV3 Pyridoxine 5'-phosphate synthase 7.68e-08 8.23e-04 NA NA
5. P P60580 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.80e-09 2.28e-02 NA NA
5. P Q0SWI9 Putative N-acetylmannosamine-6-phosphate 2-epimerase 9.89e-11 1.36e-04 NA NA
5. P Q8YE37 Imidazole glycerol phosphate synthase subunit HisF 3.66e-09 4.67e-02 NA NA
5. P C4ZSW1 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.47e-10 4.00e-07 NA NA
5. P Q5HRH7 3-hexulose-6-phosphate synthase 1.38e-12 1.40e-02 NA NA
5. P Q4L3P8 3-hexulose-6-phosphate synthase 8.23e-13 4.27e-02 NA NA
5. P B1GZC0 Indole-3-glycerol phosphate synthase 5.40e-10 5.38e-05 NA NA
5. P B5FDA3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.86e-09 2.08e-02 NA NA
5. P Q6AE15 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.30e-09 4.20e-04 NA NA
5. P Q3JNB0 Indole-3-glycerol phosphate synthase 2.81e-09 7.78e-05 NA NA
5. P Q2J341 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.02e-08 5.11e-03 NA NA
5. P A1VYK3 Indole-3-glycerol phosphate synthase 4.49e-10 1.53e-03 NA NA
5. P C3K307 Indole-3-glycerol phosphate synthase 6.27e-09 1.76e-05 NA NA
5. P B2S983 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.21e-07 4.65e-03 NA NA
5. P A7INK2 Indole-3-glycerol phosphate synthase 2.90e-09 2.23e-04 NA NA
5. P Q1XDA5 Tryptophan synthase alpha chain 2.08e-08 2.00e-02 NA NA
5. P A8MDA4 Geranylgeranylglyceryl phosphate synthase 5.30e-10 3.58e-02 NA NA
5. P P60631 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1 1.04e-10 1.18e-05 NA NA
5. P Q49WT0 3-hexulose-6-phosphate synthase 2 1.24e-12 4.95e-02 NA NA
5. P Q7CG47 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.30e-07 6.92e-04 NA NA
5. P A2RJD1 3-dehydroquinate dehydratase 1.17e-06 8.47e-03 NA NA
5. P C6A2A3 Geranylgeranylglyceryl phosphate synthase 1.43e-10 4.06e-03 NA NA
5. P Q9YBR1 Triosephosphate isomerase 5.50e-10 1.76e-05 NA NA
5. P C1EVE6 Thiamine-phosphate synthase 4.22e-09 1.47e-02 NA NA
5. P C1DHY7 Indole-3-glycerol phosphate synthase 2.90e-09 5.24e-05 NA NA
5. P B0SLU9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.59e-09 3.34e-03 NA NA
5. P Q0RFX1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.12e-09 1.16e-02 NA NA
5. P Q4UXY4 Thiazole synthase 2.20e-09 2.60e-02 NA NA
5. P O67657 Indole-3-glycerol phosphate synthase 8.31e-10 9.01e-04 NA NA
5. P Q9PQW2 Triosephosphate isomerase 2.17e-04 5.53e-04 NA NA
5. P Q65MR4 Heptaprenylglyceryl phosphate synthase 3.86e-07 3.02e-02 NA NA
5. P Q58923 Triosephosphate isomerase 1.42e-10 7.19e-05 NA NA
5. P B0CJI5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.10e-08 4.65e-03 NA NA
5. P C3LNA0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.18e-10 1.16e-02 NA NA
5. P A7ZLX4 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.72e-07 7.72e-03 NA NA
5. P A9EXF3 Thiazole synthase 1.39e-09 2.66e-02 NA NA
5. P A0B7W4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.30e-09 2.59e-03 NA NA
5. P O59536 Triosephosphate isomerase 3.98e-10 2.92e-07 NA NA
5. P Q5KXU9 Indole-3-glycerol phosphate synthase 4.03e-09 1.05e-04 NA NA
5. P A0LCF2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1.96e-08 1.50e-02 NA NA
5. P A1AR94 Pyridoxine 5'-phosphate synthase 2.79e-08 3.69e-02 NA NA
5. P A8ZVC5 Pyridoxine 5'-phosphate synthase 3.31e-08 3.91e-03 NA NA
5. P Q66EZ3 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.28e-07 3.32e-04 NA NA
5. P Q5LYI5 Indole-3-glycerol phosphate synthase 1.09e-09 6.58e-06 NA NA
5. P Q8TS37 Orotidine 5'-phosphate decarboxylase 1.23e-10 1.99e-02 NA NA
5. P A7GWX9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.10e-09 3.35e-04 NA NA
5. P A5FJK8 Geranylgeranylglyceryl phosphate synthase 1.98e-05 2.59e-03 NA NA
5. P P17217 Indole-3-glycerol phosphate synthase 1.57e-09 1.44e-04 NA NA
5. P Q5ZX99 Indole-3-glycerol phosphate synthase 3.98e-09 3.55e-04 NA NA
5. P A7HSH1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.34e-08 1.00e-04 NA NA
5. P B0VBS1 Indole-3-glycerol phosphate synthase 2.85e-09 6.01e-04 NA NA
5. P A6LU97 Tryptophan synthase alpha chain 9.94e-04 2.05e-02 NA NA
5. P Q88A03 Indole-3-glycerol phosphate synthase 5.45e-09 1.50e-05 NA NA
5. P Q65I33 Indole-3-glycerol phosphate synthase 2.04e-09 4.09e-04 NA NA
5. P A7IHP0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.73e-08 4.95e-02 NA NA
5. P Q926V7 Putative N-acetylmannosamine-6-phosphate 2-epimerase 7.53e-10 2.03e-06 NA NA
5. P Q979V9 Indole-3-glycerol phosphate synthase 8.37e-07 1.58e-03 NA NA
5. P Q9D8X1 Copper homeostasis protein cutC homolog 6.54e-11 3.21e-02 NA NA
5. P Q9PGT5 Indole-3-glycerol phosphate synthase 4.75e-09 7.22e-04 NA NA
5. P A4XZC5 Indole-3-glycerol phosphate synthase 5.99e-09 2.93e-06 NA NA
5. P Q5E735 Putative N-acetylmannosamine-6-phosphate 2-epimerase 2.47e-10 5.52e-05 NA NA
5. P B9JN20 L-erythrulose-1-phosphate isomerase 3.10e-06 4.21e-02 NA NA
5. P P00911 Indole-3-glycerol phosphate synthase 3.50e-09 8.30e-04 NA NA
5. P P42405 3-hexulose-6-phosphate synthase 8.86e-13 1.76e-03 NA NA
5. P Q162Q2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.26e-09 3.00e-05 NA NA
5. P Q6G601 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 8.36e-09 3.36e-03 NA NA
5. P C5CKE4 Indole-3-glycerol phosphate synthase 2.36e-09 1.31e-02 NA NA
5. P P66983 Tryptophan synthase alpha chain 6.41e-05 2.43e-02 NA NA
5. P O27120 Triosephosphate isomerase 1.87e-10 1.40e-08 NA NA
5. P Q57HD9 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase 1.18e-07 1.68e-03 NA NA
5. P C3PBW1 Thiamine-phosphate synthase 4.20e-09 3.38e-02 NA NA
5. P Q6LPV5 Putative N-acetylmannosamine-6-phosphate 2-epimerase 1.69e-10 8.79e-04 NA NA
5. P P57936 Triosephosphate isomerase 3.68e-06 2.58e-02 NA NA
5. P Q87DU4 Copper homeostasis protein CutC 4.63e-11 2.57e-04 NA NA
5. P Q978V5 Triosephosphate isomerase 1.24e-08 1.81e-04 NA NA
5. P Q4QNC6 Thiamine-phosphate synthase 5.11e-08 2.06e-02 NA NA
5. P A8LHX7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.76e-09 8.37e-04 NA NA
5. P A8AUI0 Putative N-acetylmannosamine-6-phosphate 2-epimerase 3.18e-10 3.36e-08 NA NA
5. P Q9HRI2 Fructose-bisphosphate aldolase class 1 1.21e-09 1.18e-05 NA NA
5. P A6SUH5 Indole-3-glycerol phosphate synthase 4.53e-09 2.97e-04 NA NA
5. P B1Y7I2 Indole-3-glycerol phosphate synthase 5.47e-09 9.63e-04 NA NA
5. P B3Q950 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 2.91e-08 2.60e-02 NA NA
5. P Q4FMP0 Thiazole synthase 1.80e-09 2.13e-02 NA NA
5. P A4WN19 Indole-3-glycerol phosphate synthase 1.85e-08 1.04e-03 NA NA
5. P Q136D2 Indole-3-glycerol phosphate synthase 3.48e-09 2.55e-04 NA NA
5. P Q73T20 Thiazole synthase 8.00e-10 3.48e-02 NA NA
5. P A6QKG2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 7.13e-09 3.36e-03 NA NA
5. P Q0RFX9 Indole-3-glycerol phosphate synthase 6.62e-10 7.19e-05 NA NA
5. P Q0TQ02 Thiazole synthase 4.15e-10 1.86e-02 NA NA
5. P A3CLL9 Indole-3-glycerol phosphate synthase 9.32e-10 1.16e-04 NA NA
5. P A4J708 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.03e-09 4.15e-02 NA NA
5. P Q32CV7 Pyridoxine 5'-phosphate synthase 2.96e-08 3.61e-02 NA NA
5. P Q7VAT3 Indole-3-glycerol phosphate synthase 1.07e-08 1.53e-02 NA NA
5. P Q4A048 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 4.76e-09 7.09e-03 NA NA
5. P A8Z6K1 Indole-3-glycerol phosphate synthase 5.87e-10 2.42e-02 NA NA
5. P Q2VYJ0 Imidazole glycerol phosphate synthase subunit HisF 9.24e-10 1.05e-02 NA NA
5. P A3D5B0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 3.71e-10 6.32e-04 NA NA
5. P B1ZW79 Indole-3-glycerol phosphate synthase 9.30e-10 6.32e-04 NA NA
5. P B2ICL3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 6.85e-08 5.23e-03 NA NA
6. F Q8E9N2 2-isopropylmalate synthase 2.36e-07 NA NA 0.6315
6. F Q89A49 Putative 2-isopropylmalate synthase 4.89e-09 NA NA 0.6527
6. F B5QVU3 3-dehydroquinate dehydratase 4.46e-09 NA NA 0.5923
6. F A8AB61 Probable 2-isopropylmalate synthase 8.83e-09 NA NA 0.6156
6. F Q4KIF9 Triosephosphate isomerase 1.36e-06 NA NA 0.5877
6. F A0RBL2 2-isopropylmalate synthase 7.91e-08 NA NA 0.6201
6. F Q3SHE7 2-isopropylmalate synthase 1.70e-07 NA NA 0.6584
6. F Q5PDG1 2-isopropylmalate synthase 1.51e-07 NA NA 0.6594
6. F A6Q2V4 4-hydroxy-tetrahydrodipicolinate synthase 1.48e-10 NA NA 0.6578
6. F Q8ZIG8 2-isopropylmalate synthase 1.50e-07 NA NA 0.6404
6. F C4ZPZ7 2-isopropylmalate synthase 1.70e-07 NA NA 0.6378
6. F B8DM91 2-isopropylmalate synthase 2.56e-07 NA NA 0.6174
6. F B6JFZ2 Triosephosphate isomerase 2.46e-06 NA NA 0.5282
6. F Q2YVY6 Biotin synthase 4.46e-08 NA NA 0.5876
6. F A8Z4W0 2-isopropylmalate synthase 1.23e-07 NA NA 0.6274
6. F Q0A9A1 Tryptophan synthase alpha chain 1.02e-05 NA NA 0.5618
6. F B7V0S0 Tryptophan synthase alpha chain 8.86e-04 NA NA 0.5396
6. F Q5NPZ7 Tryptophan synthase alpha chain 8.99e-05 NA NA 0.6163
6. F A9AJN4 2-isopropylmalate synthase 1.45e-07 NA NA 0.6273
6. F B2SNG9 2-isopropylmalate synthase 1.10e-07 NA NA 0.509
6. F Q02FS4 Triosephosphate isomerase 2.13e-05 NA NA 0.5735
6. F A1KUQ1 3-dehydroquinate dehydratase 2.68e-09 NA NA 0.6003
6. F B5FGH4 2-isopropylmalate synthase 1.54e-07 NA NA 0.6521
6. F P15875 2-isopropylmalate synthase 1.85e-07 NA NA 0.6668
6. F Q7MP77 2-isopropylmalate synthase 1.20e-07 NA NA 0.6482
6. F Q7NI93 2-isopropylmalate synthase 1.90e-07 NA NA 0.6775
6. F B3QCX5 2-isopropylmalate synthase 1.66e-07 NA NA 0.6443
6. F B1ZDN3 2-isopropylmalate synthase 1.63e-07 NA NA 0.5965
6. F B0T0G9 2-isopropylmalate synthase 1.30e-07 NA NA 0.6234
6. F Q5GXR6 Tryptophan synthase alpha chain 7.22e-08 NA NA 0.5817
6. F A1W1X2 2-isopropylmalate synthase 1.03e-07 NA NA 0.6338
6. F B2U281 2-isopropylmalate synthase 1.83e-07 NA NA 0.6295
6. F A4IPP2 3-dehydroquinate dehydratase 1.89e-09 NA NA 0.5544
6. F Q30R77 4-hydroxy-tetrahydrodipicolinate synthase 1.11e-10 NA NA 0.6531
6. F B8E2W9 2-isopropylmalate synthase 8.62e-08 NA NA 0.6442
6. F Q5P1I9 Tryptophan synthase alpha chain 1.16e-03 NA NA 0.5791
6. F Q0T8C4 2-isopropylmalate synthase 1.53e-07 NA NA 0.6267
6. F Q4UYG1 2-isopropylmalate synthase 1.42e-07 NA NA 0.5759
6. F B5YZB0 2-isopropylmalate synthase 1.70e-07 NA NA 0.6667
6. F A6Q2V6 Dihydroorotate dehydrogenase (quinone) 4.22e-09 NA NA 0.6133
6. F Q92NH8 L-erythrulose-1-phosphate isomerase 1.71e-06 NA NA 0.6386
6. F Q604P4 Tryptophan synthase alpha chain 1.61e-04 NA NA 0.5346
6. F Q88DV4 Triosephosphate isomerase 1.33e-06 NA NA 0.5717
6. F Q5WEN3 2-isopropylmalate synthase 8.71e-08 NA NA 0.6239
6. F Q63JM0 Tryptophan synthase alpha chain 2.08e-04 NA NA 0.5817
6. F B2JDN6 2-isopropylmalate synthase 1.63e-07 NA NA 0.6307
6. F P12291 Tryptophan synthase alpha chain 6.01e-04 NA NA 0.2649
6. F Q986N6 L-erythrulose-1-phosphate isomerase 2.02e-06 NA NA 0.643
6. F A1VN06 2-isopropylmalate synthase 3.12e-07 NA NA 0.6357
6. F P48571 2-isopropylmalate synthase 1.32e-07 NA NA 0.6429
6. F P58899 2-isopropylmalate synthase 1.19e-07 NA NA 0.6258
6. F B7V1G0 Triosephosphate isomerase 1.17e-06 NA NA 0.5725
6. F Q9RX14 Dihydroorotate dehydrogenase (quinone) 6.22e-09 NA NA 0.6166
6. F B5FJ82 3-dehydroquinate dehydratase 4.34e-09 NA NA 0.5964
6. F Q493R0 2-isopropylmalate synthase 1.43e-07 NA NA 0.6395
6. F Q9RN77 3-dehydroquinate dehydratase 4.23e-09 NA NA 0.5947
6. F A7GMU1 2-isopropylmalate synthase 8.21e-08 NA NA 0.6353
6. F Q7VBG1 2-isopropylmalate synthase 2.11e-07 NA NA 0.6752
6. F A6QIQ3 2-isopropylmalate synthase 1.25e-07 NA NA 0.6249
6. F Q9ZEY8 2-isopropylmalate synthase 1.51e-07 NA NA 0.6672
6. F C3L9Q7 2-isopropylmalate synthase 1.28e-07 NA NA 0.6199
6. F Q02YX5 2-isopropylmalate synthase 1.35e-07 NA NA 0.6321
6. F A6U3E2 2-isopropylmalate synthase 1.26e-07 NA NA 0.6132
6. F Q8DEX2 Copper homeostasis protein CutC 4.02e-11 NA NA 0.6328
6. F Q99RK7 Biotin synthase 3.79e-08 NA NA 0.583
6. F A4XYE4 Triosephosphate isomerase 3.73e-05 NA NA 0.574
6. F Q2YIQ6 L-erythrulose-1-phosphate isomerase 2.48e-06 NA NA 0.5771
6. F Q5HS76 2-isopropylmalate synthase 1.09e-07 NA NA 0.6389
6. F A4FIS6 Biotin synthase 1.01e-07 NA NA 0.5905
6. F Q5WQ01 2-isopropylmalate synthase 2.01e-07 NA NA 0.6394
6. F Q46DZ7 3-dehydroquinate dehydratase 9.80e-09 NA NA 0.5882
6. F B1HR98 2-isopropylmalate synthase 1.34e-07 NA NA 0.6521
6. F A6VK15 (5-formylfuran-3-yl)methyl phosphate synthase 8.12e-12 NA NA 0.6505
6. F Q2P761 2-isopropylmalate synthase 1.25e-07 NA NA 0.5817
6. F B1J4B0 Tryptophan synthase alpha chain 1.55e-04 NA NA 0.5428
6. F B0U6K7 Tryptophan synthase alpha chain 9.70e-08 NA NA 0.578
6. F B2TQ57 3-dehydroquinate dehydratase 3.76e-09 NA NA 0.5761
6. F Q8DEE1 2-isopropylmalate synthase 1.21e-07 NA NA 0.6546
6. F Q6N858 2-isopropylmalate synthase 1.86e-07 NA NA 0.6743
6. F A8ALM5 2-isopropylmalate synthase 1.68e-07 NA NA 0.6441
6. F B7KJX8 2-isopropylmalate synthase 3.30e-07 NA NA 0.6687
6. F Q66EM1 2-isopropylmalate synthase 1.49e-07 NA NA 0.6357
6. F C3P4Z6 2-isopropylmalate synthase 1.23e-07 NA NA 0.6374
6. F C1EMA9 2-isopropylmalate synthase 1.19e-07 NA NA 0.6218
6. F A5EP79 2-isopropylmalate synthase 1.48e-07 NA NA 0.6428
6. F A2BRP4 2-isopropylmalate synthase 2.71e-07 NA NA 0.6772
6. F B8H607 2-isopropylmalate synthase 7.98e-08 NA NA 0.6413
6. F P94907 2-isopropylmalate synthase 1.63e-07 NA NA 0.6618
6. F Q5F8D4 2-isopropylmalate synthase 2.55e-07 NA NA 0.641
6. F Q2YUF2 2-isopropylmalate synthase 1.20e-07 NA NA 0.6092
6. F Q1IF47 Triosephosphate isomerase 5.46e-05 NA NA 0.5549
6. F A5IJM2 2-isopropylmalate synthase 1.77e-07 NA NA 0.6125
6. F A4IRH8 2-isopropylmalate synthase 1.44e-07 NA NA 0.6309
6. F A2BMY4 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.29e-07 NA NA 0.5634
6. F B5F9Z0 Copper homeostasis protein CutC 3.99e-11 NA NA 0.6735
6. F Q5XGL6 4-hydroxy-2-oxoglutarate aldolase, mitochondrial 7.32e-10 NA NA 0.627
6. F Q73BA0 2-isopropylmalate synthase 8.42e-08 NA NA 0.6206
6. F Q9PPB4 4-hydroxy-tetrahydrodipicolinate synthase 1.88e-10 NA NA 0.6446
6. F B5RAU8 3-dehydroquinate dehydratase 4.24e-09 NA NA 0.596
6. F B1KKZ4 2-isopropylmalate synthase 2.90e-07 NA NA 0.6397
6. F B2JQF0 Tryptophan synthase alpha chain 1.91e-04 NA NA 0.5674
6. F Q12UJ8 3-dehydroquinate dehydratase 5.62e-09 NA NA 0.5533
6. F B6JB87 2-isopropylmalate synthase 1.65e-07 NA NA 0.6403
6. F A1WY05 Tryptophan synthase alpha chain 9.70e-06 NA NA 0.5639
6. F Q8PJ29 Tryptophan synthase alpha chain 6.39e-08 NA NA 0.5685
6. F C3N136 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.30e-07 NA NA 0.551
6. F C5CYP2 2-isopropylmalate synthase 2.92e-07 NA NA 0.6383
6. F Q1BV03 2-isopropylmalate synthase 1.42e-07 NA NA 0.6279
6. F Q48QG7 Tryptophan synthase alpha chain 1.35e-03 NA NA 0.5423
6. F B7UIC4 2-isopropylmalate synthase 1.72e-07 NA NA 0.6295
6. F Q74C76 (R)-citramalate synthase 3.07e-06 NA NA 0.5645
6. F B7M119 2-isopropylmalate synthase 1.53e-07 NA NA 0.6267
6. F A5W991 Triosephosphate isomerase 1.42e-06 NA NA 0.5837
6. F Q9JZG1 2-isopropylmalate synthase 2.81e-07 NA NA 0.6256
6. F A2S138 Tryptophan synthase alpha chain 1.97e-04 NA NA 0.5814
6. F A8LY18 Dihydroorotate dehydrogenase (quinone) 2.04e-08 NA NA 0.637
6. F B8H661 Tryptophan synthase alpha chain 5.97e-04 NA NA 0.2649
6. F Q2FE72 Biotin synthase 4.16e-08 NA NA 0.5895
6. F B1WQQ4 2-isopropylmalate synthase 1.85e-07 NA NA 0.6547
6. F B3R113 Tryptophan synthase alpha chain 1.77e-04 NA NA 0.5533
6. F B2SEK8 Tryptophan synthase alpha chain 7.92e-05 NA NA 0.5946
6. F Q3BRL7 Tryptophan synthase alpha chain 1.03e-07 NA NA 0.5713
6. F Q138Z2 2-isopropylmalate synthase 1.69e-07 NA NA 0.665
6. F Q820M0 2-isopropylmalate synthase 1.12e-07 NA NA 0.6193
6. F A4XNC8 Tryptophan synthase alpha chain 9.27e-04 NA NA 0.5475
6. F P06562 Tryptophan synthase alpha chain 6.44e-06 NA NA 0.5676
6. F Q7VQJ6 2-isopropylmalate synthase 1.55e-07 NA NA 0.6198
6. F Q8U2A2 2-isopropylmalate synthase 1.63e-07 NA NA 0.623
6. F Q0P5I5 4-hydroxy-2-oxoglutarate aldolase, mitochondrial 9.39e-10 NA NA 0.6471
6. F P94565 2-isopropylmalate synthase 1.18e-07 NA NA 0.6165
6. F Q8YCV3 L-erythrulose-1-phosphate isomerase 2.71e-06 NA NA 0.5959
6. F Q07WG9 2-isopropylmalate synthase 2.23e-07 NA NA 0.5964
6. F B0KHY2 Triosephosphate isomerase 1.33e-06 NA NA 0.5836
6. F Q9JUK6 2-isopropylmalate synthase 2.90e-07 NA NA 0.6349
6. F A4WPE1 Tryptophan synthase alpha chain 1.07e-03 NA NA 0.2991
6. F B0TQM0 2-isopropylmalate synthase 2.42e-07 NA NA 0.6291
6. F C3MBA0 Tryptophan synthase alpha chain 4.08e-04 NA NA 0.5245
6. F Q07PI3 2-isopropylmalate synthase 1.64e-07 NA NA 0.6455
6. F Q0HZT4 2-isopropylmalate synthase 2.10e-07 NA NA 0.6463
6. F A9MZK0 2-isopropylmalate synthase 1.55e-07 NA NA 0.6439
6. F Q0BP46 Tryptophan synthase alpha chain 9.17e-05 NA NA 0.5944
6. F A1UZ42 Tryptophan synthase alpha chain 2.04e-04 NA NA 0.5812
6. F O04974 2-isopropylmalate synthase B 1.08e-06 NA NA 0.6561
6. F B2I596 2-isopropylmalate synthase 1.12e-07 NA NA 0.6251
6. F Q9HV51 Triosephosphate isomerase 2.24e-05 NA NA 0.5725
6. F B1W5S5 Putative (5-formylfuran-3-yl)methyl phosphate synthase 4.99e-11 NA NA 0.6616
6. F Q1LPX2 2-isopropylmalate synthase 1.69e-07 NA NA 0.612
6. F Q88RP7 Tryptophan synthase alpha chain 1.88e-05 NA NA 0.5441
6. F P48576 2-isopropylmalate synthase 2.35e-07 NA NA 0.6703
6. F B8E4K4 2-isopropylmalate synthase 2.09e-07 NA NA 0.6037
6. F P56839 Phosphoenolpyruvate phosphomutase 1.01e-08 NA NA 0.6463
6. F A9HE84 Tryptophan synthase alpha chain 6.82e-06 NA NA 0.5587
6. F B7VIF2 2-isopropylmalate synthase 1.22e-07 NA NA 0.665
6. F A3DF94 2-isopropylmalate synthase 7.22e-08 NA NA 0.626
6. F Q6GF16 2-isopropylmalate synthase 9.55e-08 NA NA 0.6279
6. F B9E0D7 3-dehydroquinate dehydratase 1.68e-09 NA NA 0.5722
6. F B1L8U2 2-isopropylmalate synthase 1.69e-07 NA NA 0.6378
6. F Q0AGN5 2-isopropylmalate synthase 1.58e-07 NA NA 0.6184
6. F A1REY0 2-isopropylmalate synthase 2.49e-07 NA NA 0.6378
6. F P58900 2-isopropylmalate synthase 1.33e-07 NA NA 0.6034
6. F B1YTR7 2-isopropylmalate synthase 1.46e-07 NA NA 0.6277
6. F A1KTV6 2-isopropylmalate synthase 2.17e-07 NA NA 0.6432
6. F Q5F8N0 3-dehydroquinate dehydratase 3.06e-09 NA NA 0.59
6. F Q7U892 2-isopropylmalate synthase 2.25e-07 NA NA 0.676
6. F Q8F445 2-isopropylmalate synthase 1 1.84e-07 NA NA 0.6596
6. F Q2JZQ2 L-erythrulose-1-phosphate isomerase 2.78e-06 NA NA 0.6223
6. F Q7V121 2-isopropylmalate synthase 2.61e-07 NA NA 0.6691
6. F A4SWX7 Tryptophan synthase alpha chain 1.30e-05 NA NA 0.5841
6. F Q8VX04 Methylthioalkylmalate synthase 2, chloroplastic 2.88e-07 NA NA 0.6525
6. F B4TUS2 3-dehydroquinate dehydratase 4.61e-09 NA NA 0.5967
6. F A6UX98 Tryptophan synthase alpha chain 8.76e-04 NA NA 0.539
6. F P07344 Tryptophan synthase alpha chain 1.01e-03 NA NA 0.5287
6. F A9B6M7 Tryptophan synthase alpha chain 1.40e-04 NA NA 0.5622
6. F A9N159 3-dehydroquinate dehydratase 4.43e-09 NA NA 0.597
6. F Q212A9 2-isopropylmalate synthase 1.63e-07 NA NA 0.6505
6. F A0AK92 2-isopropylmalate synthase 1.65e-07 NA NA 0.6189
6. F Q05957 Petal death protein 3.74e-08 NA NA 0.6436
6. F A5MZ76 2-isopropylmalate synthase 1.26e-07 NA NA 0.6385
6. F Q57TE6 2-isopropylmalate synthase 1.78e-07 NA NA 0.6648
6. F Q8FL75 2-isopropylmalate synthase 1.66e-07 NA NA 0.6498
6. F A4W6H9 2-isopropylmalate synthase 1.76e-07 NA NA 0.6338
6. F Q8CNL3 2-isopropylmalate synthase 1.17e-07 NA NA 0.6272
6. F Q4L7U0 2-isopropylmalate synthase 1.42e-07 NA NA 0.6246
6. F Q114U6 Uroporphyrinogen decarboxylase 1.20e-04 NA NA 0.5314
6. F B1I1Y1 2-isopropylmalate synthase 1.74e-07 NA NA 0.6559
6. F Q5QX65 Dihydroorotate dehydrogenase (quinone) 1.24e-09 NA NA 0.5633
6. F Q31HH3 Tryptophan synthase alpha chain 1.71e-03 NA NA 0.5754
6. F Q48E73 Triosephosphate isomerase 1.43e-06 NA NA 0.5691
6. F Q3SHM0 Tryptophan synthase alpha chain 1.32e-03 NA NA 0.5875
6. F Q2J5A7 Biotin synthase 2 1.68e-07 NA NA 0.5496
6. F B1LG11 2-isopropylmalate synthase 1.59e-07 NA NA 0.6182
6. F A1U0X2 Tryptophan synthase alpha chain 1.83e-04 NA NA 0.5792
6. F B4SU36 2-isopropylmalate synthase 1.80e-07 NA NA 0.657
6. F Q7MNH9 Copper homeostasis protein CutC 4.00e-11 NA NA 0.6662
6. F Q3MBA3 2-isopropylmalate synthase 1.56e-07 NA NA 0.6606
6. F A4X619 Dihydroorotate dehydrogenase (quinone) 1.91e-08 NA NA 0.6328
6. F Q04TF0 Triosephosphate isomerase 1.15e-06 NA NA 0.6127
6. F C5D5M0 2-isopropylmalate synthase 2.41e-07 NA NA 0.6451
6. F Q1RGC3 2-isopropylmalate synthase 1.61e-07 NA NA 0.6204
6. F Q9KP83 2-isopropylmalate synthase 1.05e-07 NA NA 0.6606
6. F Q1QY41 Tryptophan synthase alpha chain 5.92e-04 NA NA 0.5763
6. F Q5HMF9 2-isopropylmalate synthase 1.28e-07 NA NA 0.6471
6. F A8FFW5 2-isopropylmalate synthase 1 1.21e-07 NA NA 0.6293
6. F A1KAA5 3-methyl-2-oxobutanoate hydroxymethyltransferase 2.74e-08 NA NA 0.5315
6. F Q1QJV3 2-isopropylmalate synthase 1.55e-07 NA NA 0.6384
6. F A6VCK5 Triosephosphate isomerase 2.07e-05 NA NA 0.5753
6. F A4VNJ1 Tryptophan synthase alpha chain 1.09e-03 NA NA 0.5551
6. F Q57PS8 3-dehydroquinate dehydratase 2.90e-09 NA NA 0.5933
6. F A5VWL2 Tryptophan synthase alpha chain 1.16e-03 NA NA 0.5316
6. F A3PDH0 2-isopropylmalate synthase 2.68e-07 NA NA 0.6755
6. F P22095 Tryptophan synthase alpha chain 8.84e-06 NA NA 0.257
6. F Q7P0H2 2-isopropylmalate synthase 2.48e-07 NA NA 0.6378
6. F B1XYA8 2-isopropylmalate synthase 1.80e-07 NA NA 0.6306
6. F Q2T7G9 Tryptophan synthase alpha chain 1.84e-04 NA NA 0.5766
6. F Q9X4H5 Putative (5-formylfuran-3-yl)methyl phosphate synthase 6.31e-11 NA NA 0.6654
6. F B0RP28 2-isopropylmalate synthase 1.38e-07 NA NA 0.5985
6. F C0Z9C8 2-isopropylmalate synthase 1.19e-07 NA NA 0.6155
6. F Q8THS6 (5-formylfuran-3-yl)methyl phosphate synthase 4.80e-12 NA NA 0.6475
6. F B1JVQ1 2-isopropylmalate synthase 1.40e-07 NA NA 0.6192
6. F A8FQ83 2-isopropylmalate synthase 2.60e-07 NA NA 0.6392
6. F C4XPA8 2-isopropylmalate synthase 1.31e-07 NA NA 0.6462
6. F Q5HUY6 4-hydroxy-tetrahydrodipicolinate synthase 1.96e-10 NA NA 0.6531
6. F Q9WZ23 2-isopropylmalate synthase 1.81e-07 NA NA 0.6128
6. F A5IUK3 2-isopropylmalate synthase 9.94e-08 NA NA 0.6419
6. F Q9WZ22 (R)-citramalate synthase 2.95e-06 NA NA 0.6254
6. F A7I0Y0 4-hydroxy-tetrahydrodipicolinate synthase 2.03e-10 NA NA 0.617
6. F Q7NZI3 Triosephosphate isomerase 2.13e-05 NA NA 0.5865
6. F A5N2N7 Triosephosphate isomerase 4.04e-05 NA NA 0.6151
6. F Q9PCG3 2-isopropylmalate synthase 1.16e-07 NA NA 0.6441
6. F B9KFX0 4-hydroxy-tetrahydrodipicolinate synthase 1.78e-10 NA NA 0.643
6. F A1K4B0 Tryptophan synthase alpha chain 9.22e-04 NA NA 0.5687
6. F Q3AIA2 2-isopropylmalate synthase 2.17e-07 NA NA 0.6841
6. F Q87CL8 2-isopropylmalate synthase 1.13e-07 NA NA 0.6244
6. F Q5E3C5 Copper homeostasis protein CutC 4.06e-11 NA NA 0.6732
6. F Q7VFP9 4-hydroxy-tetrahydrodipicolinate synthase 1.65e-10 NA NA 0.6481
6. F P11435 Carboxyvinyl-carboxyphosphonate phosphorylmutase 1.55e-08 NA NA 0.6407
6. F A4JGE0 2-isopropylmalate synthase 2.91e-07 NA NA 0.6223
6. F Q6D0G8 2-isopropylmalate synthase 2.24e-07 NA NA 0.6521
6. F C5B7R4 2-isopropylmalate synthase 2.14e-07 NA NA 0.6256
6. F B7JFY5 2-isopropylmalate synthase 8.35e-08 NA NA 0.6201
6. F Q31I16 2-isopropylmalate synthase 1 1.40e-07 NA NA 0.6054
6. F Q2G8S8 Tryptophan synthase alpha chain 1.01e-04 NA NA 0.5815
6. F Q5X5Q1 Tryptophan synthase alpha chain 1.29e-03 NA NA 0.5915
6. F B9KB95 2-isopropylmalate synthase 1.14e-07 NA NA 0.6382
6. F Q2JRL7 Dihydroorotate dehydrogenase (quinone) 1.69e-08 NA NA 0.6112
6. F Q2NVW3 2-isopropylmalate synthase 1.57e-07 NA NA 0.6349
6. F Q9JYT0 3-dehydroquinate dehydratase 2.92e-09 NA NA 0.6139
6. F C5BDB6 Tryptophan synthase alpha chain 1.51e-04 NA NA 0.582
6. F P63477 2-isopropylmalate synthase 1.23e-07 NA NA 0.6077
6. F O67502 Tryptophan synthase alpha chain 6.81e-04 NA NA 0.5669
6. F Q9JTR9 3-dehydroquinate dehydratase 2.50e-09 NA NA 0.5988
6. F A9KY13 2-isopropylmalate synthase 2.35e-07 NA NA 0.6346
6. F A5N6W8 3-dehydroquinate dehydratase 1.68e-09 NA NA 0.5725
6. F A7X669 Biotin synthase 4.32e-08 NA NA 0.5894
6. F Q9UZ08 2-isopropylmalate synthase 8.40e-08 NA NA 0.6302
6. F C3NMB9 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.44e-07 NA NA 0.5569
6. F A7MIC5 2-isopropylmalate synthase 1.55e-07 NA NA 0.6359
6. F Q5HEE4 2-isopropylmalate synthase 1.20e-07 NA NA 0.6342
6. F A3N7K7 2-isopropylmalate synthase 1.60e-07 NA NA 0.6231
6. F A4VPP4 Triosephosphate isomerase 1.27e-06 NA NA 0.5767
6. F Q8RL85 2-isopropylmalate synthase 1.24e-07 NA NA 0.6299
6. F Q3KI88 Triosephosphate isomerase 1.38e-06 NA NA 0.5884
6. F Q1LKI4 Tryptophan synthase alpha chain 1.33e-04 NA NA 0.5951
6. F Q3AEQ5 2-isopropylmalate synthase 1.03e-07 NA NA 0.6356
6. F Q49Z12 2-isopropylmalate synthase 9.19e-08 NA NA 0.6256
6. F Q052H8 Triosephosphate isomerase 1.15e-06 NA NA 0.5793
6. F A2C3L7 2-isopropylmalate synthase 1.82e-07 NA NA 0.6746
6. F A5GRZ0 2-isopropylmalate synthase 1.93e-07 NA NA 0.6732
6. F Q9K8E8 2-isopropylmalate synthase 1.08e-07 NA NA 0.6231
6. F Q8R9E1 Lipoyl synthase 5.42e-04 NA NA 0.5152
6. F A1W6T7 2-isopropylmalate synthase 2.53e-07 NA NA 0.643
6. F A9WL37 Biotin synthase 1.23e-07 NA NA 0.5761
6. F Q8Y5R9 2-isopropylmalate synthase 1.55e-07 NA NA 0.6226
6. F A1AXS3 Tryptophan synthase alpha chain 1.61e-05 NA NA 0.542
6. F A8G9R1 2-isopropylmalate synthase 1.55e-07 NA NA 0.648
6. F Q6HLF3 2-isopropylmalate synthase 1.19e-07 NA NA 0.6252
6. F Q39ED5 2-isopropylmalate synthase 1.42e-07 NA NA 0.6127
6. F B9DMJ6 2-isopropylmalate synthase 1.48e-07 NA NA 0.6296
6. F Q0I591 Triosephosphate isomerase 1.60e-06 NA NA 0.6024
6. F C3MK79 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.31e-07 NA NA 0.5517
6. F A6LDN1 2-isopropylmalate synthase 9.14e-08 NA NA 0.6409
6. F P95576 Triosephosphate isomerase 5.16e-05 NA NA 0.5702
6. F B0URI5 Triosephosphate isomerase 1.63e-06 NA NA 0.6068
6. F Q72RL9 2-isopropylmalate synthase 2.20e-07 NA NA 0.6826
6. F Q7VQZ9 Tryptophan synthase alpha chain 1.47e-08 NA NA 0.5935
6. F Q81T68 2-isopropylmalate synthase 1.21e-07 NA NA 0.6372
6. F B5BLB5 2-isopropylmalate synthase 1.79e-07 NA NA 0.6325
6. F A0L1R0 2-isopropylmalate synthase 2.52e-07 NA NA 0.6306
6. F P29247 Phosphoenolpyruvate phosphomutase 2.36e-08 NA NA 0.6676
6. F C4LAV7 2-isopropylmalate synthase 1.71e-07 NA NA 0.6051
6. F A7X4N1 2-isopropylmalate synthase 1.25e-07 NA NA 0.6142
6. F B1J266 Triosephosphate isomerase 1.12e-06 NA NA 0.5606
6. F Q5FRN3 Tryptophan synthase alpha chain 8.81e-06 NA NA 0.5349
6. F B4TJ72 2-isopropylmalate synthase 1.74e-07 NA NA 0.6668
6. F A8GF83 Tryptophan synthase alpha chain 1.22e-04 NA NA 0.5873
6. F B3PVV3 Tryptophan synthase alpha chain 2.64e-04 NA NA 0.5302
6. F B9E371 2-isopropylmalate synthase 1.24e-07 NA NA 0.6387
6. F A4YZ76 2-isopropylmalate synthase 1.60e-07 NA NA 0.6392
6. F B8CX21 2-isopropylmalate synthase 1.14e-07 NA NA 0.6303
6. F Q4QLS4 2-isopropylmalate synthase 1.29e-07 NA NA 0.651
6. F A7Z7B8 2-isopropylmalate synthase 1.04e-07 NA NA 0.6336
6. F A9VLG7 2-isopropylmalate synthase 1.15e-07 NA NA 0.6397
6. F B3DX88 2-isopropylmalate synthase 2.09e-07 NA NA 0.6309
6. F Q63VP3 2-isopropylmalate synthase 1.66e-07 NA NA 0.6234
6. F Q3AYY2 2-isopropylmalate synthase 2.16e-07 NA NA 0.677
6. F B5R2K9 2-isopropylmalate synthase 1.72e-07 NA NA 0.624
6. F A6Y9S5 L-threo-3-deoxy-hexylosonate aldolase 4.69e-10 NA NA 0.6234
6. F B0RR86 Tryptophan synthase alpha chain 2.44e-08 NA NA 0.5792
6. F B7MNT2 2-isopropylmalate synthase 1.50e-07 NA NA 0.6345
6. F P63476 2-isopropylmalate synthase 1.20e-07 NA NA 0.6256
6. F B8HW33 Dihydroorotate dehydrogenase (quinone) 1.35e-08 NA NA 0.5744
6. F A6WIB5 2-isopropylmalate synthase 2.46e-07 NA NA 0.6424
6. F Q92A28 2-isopropylmalate synthase 1.54e-07 NA NA 0.6277
6. F C1D702 Tryptophan synthase alpha chain 8.74e-04 NA NA 0.5708
6. F B2T9N0 Tryptophan synthase alpha chain 2.19e-04 NA NA 0.5733
6. F P58687 3-dehydroquinate dehydratase 4.25e-09 NA NA 0.5962
6. F D3HCJ2 2-isopropylmalate synthase 1.76e-07 NA NA 0.6297
6. F B4F194 2-isopropylmalate synthase 1.47e-07 NA NA 0.652
6. F Q71Y35 2-isopropylmalate synthase 1.47e-07 NA NA 0.6267
6. F Q8XXP1 2-isopropylmalate synthase 1 1.71e-07 NA NA 0.6146
6. F Q8X9Z8 2-isopropylmalate synthase 1.76e-07 NA NA 0.6134
6. F Q12B47 2-isopropylmalate synthase 2.46e-07 NA NA 0.6154
6. F Q8FWN5 Bifunctional enzyme NanE/NanK 7.07e-07 NA NA 0.6405
6. F Q0HE65 2-isopropylmalate synthase 1.78e-07 NA NA 0.6308
6. F B8CM39 2-isopropylmalate synthase 1.97e-07 NA NA 0.6381
6. F O67862 2-isopropylmalate synthase 2.46e-07 NA NA 0.6266
6. F Q82WI1 Tryptophan synthase alpha chain 1.10e-03 NA NA 0.5716
6. F A1S2E0 2-isopropylmalate synthase 2.17e-07 NA NA 0.6042
6. F Q8YBP2 Bifunctional enzyme NanE/NanK 6.17e-07 NA NA 0.6423
6. F A3MBU6 Tryptophan synthase alpha chain 1.65e-04 NA NA 0.5917
6. F B1XLQ9 2-isopropylmalate synthase 1.76e-07 NA NA 0.6424
6. F A3NT94 2-isopropylmalate synthase 1.67e-07 NA NA 0.647
6. F B0SPT9 Ribosomal protein S12 methylthiotransferase RimO 1.45e-02 NA NA 0.4084
6. F Q4UWD0 Tryptophan synthase alpha chain 2.47e-08 NA NA 0.5714
6. F Q21VZ1 2-isopropylmalate synthase 1.74e-07 NA NA 0.6535
6. F A1AWA1 2-isopropylmalate synthase 1.07e-07 NA NA 0.6403
6. F O04973 2-isopropylmalate synthase A 8.37e-07 NA NA 0.6105
6. F B6ELK0 2-isopropylmalate synthase 1.87e-07 NA NA 0.6661
6. F Q9K0D4 Tryptophan synthase alpha chain 1.15e-05 NA NA 0.5862
6. F Q2LWJ3 2-isopropylmalate synthase 2.03e-07 NA NA 0.6754
6. F Q6G7Q1 2-isopropylmalate synthase 1.23e-07 NA NA 0.6152
6. F A8DRH7 L-threo-3-deoxy-hexylosonate aldolase 1.04e-09 NA NA 0.6179
6. F Q89GB0 2-isopropylmalate synthase 1.59e-07 NA NA 0.6445
6. F Q8FVH2 L-erythrulose-1-phosphate isomerase 2.72e-06 NA NA 0.5858
6. F Q6LZC1 (5-formylfuran-3-yl)methyl phosphate synthase 8.46e-12 NA NA 0.6609
6. F Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase 1.36e-09 NA NA 0.6149
6. F O28087 (5-formylfuran-3-yl)methyl phosphate synthase 2.35e-11 NA NA 0.6663
6. F A8FLL9 4-hydroxy-tetrahydrodipicolinate synthase 1.90e-10 NA NA 0.6531
6. F Q8Z9I0 2-isopropylmalate synthase 1.58e-07 NA NA 0.6195
6. F D5HB86 2-isopropylmalate synthase 1.93e-07 NA NA 0.6399
6. F A1JJH7 2-isopropylmalate synthase 1.60e-07 NA NA 0.6318
6. F Q12SE7 2-isopropylmalate synthase 1.70e-07 NA NA 0.6042
6. F Q1IH21 Tryptophan synthase alpha chain 8.88e-04 NA NA 0.5304
6. F B7I8K2 Tryptophan synthase alpha chain 8.49e-04 NA NA 0.5841
6. F Q9ZBH3 Putative (5-formylfuran-3-yl)methyl phosphate synthase 7.02e-11 NA NA 0.6652
6. F B5FI58 2-isopropylmalate synthase 1.71e-07 NA NA 0.6431
6. F P96074 Fosfomycin biosynthesis bifunctional protein Fom1 1.61e-03 NA NA 0.5904
6. F A8FP35 2-isopropylmalate synthase 1.12e-07 NA NA 0.6255
6. F A3P7M8 Tryptophan synthase alpha chain 2.06e-04 NA NA 0.5807
6. F A1WAT8 Tryptophan synthase alpha chain 1.26e-03 NA NA 0.5929
6. F A3CZK5 2-isopropylmalate synthase 2.45e-07 NA NA 0.6355
6. F B4TGJ6 3-dehydroquinate dehydratase 3.10e-09 NA NA 0.5965
6. F Q8RDK3 2-isopropylmalate synthase 1 5.97e-09 NA NA 0.6367
6. F A5V9W7 Tryptophan synthase alpha chain 1.20e-05 NA NA 0.5738
6. F B1XUJ3 2-isopropylmalate synthase 1.29e-07 NA NA 0.6323
6. F Q5BD77 Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial 4.28e-11 NA NA 0.6683
6. F A4YED8 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.55e-07 NA NA 0.5807
6. F O86511 (R)-citramalate synthase 2.76e-06 NA NA 0.6327
6. F Q7UI51 2-isopropylmalate synthase 1.57e-07 NA NA 0.6227
6. F Q2FF67 2-isopropylmalate synthase 1.25e-07 NA NA 0.6144
6. F Q3J877 2-isopropylmalate synthase 1.44e-07 NA NA 0.6404
6. F A2BX52 2-isopropylmalate synthase 2.53e-07 NA NA 0.6693
6. F A6T006 Tryptophan synthase alpha chain 1.15e-03 NA NA 0.5621
6. F A7MT89 Copper homeostasis protein CutC 2.07e-10 NA NA 0.6597
6. F Q2YBW0 2-isopropylmalate synthase 1.20e-07 NA NA 0.6301
6. F Q7TUV5 2-isopropylmalate synthase 2.15e-07 NA NA 0.673
6. F A1VZF4 4-hydroxy-tetrahydrodipicolinate synthase 1.97e-10 NA NA 0.6516
6. F Q3JUB9 2-isopropylmalate synthase 1.94e-07 NA NA 0.6321
6. F C3MU48 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.28e-07 NA NA 0.5633
6. F Q87WQ1 Triosephosphate isomerase 1.13e-06 NA NA 0.581
6. F B2K4C9 2-isopropylmalate synthase 1.50e-07 NA NA 0.6365
6. F Q63DX8 2-isopropylmalate synthase 1.24e-07 NA NA 0.6368
6. F O85070 2-isopropylmalate synthase 1.17e-07 NA NA 0.6397
6. F Q605K7 2-isopropylmalate synthase 1.41e-07 NA NA 0.6768
6. F A1TRT4 2-isopropylmalate synthase 2.59e-07 NA NA 0.6198
6. F B7GH19 2-isopropylmalate synthase 2.15e-07 NA NA 0.6256
6. F A2SHL8 2-isopropylmalate synthase 1.70e-07 NA NA 0.6245
6. F A5CWZ3 2-isopropylmalate synthase 1.30e-07 NA NA 0.6373
6. F Q9A823 2-isopropylmalate synthase 9.50e-08 NA NA 0.6381
6. F B5YEF4 2-isopropylmalate synthase 8.95e-08 NA NA 0.6535
6. F Q87SS7 2-isopropylmalate synthase 1.23e-07 NA NA 0.6559
6. F Q7N129 2-isopropylmalate synthase 1.34e-07 NA NA 0.6287
6. F C6DEV8 2-isopropylmalate synthase 2.08e-07 NA NA 0.6787
6. F Q2IUT4 2-isopropylmalate synthase 1.82e-07 NA NA 0.6439
6. F B8IHS8 2-isopropylmalate synthase 1.42e-07 NA NA 0.6477
6. F Q1CMP5 2-isopropylmalate synthase 1.51e-07 NA NA 0.6393
6. F Q2Y7R5 Tryptophan synthase alpha chain 1.05e-03 NA NA 0.5726
6. F P48575 2-isopropylmalate synthase 1.47e-07 NA NA 0.6368
6. F Q8DJ32 2-isopropylmalate synthase 1.87e-07 NA NA 0.6746
6. F A5D4W0 2-isopropylmalate synthase 9.16e-08 NA NA 0.6498
6. F B0CA74 Dihydroorotate dehydrogenase (quinone) 1.04e-08 NA NA 0.5847
6. F P0C119 L-erythrulose-1-phosphate isomerase 2.70e-06 NA NA 0.5827
6. F A5GM47 2-isopropylmalate synthase 2.05e-07 NA NA 0.6567
6. F A5FXW5 Triosephosphate isomerase 4.93e-06 NA NA 0.6174
6. F Q8EN67 2-isopropylmalate synthase 1.98e-07 NA NA 0.6359
6. F I1RV17 NADH:flavin oxidoreductase FG08077 2.49e-09 NA NA 0.6445
6. F P58901 2-isopropylmalate synthase 1.42e-07 NA NA 0.5852
6. F Q88B60 Tryptophan synthase alpha chain 1.39e-03 NA NA 0.5429
6. F B5RGE4 2-isopropylmalate synthase 1.61e-07 NA NA 0.6476
6. F B1H0A7 2-isopropylmalate synthase 1.72e-07 NA NA 0.639
6. F Q826T2 Biotin synthase 2.58e-07 NA NA 0.5547
6. F A7N9D1 Tryptophan synthase alpha chain 8.42e-05 NA NA 0.5944
6. F Q5KWJ3 2-isopropylmalate synthase 1.18e-07 NA NA 0.6333
6. F B1JK98 2-isopropylmalate synthase 1.51e-07 NA NA 0.6297
6. F Q473V1 2-isopropylmalate synthase 2.84e-07 NA NA 0.6161
6. F A4SXR0 2-isopropylmalate synthase 1.19e-07 NA NA 0.6194
6. F B4E5N2 2-isopropylmalate synthase 2.02e-07 NA NA 0.6288
6. F C1KWT1 2-isopropylmalate synthase 1.57e-07 NA NA 0.6297
6. F P0CL20 Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial 2.44e-10 NA NA 0.6431
6. F B4RLX9 3-dehydroquinate dehydratase 3.04e-09 NA NA 0.6228
6. F Q5H4C6 2-isopropylmalate synthase 1.26e-07 NA NA 0.5941
6. F Q31AF9 2-isopropylmalate synthase 2.75e-07 NA NA 0.6805
6. F B5Y1W2 2-isopropylmalate synthase 1.69e-07 NA NA 0.6734
6. F Q2A5V4 Tryptophan synthase alpha chain 8.58e-05 NA NA 0.5945
6. F A1SRG8 2-isopropylmalate synthase 1.81e-07 NA NA 0.6529
6. F C0Q5H1 2-isopropylmalate synthase 1.72e-07 NA NA 0.6667
6. F A4J181 2-isopropylmalate synthase 1.38e-07 NA NA 0.5851
6. F Q7A018 Biotin synthase 3.90e-08 NA NA 0.6043
6. F A2C859 2-isopropylmalate synthase 2.21e-07 NA NA 0.6736
6. F B8DBU4 2-isopropylmalate synthase 1.49e-07 NA NA 0.6222
6. F C3N926 3-methyl-2-oxobutanoate hydroxymethyltransferase 1.38e-07 NA NA 0.5588
6. F B1WT19 N-(5'-phosphoribosyl)anthranilate isomerase 1.16e-07 NA NA 0.5864
6. F B9IUZ0 2-isopropylmalate synthase 1.24e-07 NA NA 0.6371
6. F Q5HDC9 Biotin synthase 4.33e-08 NA NA 0.597
6. F B0JGK2 2-isopropylmalate synthase 1.70e-07 NA NA 0.6602
6. F A0K933 2-isopropylmalate synthase 1.75e-07 NA NA 0.6282
6. F Q8TUZ9 (5-formylfuran-3-yl)methyl phosphate synthase 8.64e-12 NA NA 0.6634
6. F B2FT78 2-isopropylmalate synthase 2.33e-07 NA NA 0.5921
6. F A1SWS5 Triosephosphate isomerase 3.98e-05 NA NA 0.5692
6. F Q3SQ49 2-isopropylmalate synthase 1.39e-07 NA NA 0.636
6. F Q5M8W9 4-hydroxy-2-oxoglutarate aldolase, mitochondrial 7.21e-10 NA NA 0.6329
6. F A8H9A1 2-isopropylmalate synthase 2.01e-07 NA NA 0.6063
6. F Q3BPJ9 2-isopropylmalate synthase 1.28e-07 NA NA 0.6034