Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54946.1
JCVISYN3A_0733
Phosphopentomutase.
M. mycoides homolog: Q6MSE6.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 46
Unique PROST Go: 3
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 784
Unique PROST Homologs: 12
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q8R6A7
(Phosphoglucosamine mutase) with a FATCAT P-Value: 0 and RMSD of 3.06 angstrom. The sequence alignment identity is 26.5%.
Structural alignment shown in left. Query protein AVX54946.1 colored as red in alignment, homolog Q8R6A7 colored as blue.
Query protein AVX54946.1 is also shown in right top, homolog Q8R6A7 showed in right bottom. They are colored based on secondary structures.
AVX54946.1 MSFNKLNQTYLDWINHPNLDQELKELLNKADDNELNAAFNLELKFGTAGIRGILGAGPGRFN-VYTI-KKVTIAYAKL---LQTKYSNDLNK-GVVIGHD 94 Q8R6A7 ----------------------------------------MGRYFGTDGIR-------GEANRELTVDKALRLGYA-LGYYLKNNNPNE-EKIKVIMGSD 51 AVX54946.1 NRHNSKKF-AKLVADILTSFNIKAYLFKNND---LQPTPVVSFATKALNCIGGIVITASHNPAEYNGYKIYDPYGCQLMPHDTDVIAN----YMNEITNI 186 Q8R6A7 TRISGYMLRSALTAG-LTSMGI--YI----DFVGVIPTPGVAYITKQKKAKAGIMISASHNPAKDNGIKIFNLEGYKL----SDEIENQIEDYMD---N- 136 AVX54946.1 LDWTFISNNNLLEIVDQT-----VIDKYFEMIKN-L-EFYKDQDKSNLKIIYSAVNGTGSLYTPIVLKQSGYEV-IEVKEH--AFEDE-TFKNVIN---- 271 Q8R6A7 LD-KILANP--LA-GDKVGKFKYAEDEYFQY-KNYLTQCVKGNFK-DIKIVLDTAN--GAAY------RAAKDVFLDLRAELVVINDAPNGRN-INVKCG 221 AVX54946.1 -PNPEFDPAWKIPLEYAKKYDADIIILNDPDADRFGMAI-KHNNEFIRLNGNQ-TGAILIDWKLSNLKRLNK--LPKNPALYSSFVTSDLG-DRIASETY 365 Q8R6A7 STHP--DILSKVVV----GYEADLGLAYDGDADRL-IAVDKFGN--V-IDGDKIIG-IL---AL-GMK--NKGTL-KNNKVVTT-VMSNIGFEKYLKE-- 300 AVX54946.1 NA-NVVKTLTGFKWMGQEMLKEPLNGLNFVFAYEESYGYVI--DDSTRDKDGIQASIIAAEACWYYKNQNMTLVDYLNQLYEKYGYYYTTTYNLNFKPEE 462 Q8R6A7 NSIELLRANVGDRYVLEKMLAEDV-----VIGGEQS-GHIILKDYATTG-DGVLSSLKLVEV---IRD---TGKD-LHEL--------VSSI-------- 370 AVX54946.1 KDSKIAPIMKLLRTTGIKQINNLKVVK-IEDYINGLYNMPS--EDLLKIYLEDKSWIAIRPSGTEPKLKIYFVIVDSSL-QK-AENKAEKIYTELKTILN 557 Q8R6A7 KD---AP-QTLI---NVK-VDNIK--KNTWDK-NEII-M-SFINEANKKY-KDEVRILVRKSGTEPLIRVMTEGDDKQLVHKLAEDIAHLIEKELN---- 452 AVX54946.1 I 558 Q8R6A7 - 452
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0009252 | peptidoglycan biosynthetic process |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0006048 | UDP-N-acetylglucosamine biosynthetic process |
1. PBF | GO:0009243 | O antigen biosynthetic process |
1. PBF | GO:0009103 | lipopolysaccharide biosynthetic process |
1. PBF | GO:0008966 | phosphoglucosamine mutase activity |
1. PBF | GO:0004615 | phosphomannomutase activity |
1. PBF | GO:0042121 | alginic acid biosynthetic process |
1. PBF | GO:0005975 | carbohydrate metabolic process |
1. PBF | GO:0046872 | metal ion binding |
1. PBF | GO:0047933 | glucose-1,6-bisphosphate synthase activity |
1. PBF | GO:0009298 | GDP-mannose biosynthetic process |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0005737 | cytoplasm |
1. PBF | GO:0000287 | magnesium ion binding |
1. PBF | GO:0009246 | enterobacterial common antigen biosynthetic process |
1. PBF | GO:0006006 | glucose metabolic process |
1. PBF | GO:0004614 | phosphoglucomutase activity |
1. PBF | GO:0016868 | intramolecular transferase activity, phosphotransferases |
1. PBF | GO:0004610 | phosphoacetylglucosamine mutase activity |
4. PB | GO:0008973 | phosphopentomutase activity |
4. PB | GO:0030239 | myofibril assembly |
4. PB | GO:0005829 | cytosol |
4. PB | GO:0006011 | UDP-glucose metabolic process |
4. PB | GO:0005914 | spot adherens junction |
4. PB | GO:0019388 | galactose catabolic process |
4. PB | GO:0046115 | guanosine catabolic process |
4. PB | GO:0019255 | glucose 1-phosphate metabolic process |
4. PB | GO:0006148 | inosine catabolic process |
4. PB | GO:1904813 | ficolin-1-rich granule lumen |
4. PB | GO:0005992 | trehalose biosynthetic process |
4. PB | GO:0005634 | nucleus |
4. PB | GO:0030055 | cell-substrate junction |
4. PB | GO:0051156 | glucose 6-phosphate metabolic process |
4. PB | GO:0043034 | costamere |
4. PB | GO:0005576 | extracellular region |
4. PB | GO:0009590 | detection of gravity |
4. PB | GO:0030003 | cellular cation homeostasis |
4. PB | GO:0016010 | dystrophin-associated glycoprotein complex |
4. PB | GO:0071259 | cellular response to magnetism |
4. PB | GO:0046386 | deoxyribose phosphate catabolic process |
4. PB | GO:0014706 | striated muscle tissue development |
4. PB | GO:0030018 | Z disc |
5. P | GO:0006041 | glucosamine metabolic process |
5. P | GO:0034221 | fungal-type cell wall chitin biosynthetic process |
5. P | GO:0030097 | hemopoiesis |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0071704 | organic substance metabolic process |
GO:0004615 | phosphomannomutase activity |
GO:0005975 | carbohydrate metabolic process |
GO:0016853 | isomerase activity |
GO:0016868 | intramolecular transferase activity, phosphotransferases |
GO:0046872 | metal ion binding |
GO:0000287 | magnesium ion binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | C3K264 | Phosphoglucosamine mutase | 5.08e-13 | 9.41e-20 | 7.97e-08 | 0.7926 |
1. PBF | B9DM98 | Phosphoglucosamine mutase | 0.00e+00 | 1.54e-15 | 1.92e-08 | 0.7769 |
1. PBF | O85343 | Phosphomannomutase | 0.00e+00 | 8.26e-18 | 1.59e-06 | 0.854 |
1. PBF | Q8U2H4 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.31e-19 | 2.71e-17 | 0.8022 |
1. PBF | B3Q6Y9 | Phosphoglucosamine mutase | 2.68e-13 | 4.60e-13 | 4.90e-11 | 0.7774 |
1. PBF | Q7VF98 | Phosphoglucosamine mutase | 4.90e-13 | 3.54e-19 | 7.03e-14 | 0.7719 |
1. PBF | Q5R979 | Glucose 1,6-bisphosphate synthase | 0.00e+00 | 5.87e-36 | 1.11e-69 | 0.8777 |
1. PBF | A5EUT6 | Phosphoglucosamine mutase | 0.00e+00 | 5.84e-20 | 4.31e-06 | 0.7844 |
1. PBF | A0Q8C5 | Phosphoglucosamine mutase | 1.67e-15 | 1.56e-15 | 1.60e-05 | 0.7593 |
1. PBF | Q0SQL7 | Phosphoglucosamine mutase | 0.00e+00 | 1.31e-18 | 9.31e-13 | 0.7675 |
1. PBF | Q03K54 | Phosphoglucosamine mutase | 0.00e+00 | 2.75e-20 | 0.001 | 0.7778 |
1. PBF | A1S457 | Phosphoglucosamine mutase 1 | 7.13e-13 | 2.47e-18 | 3.05e-12 | 0.7645 |
1. PBF | A7I458 | Phosphoglucosamine mutase | 0.00e+00 | 1.63e-16 | 4.82e-15 | 0.7815 |
1. PBF | A6VU24 | Phosphoglucosamine mutase | 9.97e-13 | 3.68e-17 | 2.54e-10 | 0.7639 |
1. PBF | Q9ZMZ2 | Phosphoglucosamine mutase | 0.00e+00 | 4.17e-16 | 3.34e-13 | 0.7678 |
1. PBF | Q28NS0 | Phosphoglucosamine mutase | 0.00e+00 | 9.99e-17 | 5.91e-09 | 0.7674 |
1. PBF | P38569 | Phosphoglucomutase | 0.00e+00 | 1.20e-40 | 2.15e-16 | 0.7548 |
1. PBF | Q88C93 | Phosphomannomutase/phosphoglucomutase | 0.00e+00 | 6.94e-16 | 3.15e-09 | 0.8198 |
1. PBF | Q5HM67 | Phosphoglucosamine mutase | 0.00e+00 | 4.09e-14 | 1.96e-09 | 0.785 |
1. PBF | A8FKE8 | Phosphoglucosamine mutase | 0.00e+00 | 4.23e-16 | 9.45e-14 | 0.7847 |
1. PBF | C1DFL3 | Phosphoglucosamine mutase | 4.46e-13 | 6.57e-18 | 2.16e-05 | 0.8011 |
1. PBF | B2UGP7 | Phosphoglucosamine mutase | 8.22e-13 | 4.55e-16 | 2.27e-11 | 0.7908 |
1. PBF | B6JPH8 | Phosphoglucosamine mutase | 0.00e+00 | 1.78e-15 | 9.21e-13 | 0.7701 |
1. PBF | Q0HWV8 | Phosphoglucosamine mutase 2 | 0.00e+00 | 7.53e-17 | 1.72e-08 | 0.7813 |
1. PBF | A8F9E6 | Phosphoglucosamine mutase | 0.00e+00 | 1.45e-16 | 1.18e-10 | 0.7771 |
1. PBF | C0M9C4 | Phosphoglucosamine mutase | 6.66e-16 | 1.56e-17 | 1.66e-04 | 0.7745 |
1. PBF | Q493U0 | Phosphoglucosamine mutase | 5.76e-13 | 2.96e-18 | 8.60e-09 | 0.7884 |
1. PBF | Q7W8R3 | Phosphoglucosamine mutase | 9.72e-13 | 3.97e-17 | 4.22e-14 | 0.7464 |
1. PBF | Q5X1A3 | Phosphoglucosamine mutase | 1.23e-12 | 1.24e-17 | 2.77e-07 | 0.7362 |
1. PBF | Q8XZ76 | Phosphoglucosamine mutase | 6.97e-13 | 3.65e-16 | 6.98e-13 | 0.7606 |
1. PBF | Q0W4I8 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.38e-17 | 4.06e-28 | 0.8385 |
1. PBF | Q1MC77 | Phosphoglucosamine mutase | 0.00e+00 | 2.73e-17 | 1.65e-17 | 0.8042 |
1. PBF | C0QGV9 | Phosphoglucosamine mutase | 1.99e-12 | 6.47e-18 | 2.89e-09 | 0.7457 |
1. PBF | Q98F91 | Phosphoglucosamine mutase | 0.00e+00 | 1.06e-12 | 6.30e-13 | 0.794 |
1. PBF | Q2IHZ5 | Phosphoglucosamine mutase | 1.22e-12 | 2.21e-18 | 1.49e-12 | 0.7496 |
1. PBF | Q7NRI6 | Phosphoglucosamine mutase | 2.12e-13 | 2.37e-15 | 3.94e-11 | 0.7705 |
1. PBF | B5YS65 | Phosphoglucosamine mutase | 7.08e-13 | 1.75e-14 | 2.10e-09 | 0.7865 |
1. PBF | Q6LUJ6 | Phosphoglucosamine mutase | 1.15e-12 | 5.26e-16 | 4.46e-13 | 0.7802 |
1. PBF | Q9P931 | Phosphoglucomutase | 0.00e+00 | 1.95e-09 | 2.89e-04 | 0.7268 |
1. PBF | A6LMW5 | Phosphoglucosamine mutase | 7.66e-15 | 3.03e-13 | 6.11e-15 | 0.764 |
1. PBF | A6WY87 | Phosphoglucosamine mutase | 8.39e-13 | 2.77e-16 | 4.63e-14 | 0.7916 |
1. PBF | B0TQA7 | Phosphoglucosamine mutase | 8.63e-13 | 5.31e-19 | 8.81e-15 | 0.7851 |
1. PBF | A4XBI5 | Phosphoglucosamine mutase | 0.00e+00 | 1.53e-16 | 3.81e-10 | 0.7845 |
1. PBF | Q1JC19 | Phosphoglucosamine mutase | 0.00e+00 | 1.86e-19 | 5.53e-07 | 0.7705 |
1. PBF | Q01411 | Phosphomannomutase | 0.00e+00 | 1.76e-17 | 1.97e-06 | 0.861 |
1. PBF | Q8P179 | Phosphoglucosamine mutase | 6.66e-16 | 1.54e-19 | 3.92e-06 | 0.7648 |
1. PBF | Q5NNT4 | Phosphoglucosamine mutase | 0.00e+00 | 3.06e-15 | 4.17e-07 | 0.7662 |
1. PBF | Q74C70 | Phosphoglucosamine mutase | 7.77e-13 | 1.49e-15 | 7.37e-18 | 0.7605 |
1. PBF | Q7CPP9 | Phosphoglucosamine mutase | 8.43e-13 | 7.73e-14 | 1.38e-08 | 0.7862 |
1. PBF | Q3M6L2 | Phosphoglucosamine mutase | 0.00e+00 | 1.12e-21 | 6.13e-21 | 0.7429 |
1. PBF | C5CKU7 | Phosphoglucosamine mutase | 8.43e-13 | 6.61e-19 | 1.86e-09 | 0.7806 |
1. PBF | Q20YZ7 | Phosphoglucosamine mutase | 3.44e-13 | 2.44e-13 | 9.81e-13 | 0.7663 |
1. PBF | A8AQ65 | Phosphoglucosamine mutase | 9.83e-13 | 1.53e-13 | 3.26e-09 | 0.7836 |
1. PBF | Q1CV79 | Phosphoglucosamine mutase | 0.00e+00 | 1.15e-15 | 4.36e-13 | 0.7716 |
1. PBF | P95575 | Phosphoglucosamine mutase | 6.04e-13 | 2.35e-19 | 1.49e-08 | 0.7798 |
1. PBF | A7HCU0 | Phosphoglucosamine mutase | 1.48e-12 | 5.93e-19 | 5.63e-12 | 0.7392 |
1. PBF | B2GAN5 | Phosphoglucosamine mutase | 0.00e+00 | 2.83e-18 | 1.80e-09 | 0.7681 |
1. PBF | Q7A3K7 | Phosphoglucomutase | 0.00e+00 | 2.02e-60 | 1.58e-83 | 0.9053 |
1. PBF | Q46ZA1 | Phosphoglucosamine mutase | 9.19e-13 | 1.66e-17 | 1.16e-09 | 0.7997 |
1. PBF | A9M1R2 | Phosphoglucosamine mutase | 3.83e-13 | 2.33e-15 | 1.60e-09 | 0.7712 |
1. PBF | B7JL64 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7822 |
1. PBF | A5UC76 | Phosphoglucosamine mutase | 4.74e-13 | 2.22e-16 | 7.37e-13 | 0.7713 |
1. PBF | Q5PLC4 | Phosphoglucosamine mutase | 8.45e-13 | 5.25e-14 | 1.79e-08 | 0.7865 |
1. PBF | Q6G6I3 | Phosphoglucomutase | 0.00e+00 | 4.58e-58 | 5.42e-84 | 0.9175 |
1. PBF | Q74K59 | Phosphoglucosamine mutase | 8.24e-13 | 1.26e-17 | 2.64e-06 | 0.7825 |
1. PBF | P40390 | Phosphoglucomutase | 0.00e+00 | 1.03e-16 | 9.80e-08 | 0.8027 |
1. PBF | C1CLQ9 | Phosphoglucosamine mutase | 0.00e+00 | 6.03e-20 | 1.02e-05 | 0.7669 |
1. PBF | Q8U9L9 | Phosphoglucosamine mutase | 0.00e+00 | 9.42e-17 | 5.09e-15 | 0.7991 |
1. PBF | B7N0V9 | Phosphoglucosamine mutase | 9.36e-13 | 4.90e-15 | 2.69e-09 | 0.778 |
1. PBF | Q02FS3 | Phosphoglucosamine mutase | 4.20e-13 | 4.01e-19 | 1.91e-12 | 0.7899 |
1. PBF | B2VGT8 | Phosphoglucosamine mutase | 8.07e-13 | 3.35e-16 | 3.15e-10 | 0.7904 |
1. PBF | A9VPC3 | Phosphoglucosamine mutase | 0.00e+00 | 3.11e-16 | 9.09e-12 | 0.7891 |
1. PBF | Q17VS9 | Phosphoglucosamine mutase | 0.00e+00 | 1.01e-15 | 3.72e-13 | 0.7728 |
1. PBF | A2S3Q4 | Phosphoglucosamine mutase | 2.60e-12 | 5.15e-18 | 1.19e-08 | 0.7498 |
1. PBF | Q7VZ59 | Phosphoglucosamine mutase | 1.05e-12 | 5.27e-17 | 6.70e-14 | 0.744 |
1. PBF | A1VQI3 | Phosphoglucosamine mutase | 5.38e-13 | 4.05e-20 | 1.52e-16 | 0.788 |
1. PBF | A1S7U2 | Phosphoglucosamine mutase 2 | 0.00e+00 | 4.29e-16 | 4.08e-07 | 0.7796 |
1. PBF | A4IW39 | Phosphoglucosamine mutase | 1.67e-15 | 1.96e-15 | 6.18e-06 | 0.757 |
1. PBF | P0C7J2 | Phosphohexose mutases | 0.00e+00 | 1.36e-17 | 1.32e-06 | 0.8453 |
1. PBF | B3PYX0 | Phosphoglucosamine mutase | 0.00e+00 | 3.97e-17 | 2.39e-18 | 0.8059 |
1. PBF | B1XP15 | Phosphoglucosamine mutase | 1.11e-16 | 8.31e-23 | 7.45e-17 | 0.7568 |
1. PBF | Q68BJ7 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.17e-18 | 1.70e-17 | 0.8177 |
1. PBF | B7LHN9 | Phosphoglucosamine mutase | 9.18e-13 | 3.11e-15 | 7.64e-10 | 0.7974 |
1. PBF | Q2P0U5 | Phosphoglucosamine mutase | 0.00e+00 | 3.68e-17 | 1.96e-07 | 0.7709 |
1. PBF | B8HCH4 | Phosphoglucosamine mutase | 0.00e+00 | 7.89e-18 | 1.58e-14 | 0.778 |
1. PBF | B1J265 | Phosphoglucosamine mutase | 5.66e-13 | 3.25e-21 | 1.15e-07 | 0.7913 |
1. PBF | B5Z677 | Phosphoglucosamine mutase | 0.00e+00 | 1.96e-15 | 2.24e-13 | 0.7754 |
1. PBF | Q031P2 | Phosphoglucosamine mutase | 0.00e+00 | 7.90e-20 | 1.02e-06 | 0.7659 |
1. PBF | Q82DL7 | Phosphoglucosamine mutase | 0.00e+00 | 7.20e-18 | 5.71e-12 | 0.7954 |
1. PBF | Q68BJ6 | Phosphoglucomutase/phosphomannomutase | 0.00e+00 | 4.27e-19 | 7.81e-31 | 0.8646 |
1. PBF | Q32BF7 | Phosphoglucosamine mutase | 1.05e-12 | 2.33e-15 | 2.01e-08 | 0.7844 |
1. PBF | B6IZD8 | Phosphoglucosamine mutase | 7.71e-13 | 2.11e-18 | 2.76e-08 | 0.7909 |
1. PBF | B7GUF2 | Phosphoglucosamine mutase | 0.00e+00 | 9.97e-16 | 1.11e-15 | 0.7608 |
1. PBF | Q49ZA7 | Phosphoglucosamine mutase | 0.00e+00 | 1.75e-15 | 3.54e-07 | 0.7749 |
1. PBF | Q0HXS0 | Phosphoglucosamine mutase 1 | 7.77e-13 | 1.56e-17 | 1.39e-14 | 0.7665 |
1. PBF | C6DKI6 | Phosphoglucosamine mutase | 7.41e-13 | 6.79e-15 | 3.12e-07 | 0.7799 |
1. PBF | A2RIG0 | Phosphoglucosamine mutase | 3.33e-16 | 2.17e-19 | 1.02e-06 | 0.7451 |
1. PBF | Q3A5V5 | Phosphoglucosamine mutase | 7.78e-13 | 9.95e-15 | 4.36e-15 | 0.7605 |
1. PBF | B4SQU4 | Phosphoglucosamine mutase | 0.00e+00 | 3.31e-17 | 2.05e-09 | 0.7615 |
1. PBF | B7HQZ0 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7907 |
1. PBF | Q0VSS6 | Phosphoglucosamine mutase | 0.00e+00 | 1.67e-14 | 4.46e-09 | 0.7804 |
1. PBF | Q03AF8 | Phosphoglucosamine mutase | 0.00e+00 | 1.02e-14 | 0.025 | 0.7666 |
1. PBF | B1YH95 | Phosphoglucosamine mutase | 3.67e-13 | 1.34e-17 | 4.13e-09 | 0.7467 |
1. PBF | A4WEY7 | Phosphoglucosamine mutase | 7.76e-13 | 2.20e-15 | 7.87e-12 | 0.7919 |
1. PBF | Q2SML8 | Phosphoglucosamine mutase | 1.01e-12 | 9.16e-19 | 3.05e-10 | 0.7935 |
1. PBF | Q1CEK9 | Phosphoglucosamine mutase | 1.02e-12 | 2.85e-14 | 9.90e-09 | 0.7737 |
1. PBF | Q8YIU8 | Phosphoglucosamine mutase | 4.44e-16 | 1.86e-16 | 5.13e-16 | 0.7812 |
1. PBF | Q99RE2 | Phosphoglucomutase | 0.00e+00 | 2.02e-60 | 1.58e-83 | 0.8846 |
1. PBF | A3PH12 | Phosphoglucosamine mutase | 0.00e+00 | 1.12e-15 | 1.00e-10 | 0.803 |
1. PBF | Q5Z1H8 | Phosphoglucosamine mutase | 0.00e+00 | 2.46e-16 | 1.31e-11 | 0.7553 |
1. PBF | Q65P47 | Phosphoglucosamine mutase | 0.00e+00 | 2.21e-17 | 1.62e-10 | 0.7748 |
1. PBF | A7IIG5 | Phosphoglucosamine mutase | 0.00e+00 | 2.77e-14 | 2.03e-10 | 0.7692 |
1. PBF | B8ZUC1 | Phosphoglucosamine mutase | 0.00e+00 | 3.90e-15 | 7.19e-11 | 0.7651 |
1. PBF | A1UC06 | Phosphoglucosamine mutase | 0.00e+00 | 3.12e-17 | 5.59e-06 | 0.7713 |
1. PBF | A0PMD3 | Phosphoglucosamine mutase | 0.00e+00 | 1.66e-17 | 2.74e-12 | 0.7741 |
1. PBF | B0ULF6 | Phosphoglucosamine mutase | 6.56e-13 | 1.63e-14 | 3.10e-13 | 0.7942 |
1. PBF | A9N740 | Phosphoglucosamine mutase | 1.07e-12 | 7.73e-14 | 1.38e-08 | 0.7789 |
1. PBF | A0KTZ1 | Phosphoglucosamine mutase | 1.03e-12 | 5.04e-17 | 1.13e-14 | 0.7651 |
1. PBF | Q24NW7 | Phosphoglucosamine mutase | 0.00e+00 | 2.65e-17 | 1.52e-15 | 0.7743 |
1. PBF | A7GW10 | Phosphoglucosamine mutase | 0.00e+00 | 2.93e-14 | 7.69e-16 | 0.7645 |
1. PBF | B6J7Z9 | Phosphoglucosamine mutase | 6.70e-13 | 2.11e-18 | 2.76e-08 | 0.7958 |
1. PBF | A2BUM2 | Phosphoglucosamine mutase | 0.00e+00 | 2.88e-18 | 2.18e-12 | 0.792 |
1. PBF | P37755 | Phosphomannomutase | 0.00e+00 | 5.90e-15 | 5.25e-05 | 0.8597 |
1. PBF | A6VP84 | Phosphoglucosamine mutase | 6.01e-13 | 2.08e-17 | 3.64e-13 | 0.7768 |
1. PBF | P65704 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7899 |
1. PBF | A6T078 | Phosphoglucosamine mutase | 7.18e-13 | 8.05e-14 | 3.91e-10 | 0.7741 |
1. PBF | C0ZIM8 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-14 | 2.71e-09 | 0.7647 |
1. PBF | A5V2D8 | Phosphoglucosamine mutase | 0.00e+00 | 8.75e-16 | 5.18e-11 | 0.7863 |
1. PBF | A9HYU0 | Phosphoglucosamine mutase | 6.71e-13 | 3.40e-18 | 9.30e-15 | 0.776 |
1. PBF | Q2NES6 | Probable phosphoglucosamine mutase | 0.00e+00 | 8.36e-17 | 1.47e-19 | 0.838 |
1. PBF | Q14JZ1 | Phosphoglucosamine mutase | 0.00e+00 | 2.20e-15 | 1.47e-05 | 0.7556 |
1. PBF | A5VIK4 | Phosphoglucosamine mutase | 0.00e+00 | 1.72e-19 | 3.58e-13 | 0.7887 |
1. PBF | B2HCZ2 | Phosphoglucosamine mutase | 0.00e+00 | 2.08e-17 | 1.06e-11 | 0.7709 |
1. PBF | A8H745 | Phosphoglucosamine mutase | 1.29e-12 | 1.35e-18 | 2.72e-13 | 0.7781 |
1. PBF | A1JIW5 | Phosphoglucosamine mutase | 9.44e-13 | 2.89e-14 | 3.73e-09 | 0.7959 |
1. PBF | Q4WY53 | Phosphoglucomutase | 0.00e+00 | 4.84e-11 | 5.31e-05 | 0.7203 |
1. PBF | Q1H384 | Phosphoglucosamine mutase | 9.62e-13 | 8.88e-19 | 3.16e-13 | 0.7754 |
1. PBF | Q03SJ3 | Phosphoglucosamine mutase | 0.00e+00 | 1.68e-17 | 8.72e-07 | 0.7731 |
1. PBF | Q31HG3 | Phosphoglucosamine mutase | 0.00e+00 | 7.79e-16 | 1.36e-07 | 0.7768 |
1. PBF | Q13W50 | Phosphoglucosamine mutase | 1.86e-12 | 1.19e-17 | 1.54e-10 | 0.7655 |
1. PBF | Q63H45 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7892 |
1. PBF | Q7V349 | Phosphoglucosamine mutase | 0.00e+00 | 2.17e-19 | 4.78e-14 | 0.789 |
1. PBF | A4JDA9 | Phosphoglucosamine mutase | 1.83e-12 | 2.98e-19 | 1.06e-08 | 0.7715 |
1. PBF | Q1LSK5 | Phosphoglucosamine mutase | 4.20e-13 | 9.69e-16 | 3.14e-08 | 0.8 |
1. PBF | A9KZX6 | Phosphoglucosamine mutase 1 | 1.07e-12 | 5.85e-17 | 8.06e-13 | 0.764 |
1. PBF | Q8FD84 | Phosphoglucosamine mutase | 8.68e-13 | 9.68e-15 | 2.06e-09 | 0.7846 |
1. PBF | Q5PA34 | Phosphoglucosamine mutase | 0.00e+00 | 3.62e-18 | 1.78e-07 | 0.7805 |
1. PBF | Q8EHM0 | Phosphoglucosamine mutase | 8.00e-13 | 9.28e-17 | 2.15e-14 | 0.7664 |
1. PBF | B2SZR6 | Phosphoglucosamine mutase | 1.58e-12 | 1.31e-18 | 3.40e-10 | 0.7726 |
1. PBF | A8YYC6 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-15 | 2.50e-07 | 0.7851 |
1. PBF | A0K6C4 | Phosphoglucosamine mutase | 1.89e-12 | 4.41e-19 | 1.56e-09 | 0.7627 |
1. PBF | C1CSI0 | Phosphoglucosamine mutase | 0.00e+00 | 6.03e-20 | 1.02e-05 | 0.7731 |
1. PBF | Q6FYQ7 | Phosphoglucosamine mutase | 0.00e+00 | 9.69e-16 | 1.08e-10 | 0.7886 |
1. PBF | A1KV99 | Phosphoglucosamine mutase | 3.05e-13 | 1.01e-15 | 3.04e-11 | 0.7754 |
1. PBF | A1R8Q0 | Phosphoglucosamine mutase | 0.00e+00 | 3.39e-16 | 4.73e-14 | 0.7735 |
1. PBF | B8ER03 | Phosphoglucosamine mutase | 0.00e+00 | 3.34e-15 | 5.16e-13 | 0.7904 |
1. PBF | Q6HPL3 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7712 |
1. PBF | A4FPG9 | Phosphoglucosamine mutase | 0.00e+00 | 4.09e-18 | 1.63e-07 | 0.7734 |
1. PBF | Q08DP0 | Phosphoglucomutase-1 | 0.00e+00 | 5.49e-15 | 7.71e-10 | 0.7274 |
1. PBF | Q9PDB1 | Phosphoglucosamine mutase | 0.00e+00 | 1.19e-19 | 1.18e-06 | 0.7673 |
1. PBF | Q5HWA7 | Phosphoglucosamine mutase | 0.00e+00 | 4.68e-16 | 5.34e-14 | 0.7853 |
1. PBF | B2K2Q1 | Phosphoglucosamine mutase | 1.05e-12 | 2.85e-14 | 9.90e-09 | 0.775 |
1. PBF | B2U201 | Phosphoglucosamine mutase | 9.04e-13 | 7.40e-15 | 2.06e-09 | 0.7912 |
1. PBF | B0KD39 | Phosphoglucosamine mutase | 3.33e-16 | 4.82e-16 | 8.34e-17 | 0.7734 |
1. PBF | B6END8 | Phosphoglucosamine mutase | 5.49e-13 | 6.12e-17 | 8.43e-09 | 0.7995 |
1. PBF | Q21H51 | Phosphoglucosamine mutase | 5.90e-13 | 1.91e-16 | 3.67e-09 | 0.7685 |
1. PBF | Q88DV3 | Phosphoglucosamine mutase | 7.19e-13 | 6.66e-21 | 5.20e-08 | 0.7756 |
1. PBF | C4Z1Z8 | Phosphoglucosamine mutase | 0.00e+00 | 3.27e-19 | 7.64e-05 | 0.7405 |
1. PBF | Q168N3 | Phosphoglucosamine mutase | 9.07e-13 | 3.10e-14 | 2.48e-11 | 0.7995 |
1. PBF | Q2YW66 | Phosphoglucomutase | 0.00e+00 | 9.36e-60 | 6.87e-83 | 0.9083 |
1. PBF | B2GJ26 | Phosphoglucosamine mutase | 2.71e-13 | 1.68e-16 | 5.53e-13 | 0.7621 |
1. PBF | A1WEE4 | Phosphoglucosamine mutase | 0.00e+00 | 4.55e-19 | 3.94e-13 | 0.7888 |
1. PBF | Q07IZ1 | Phosphoglucosamine mutase | 3.21e-13 | 4.25e-13 | 2.06e-13 | 0.7746 |
1. PBF | Q9RSQ3 | Phosphoglucosamine mutase | 0.00e+00 | 4.54e-17 | 1.01e-11 | 0.7489 |
1. PBF | Q3IE61 | Phosphoglucosamine mutase | 8.30e-13 | 2.07e-19 | 1.85e-14 | 0.7724 |
1. PBF | Q4JTD7 | Phosphoglucosamine mutase | 0.00e+00 | 7.25e-16 | 2.63e-13 | 0.7885 |
1. PBF | Q1QP86 | Phosphoglucosamine mutase | 0.00e+00 | 4.44e-15 | 2.86e-13 | 0.7799 |
1. PBF | A2BP40 | Phosphoglucosamine mutase | 8.88e-16 | 2.24e-20 | 9.48e-14 | 0.7532 |
1. PBF | A4IJN4 | Phosphoglucosamine mutase | 0.00e+00 | 6.89e-17 | 1.27e-12 | 0.7852 |
1. PBF | A3PAW2 | Phosphoglucosamine mutase | 1.11e-15 | 1.14e-16 | 3.39e-12 | 0.7637 |
1. PBF | Q7M9M2 | Phosphoglucosamine mutase | 0.00e+00 | 1.83e-13 | 8.86e-12 | 0.775 |
1. PBF | A5FWQ4 | Phosphoglucosamine mutase | 3.33e-16 | 1.03e-15 | 8.98e-10 | 0.7595 |
1. PBF | Q6AMQ5 | Phosphoglucosamine mutase | 3.55e-13 | 1.05e-18 | 2.77e-14 | 0.7863 |
1. PBF | B4TJ12 | Phosphoglucosamine mutase | 7.67e-13 | 7.73e-14 | 1.38e-08 | 0.7794 |
1. PBF | A1AZG3 | Phosphoglucosamine mutase | 0.00e+00 | 5.91e-16 | 5.16e-13 | 0.7707 |
1. PBF | B2FNY7 | Phosphoglucosamine mutase | 0.00e+00 | 3.03e-17 | 8.16e-10 | 0.7645 |
1. PBF | Q8G533 | Phosphoglucosamine mutase | 0.00e+00 | 1.19e-15 | 4.24e-16 | 0.7414 |
1. PBF | Q6D9B6 | Phosphoglucosamine mutase | 9.41e-13 | 3.69e-15 | 1.06e-07 | 0.7805 |
1. PBF | A0L4J3 | Phosphoglucosamine mutase | 7.88e-13 | 2.69e-14 | 6.51e-16 | 0.7206 |
1. PBF | Q3SJR2 | Phosphoglucosamine mutase | 1.08e-12 | 8.77e-18 | 7.14e-12 | 0.7625 |
1. PBF | Q9UZT5 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.21e-21 | 3.61e-20 | 0.8043 |
1. PBF | Q9SM59 | Phosphoglucomutase, chloroplastic | 0.00e+00 | 1.71e-08 | 7.32e-04 | 0.732 |
1. PBF | A9HB20 | Phosphoglucosamine mutase | 0.00e+00 | 4.57e-14 | 7.61e-11 | 0.7756 |
1. PBF | A7FMS6 | Phosphoglucosamine mutase | 1.18e-12 | 2.85e-14 | 9.90e-09 | 0.7678 |
1. PBF | C3LJZ1 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7887 |
1. PBF | B1ZBR8 | Phosphoglucosamine mutase | 7.98e-13 | 5.85e-17 | 1.15e-11 | 0.7978 |
1. PBF | A3MIQ6 | Phosphoglucosamine mutase | 2.39e-12 | 5.15e-18 | 1.19e-08 | 0.7575 |
1. PBF | Q4L837 | Phosphoglucosamine mutase | 0.00e+00 | 2.06e-16 | 2.99e-07 | 0.7789 |
1. PBF | B8D7R7 | Phosphoglucosamine mutase | 1.56e-12 | 1.17e-17 | 2.61e-09 | 0.8087 |
1. PBF | Q1LLB1 | Phosphoglucosamine mutase | 6.37e-13 | 9.28e-15 | 1.34e-11 | 0.796 |
1. PBF | Q0RRN7 | Phosphoglucosamine mutase | 0.00e+00 | 4.35e-22 | 7.87e-13 | 0.7665 |
1. PBF | Q1WSZ9 | Phosphoglucosamine mutase | 0.00e+00 | 1.60e-16 | 4.20e-04 | 0.7688 |
1. PBF | A6VCK6 | Phosphoglucosamine mutase | 5.99e-13 | 8.75e-19 | 1.30e-11 | 0.7903 |
1. PBF | A1KPC8 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | 0.785 |
1. PBF | Q6LYB4 | Phosphoglucosamine mutase | 0.00e+00 | 1.62e-20 | 1.87e-14 | 0.8252 |
1. PBF | B0B944 | Phosphoglucosamine mutase | 1.03e-12 | 2.21e-17 | 2.95e-12 | 0.7747 |
1. PBF | A1SF29 | Phosphoglucosamine mutase | 0.00e+00 | 6.49e-17 | 5.34e-12 | 0.7688 |
1. PBF | Q48TV1 | Phosphoglucosamine mutase | 4.44e-16 | 1.31e-19 | 1.00e-06 | 0.7687 |
1. PBF | Q9SMM0 | Phosphoglucomutase, chloroplastic | 0.00e+00 | 6.88e-09 | 1.01e-05 | 0.7195 |
1. PBF | B9DYJ3 | Phosphoglucosamine mutase | 0.00e+00 | 2.08e-17 | 8.58e-15 | 0.7705 |
1. PBF | B8DWH9 | Phosphoglucosamine mutase | 0.00e+00 | 3.58e-15 | 2.70e-14 | 0.7715 |
1. PBF | Q2W2C2 | Phosphoglucosamine mutase | 0.00e+00 | 3.68e-17 | 9.77e-12 | 0.7849 |
1. PBF | B2I1H8 | Phosphoglucosamine mutase | 9.23e-13 | 3.58e-15 | 5.51e-11 | 0.7468 |
1. PBF | Q8DBW4 | Phosphoglucosamine mutase | 9.43e-13 | 1.01e-14 | 3.59e-06 | 0.7779 |
1. PBF | Q2LRC1 | Phosphoglucosamine mutase | 1.16e-12 | 6.79e-17 | 3.66e-12 | 0.7839 |
1. PBF | A7ZS72 | Phosphoglucosamine mutase | 1.07e-12 | 7.40e-15 | 2.06e-09 | 0.7904 |
1. PBF | C0ZW79 | Phosphoglucosamine mutase | 0.00e+00 | 8.12e-17 | 5.59e-06 | 0.7811 |
1. PBF | Q02E40 | Phosphomannomutase/phosphoglucomutase | 0.00e+00 | 1.99e-17 | 5.25e-08 | 0.8139 |
1. PBF | B9JRY5 | Phosphoglucosamine mutase | 0.00e+00 | 1.29e-16 | 3.70e-11 | 0.799 |
1. PBF | Q4L9R5 | Phosphoglucomutase | 0.00e+00 | 2.46e-51 | 6.76e-87 | 0.8998 |
1. PBF | A8A4Z0 | Phosphoglucosamine mutase | 9.10e-13 | 7.40e-15 | 2.06e-09 | 0.7913 |
1. PBF | A1ST41 | Phosphoglucosamine mutase | 7.21e-13 | 2.38e-17 | 2.10e-10 | 0.7793 |
1. PBF | B7GV90 | Phosphoglucosamine mutase | 1.26e-12 | 3.34e-15 | 1.70e-11 | 0.7487 |
1. PBF | Q5R0R2 | Phosphoglucosamine mutase | 6.83e-13 | 1.48e-18 | 3.38e-08 | 0.781 |
1. PBF | Q5L3P1 | Phosphoglucosamine mutase | 0.00e+00 | 7.31e-18 | 4.60e-11 | 0.7892 |
1. PBF | Q47HH9 | Phosphoglucosamine mutase | 7.55e-13 | 4.91e-19 | 1.09e-10 | 0.7855 |
1. PBF | Q03GV0 | Phosphoglucosamine mutase | 0.00e+00 | 1.80e-19 | 1.73e-05 | 0.772 |
1. PBF | A0KNE8 | Phosphoglucosamine mutase | 7.10e-13 | 1.36e-17 | 2.08e-10 | 0.7817 |
1. PBF | A5CXP9 | Phosphoglucosamine mutase | 5.20e-13 | 4.76e-19 | 5.67e-07 | 0.8033 |
1. PBF | O27627 | Probable phosphoglucosamine mutase | 0.00e+00 | 9.80e-22 | 4.25e-26 | 0.8174 |
1. PBF | Q1CC03 | Phosphoglucosamine mutase | 1.06e-12 | 2.85e-14 | 9.90e-09 | 0.7717 |
1. PBF | Q0BK99 | Phosphoglucosamine mutase | 1.78e-15 | 1.32e-14 | 7.11e-06 | 0.7564 |
1. PBF | B1IG08 | Phosphoglucosamine mutase | 0.00e+00 | 9.81e-15 | 1.68e-16 | 0.7692 |
1. PBF | B1L9W8 | Phosphoglucosamine mutase | 0.00e+00 | 1.90e-12 | 7.56e-08 | 0.7765 |
1. PBF | B2IR78 | Phosphoglucosamine mutase | 0.00e+00 | 1.03e-19 | 8.95e-06 | 0.7727 |
1. PBF | B2A4R9 | Phosphoglucosamine mutase | 0.00e+00 | 1.03e-15 | 7.53e-14 | 0.7904 |
1. PBF | Q3YX65 | Phosphoglucosamine mutase | 8.45e-13 | 9.68e-15 | 2.06e-09 | 0.7829 |
1. PBF | Q5FL35 | Phosphoglucosamine mutase | 0.00e+00 | 5.91e-16 | 1.01e-04 | 0.7813 |
1. PBF | A9WMF8 | Phosphoglucosamine mutase | 0.00e+00 | 2.73e-17 | 6.65e-12 | 0.7731 |
1. PBF | B5F6U4 | Phosphoglucosamine mutase | 8.28e-13 | 7.73e-14 | 1.38e-08 | 0.7811 |
1. PBF | A5GW63 | Phosphoglucosamine mutase | 0.00e+00 | 1.65e-20 | 1.23e-13 | 0.7717 |
1. PBF | P99087 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7899 |
1. PBF | C1AHQ0 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | 0.7855 |
1. PBF | Q4FS01 | Phosphoglucosamine mutase | 1.33e-12 | 3.63e-15 | 5.68e-14 | 0.7447 |
1. PBF | Q8E049 | Phosphoglucosamine mutase | 6.66e-16 | 8.61e-19 | 7.44e-05 | 0.7653 |
1. PBF | Q890U1 | Phosphoglucosamine mutase | 0.00e+00 | 1.87e-18 | 8.51e-18 | 0.7639 |
1. PBF | A6VG24 | Phosphoglucosamine mutase | 0.00e+00 | 1.25e-19 | 1.10e-14 | 0.8091 |
1. PBF | Q9Z6U1 | Phosphoglucosamine mutase | 1.99e-12 | 1.08e-16 | 1.17e-10 | 0.7665 |
1. PBF | Q5WT16 | Phosphoglucosamine mutase | 0.00e+00 | 1.17e-17 | 5.84e-08 | 0.7407 |
1. PBF | B9MMU5 | Phosphoglucosamine mutase | 0.00e+00 | 7.79e-16 | 5.41e-12 | 0.7559 |
1. PBF | P57461 | Phosphoglucosamine mutase | 2.23e-12 | 1.17e-17 | 2.61e-09 | 0.7946 |
1. PBF | A8LAZ9 | Phosphoglucosamine mutase | 0.00e+00 | 7.41e-20 | 5.18e-07 | 0.7417 |
1. PBF | Q8DI20 | Phosphoglucosamine mutase | 0.00e+00 | 1.47e-19 | 1.03e-16 | 0.7943 |
1. PBF | Q2KVQ6 | Phosphoglucosamine mutase | 5.39e-13 | 1.03e-16 | 7.82e-10 | 0.7745 |
1. PBF | Q3AAK3 | Phosphoglucosamine mutase | 0.00e+00 | 2.47e-19 | 4.33e-13 | 0.7849 |
1. PBF | A6TW06 | Phosphoglucosamine mutase | 4.44e-16 | 3.52e-17 | 3.66e-20 | 0.7692 |
1. PBF | C1B058 | Phosphoglucosamine mutase | 0.00e+00 | 1.51e-17 | 5.05e-08 | 0.7726 |
1. PBF | A6WQD3 | Phosphoglucosamine mutase 2 | 0.00e+00 | 4.89e-17 | 1.16e-11 | 0.7709 |
1. PBF | B7NKP3 | Phosphoglucosamine mutase | 8.77e-13 | 6.07e-15 | 1.41e-09 | 0.7843 |
1. PBF | Q88YE8 | Phosphoglucosamine mutase | 0.00e+00 | 2.35e-18 | 0.010 | 0.7621 |
1. PBF | B0U6T2 | Phosphoglucosamine mutase | 0.00e+00 | 1.80e-19 | 1.21e-06 | 0.7704 |
1. PBF | P47723 | Phosphomannomutase | 0.00e+00 | 4.61e-62 | 2.37e-87 | 0.9406 |
1. PBF | C0MDT1 | Phosphoglucosamine mutase | 5.55e-16 | 1.10e-17 | 6.31e-05 | 0.7757 |
1. PBF | Q116W4 | Phosphoglucosamine mutase | 0.00e+00 | 3.30e-24 | 2.39e-11 | 0.7421 |
1. PBF | B8F5R2 | Phosphoglucosamine mutase | 7.25e-13 | 9.16e-19 | 1.26e-10 | 0.7812 |
1. PBF | B0K5X4 | Phosphoglucosamine mutase | 4.44e-16 | 7.25e-16 | 7.76e-17 | 0.7686 |
1. PBF | Q6MBL8 | Phosphoglucosamine mutase | 1.03e-12 | 1.56e-17 | 3.04e-16 | 0.7896 |
1. PBF | B0BAS3 | Phosphoglucosamine mutase | 1.25e-12 | 2.21e-17 | 2.95e-12 | 0.7697 |
1. PBF | Q4R5E4 | Phosphoglucomutase-1 | 0.00e+00 | 9.41e-15 | 2.57e-11 | 0.7163 |
1. PBF | Q1QC16 | Phosphoglucosamine mutase | 1.35e-12 | 1.68e-15 | 6.72e-14 | 0.7494 |
1. PBF | Q6MLS4 | Phosphoglucosamine mutase | 5.30e-13 | 4.48e-16 | 1.78e-11 | 0.764 |
1. PBF | Q5HLD2 | Phosphoglucomutase | 0.00e+00 | 2.02e-54 | 1.25e-82 | 0.8963 |
1. PBF | A8MJD2 | Phosphoglucosamine mutase | 0.00e+00 | 3.68e-17 | 5.84e-26 | 0.7764 |
1. PBF | Q0S3D6 | Phosphoglucosamine mutase | 0.00e+00 | 4.92e-18 | 6.25e-09 | 0.7968 |
1. PBF | Q2NW27 | Phosphoglucosamine mutase | 8.58e-13 | 5.04e-14 | 3.65e-08 | 0.7898 |
1. PBF | A9BMK7 | Phosphoglucosamine mutase | 7.33e-13 | 7.07e-20 | 3.79e-11 | 0.7806 |
1. PBF | B9K6U6 | Phosphoglucosamine mutase | 0.00e+00 | 3.01e-14 | 9.35e-09 | 0.7812 |
1. PBF | Q31LA7 | Phosphoglucosamine mutase | 0.00e+00 | 7.18e-20 | 1.40e-14 | 0.7635 |
1. PBF | Q48E72 | Phosphoglucosamine mutase | 7.01e-13 | 1.01e-18 | 2.26e-08 | 0.7776 |
1. PBF | C1FMP0 | Phosphoglucosamine mutase | 0.00e+00 | 1.47e-15 | 3.71e-16 | 0.7724 |
1. PBF | A5WEW6 | Phosphoglucosamine mutase | 1.03e-12 | 1.08e-16 | 4.16e-10 | 0.7613 |
1. PBF | Q0TMX1 | Phosphoglucosamine mutase | 0.00e+00 | 1.48e-18 | 4.28e-12 | 0.7738 |
1. PBF | A6Q6B6 | Phosphoglucosamine mutase | 0.00e+00 | 6.19e-13 | 1.06e-14 | 0.7869 |
1. PBF | Q4FN15 | Phosphoglucosamine mutase | 0.00e+00 | 4.70e-14 | 7.73e-11 | 0.8045 |
1. PBF | B9KM35 | Phosphoglucosamine mutase | 4.66e-13 | 1.12e-15 | 1.00e-10 | 0.8003 |
1. PBF | Q9PIE2 | Phosphoglucosamine mutase | 0.00e+00 | 3.16e-16 | 1.86e-13 | 0.7807 |
1. PBF | Q87LZ7 | Phosphoglucosamine mutase | 7.23e-13 | 5.43e-17 | 4.52e-07 | 0.7886 |
1. PBF | B7KWJ1 | Phosphoglucosamine mutase | 0.00e+00 | 7.53e-17 | 5.10e-13 | 0.8046 |
1. PBF | Q6GDU9 | Phosphoglucomutase | 0.00e+00 | 2.36e-60 | 1.83e-85 | 0.8949 |
1. PBF | A6UU47 | Phosphoglucosamine mutase | 0.00e+00 | 2.96e-18 | 2.55e-12 | 0.8154 |
1. PBF | A6UP86 | Phosphoglucosamine mutase | 0.00e+00 | 6.31e-19 | 4.76e-10 | 0.8218 |
1. PBF | P45632 | Phosphomannomutase | 0.00e+00 | 7.83e-21 | 1.47e-10 | 0.7972 |
1. PBF | A5F930 | Phosphoglucosamine mutase | 7.96e-13 | 1.31e-15 | 5.36e-06 | 0.7626 |
1. PBF | B3H286 | Phosphoglucosamine mutase | 5.37e-13 | 4.27e-17 | 8.61e-10 | 0.7842 |
1. PBF | Q5XCE0 | Phosphoglucosamine mutase | 5.55e-16 | 1.31e-19 | 1.00e-06 | 0.765 |
1. PBF | A1AG79 | Phosphoglucosamine mutase | 9.10e-13 | 9.68e-15 | 2.06e-09 | 0.7853 |
1. PBF | Q1JM03 | Phosphoglucosamine mutase | 0.00e+00 | 1.86e-19 | 5.53e-07 | 0.7692 |
1. PBF | Q73S29 | Phosphoglucosamine mutase | 0.00e+00 | 1.30e-16 | 6.24e-09 | 0.7751 |
1. PBF | Q15VJ3 | Phosphoglucosamine mutase | 5.03e-13 | 2.72e-16 | 1.47e-14 | 0.782 |
1. PBF | A6Q164 | Phosphoglucosamine mutase | 0.00e+00 | 9.99e-17 | 1.61e-17 | 0.7625 |
1. PBF | Q6GER6 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7907 |
1. PBF | B9DSE8 | Phosphoglucosamine mutase | 6.66e-16 | 2.70e-18 | 2.05e-05 | 0.7773 |
1. PBF | Q62L77 | Phosphoglucosamine mutase | 2.52e-12 | 5.15e-18 | 1.19e-08 | 0.7565 |
1. PBF | Q3SNB8 | Phosphoglucosamine mutase | 0.00e+00 | 1.34e-13 | 1.93e-11 | 0.7935 |
1. PBF | C3PAL5 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.785 |
1. PBF | Q7MI04 | Phosphoglucosamine mutase | 8.62e-13 | 1.20e-14 | 3.65e-06 | 0.7787 |
1. PBF | B6YXX2 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.95e-19 | 1.14e-18 | 0.8239 |
1. PBF | Q1IF48 | Phosphoglucosamine mutase | 6.15e-13 | 7.58e-21 | 2.79e-09 | 0.7755 |
1. PBF | Q6F717 | Phosphoglucosamine mutase | 7.59e-13 | 8.39e-14 | 8.00e-11 | 0.7543 |
1. PBF | B2UW73 | Phosphoglucosamine mutase | 0.00e+00 | 2.17e-15 | 3.85e-13 | 0.7734 |
1. PBF | A6QJ02 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-15 | 2.50e-07 | 0.7879 |
1. PBF | A1VY80 | Phosphoglucosamine mutase | 0.00e+00 | 3.99e-16 | 1.88e-13 | 0.7787 |
1. PBF | A6TEJ5 | Phosphoglucosamine mutase | 7.27e-13 | 7.68e-16 | 4.40e-09 | 0.772 |
1. PBF | Q0T0A8 | Phosphoglucosamine mutase | 7.04e-13 | 6.89e-15 | 9.68e-10 | 0.7916 |
1. PBF | C5BQ00 | Phosphoglucosamine mutase | 4.86e-13 | 1.49e-15 | 2.53e-09 | 0.7781 |
1. PBF | B3PLQ1 | Phosphoglucosamine mutase | 6.75e-13 | 1.08e-16 | 7.43e-07 | 0.7779 |
1. PBF | A9KSW8 | Phosphoglucosamine mutase | 0.00e+00 | 8.74e-23 | 9.46e-07 | 0.7643 |
1. PBF | Q2RVE4 | Phosphoglucosamine mutase | 0.00e+00 | 9.01e-16 | 5.07e-11 | 0.8003 |
1. PBF | Q99ZW8 | Phosphoglucosamine mutase | 5.55e-16 | 4.01e-19 | 4.27e-06 | 0.7652 |
1. PBF | A4Y9C5 | Phosphoglucosamine mutase | 9.21e-13 | 3.74e-17 | 9.12e-13 | 0.7746 |
1. PBF | C1CWA3 | Phosphoglucosamine mutase | 0.00e+00 | 7.65e-17 | 3.21e-09 | 0.7814 |
1. PBF | Q12QI6 | Phosphoglucosamine mutase | 8.58e-13 | 2.53e-17 | 3.67e-14 | 0.7758 |
1. PBF | A5I7E5 | Phosphoglucosamine mutase | 0.00e+00 | 3.29e-15 | 4.81e-16 | 0.7664 |
1. PBF | P0DB38 | Phosphoglucosamine mutase | 0.00e+00 | 9.11e-20 | 3.15e-06 | 0.7656 |
1. PBF | Q3AMX9 | Phosphoglucosamine mutase | 0.00e+00 | 3.06e-18 | 8.44e-09 | 0.7531 |
1. PBF | A7GK66 | Phosphoglucosamine mutase | 0.00e+00 | 1.61e-14 | 7.32e-11 | 0.7883 |
1. PBF | Q11DI7 | Phosphoglucosamine mutase | 0.00e+00 | 1.42e-14 | 6.45e-15 | 0.7842 |
1. PBF | B1LFS6 | Phosphoglucosamine mutase | 9.89e-13 | 9.68e-15 | 2.06e-09 | 0.7862 |
1. PBF | Q88BD4 | Phosphomannomutase/phosphoglucomutase | 0.00e+00 | 8.64e-18 | 8.34e-10 | 0.8067 |
1. PBF | Q7VDU7 | Phosphoglucosamine mutase | 0.00e+00 | 3.23e-22 | 5.84e-11 | 0.7571 |
1. PBF | Q6G7F2 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.788 |
1. PBF | B1VEZ9 | Phosphoglucosamine mutase | 0.00e+00 | 1.68e-15 | 2.04e-12 | 0.7995 |
1. PBF | A5VS47 | Phosphoglucosamine mutase | 4.44e-16 | 3.60e-16 | 8.69e-17 | 0.785 |
1. PBF | Q87DJ6 | Phosphoglucosamine mutase | 0.00e+00 | 7.30e-20 | 1.25e-06 | 0.766 |
1. PBF | P57002 | Phosphoglucomutase | 0.00e+00 | 1.87e-20 | 7.33e-09 | 0.798 |
1. PBF | Q0BGI9 | Phosphoglucosamine mutase | 1.60e-12 | 1.54e-19 | 9.42e-10 | 0.7681 |
1. PBF | Q0BT42 | Phosphoglucosamine mutase | 0.00e+00 | 1.78e-15 | 2.58e-09 | 0.7735 |
1. PBF | A1URA6 | Phosphoglucosamine mutase | 4.11e-13 | 1.03e-16 | 3.04e-11 | 0.775 |
1. PBF | Q0AHC3 | Phosphoglucosamine mutase | 1.48e-12 | 9.91e-18 | 6.18e-09 | 0.7671 |
1. PBF | Q49WH7 | Phosphoglucomutase | 0.00e+00 | 3.03e-56 | 1.89e-75 | 0.8823 |
1. PBF | A4QBS5 | Phosphoglucosamine mutase | 0.00e+00 | 4.82e-17 | 5.66e-12 | 0.7792 |
1. PBF | Q8CNH0 | Phosphoglucosamine mutase | 0.00e+00 | 4.09e-14 | 1.96e-09 | 0.7833 |
1. PBF | A7Z0V3 | Phosphoglucosamine mutase | 0.00e+00 | 1.21e-16 | 3.00e-11 | 0.7795 |
1. PBF | A9WWG7 | Phosphoglucosamine mutase | 4.44e-16 | 3.60e-16 | 8.69e-17 | 0.7811 |
1. PBF | P26405 | Phosphomannomutase | 7.77e-16 | 9.60e-24 | 1.36e-08 | 0.7154 |
1. PBF | A7MIM5 | Phosphoglucosamine mutase | 1.27e-12 | 2.73e-15 | 1.92e-09 | 0.7792 |
1. PBF | Q1R6G2 | Phosphoglucosamine mutase | 9.64e-13 | 9.68e-15 | 2.06e-09 | 0.7845 |
1. PBF | Q8E5S6 | Phosphoglucosamine mutase | 0.00e+00 | 8.61e-19 | 7.44e-05 | 0.7662 |
1. PBF | B2IGB3 | Phosphoglucosamine mutase | 0.00e+00 | 6.73e-14 | 3.82e-12 | 0.7852 |
1. PBF | C1EU11 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7718 |
1. PBF | A4SXL3 | Phosphoglucosamine mutase | 2.02e-12 | 7.49e-19 | 8.61e-10 | 0.7712 |
1. PBF | A5W992 | Phosphoglucosamine mutase | 6.34e-13 | 4.58e-21 | 6.10e-09 | 0.7904 |
1. PBF | Q81J03 | Phosphoglucosamine mutase | 0.00e+00 | 1.13e-14 | 1.06e-11 | 0.7881 |
1. PBF | B5QZW4 | Phosphoglucosamine mutase | 7.27e-13 | 7.73e-14 | 1.38e-08 | 0.789 |
1. PBF | B1ICY0 | Phosphoglucosamine mutase | 0.00e+00 | 8.97e-20 | 1.90e-05 | 0.7759 |
1. PBF | A8EQZ2 | Phosphoglucosamine mutase | 0.00e+00 | 8.51e-14 | 1.03e-15 | 0.7786 |
1. PBF | B0UTS2 | Phosphoglucosamine mutase | 5.34e-13 | 2.62e-15 | 6.16e-11 | 0.7678 |
1. PBF | Q0AV62 | Phosphoglucosamine mutase | 2.22e-16 | 3.20e-16 | 1.64e-12 | 0.771 |
1. PBF | B9M5K3 | Phosphoglucosamine mutase | 4.79e-13 | 1.76e-17 | 1.75e-14 | 0.7614 |
1. PBF | Q2A1J6 | Phosphoglucosamine mutase | 1.78e-15 | 1.32e-14 | 7.11e-06 | 0.7568 |
1. PBF | Q67T14 | Phosphoglucosamine mutase | 0.00e+00 | 2.14e-19 | 1.28e-11 | 0.7813 |
1. PBF | P25177 | Phosphoglucosamine mutase | 0.00e+00 | 5.19e-16 | 2.45e-13 | 0.7738 |
1. PBF | O58973 | Probable phosphoglucosamine mutase | 0.00e+00 | 5.40e-22 | 3.09e-20 | 0.8082 |
1. PBF | Q9KU84 | Phosphoglucosamine mutase | 7.05e-13 | 3.85e-15 | 7.34e-06 | 0.7662 |
1. PBF | A6WRH3 | Phosphoglucosamine mutase 1 | 9.71e-13 | 2.21e-17 | 5.80e-13 | 0.7637 |
1. PBF | Q7TWH9 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | 0.7813 |
1. PBF | Q8R840 | Phosphoglucosamine mutase | 0.00e+00 | 1.09e-15 | 2.27e-22 | 0.765 |
1. PBF | Q83BY7 | Phosphoglucosamine mutase | 7.83e-13 | 1.33e-18 | 2.16e-08 | 0.7873 |
1. PBF | Q5GXR8 | Phosphoglucosamine mutase | 0.00e+00 | 3.68e-17 | 1.96e-07 | 0.7712 |
1. PBF | Q6G5P7 | Phosphoglucosamine mutase | 0.00e+00 | 3.63e-17 | 7.05e-11 | 0.7756 |
1. PBF | B7V1G1 | Phosphoglucosamine mutase | 5.06e-13 | 3.27e-19 | 1.64e-12 | 0.7912 |
1. PBF | Q47LM7 | Phosphoglucosamine mutase | 0.00e+00 | 1.16e-19 | 2.63e-13 | 0.7751 |
1. PBF | O34824 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 2.75e-10 | 0.7774 |
1. PBF | Q1IXS5 | Phosphoglucosamine mutase | 0.00e+00 | 9.61e-18 | 4.52e-11 | 0.7534 |
1. PBF | Q8PJ31 | Phosphoglucosamine mutase | 0.00e+00 | 6.40e-17 | 3.50e-08 | 0.7706 |
1. PBF | A1V322 | Phosphoglucosamine mutase | 2.45e-12 | 5.15e-18 | 1.19e-08 | 0.7495 |
1. PBF | Q5HD61 | Phosphoglucomutase | 0.00e+00 | 2.57e-59 | 9.30e-84 | 0.9056 |
1. PBF | B7IDU4 | Phosphoglucosamine mutase | 3.92e-12 | 3.92e-14 | 7.00e-15 | 0.7674 |
1. PBF | A4VPP5 | Phosphoglucosamine mutase | 3.83e-13 | 1.21e-20 | 1.66e-10 | 0.7766 |
1. PBF | B1YMW5 | Phosphoglucosamine mutase | 1.09e-12 | 1.33e-19 | 1.01e-09 | 0.7731 |
1. PBF | A4J190 | Phosphoglucosamine mutase | 0.00e+00 | 1.65e-16 | 4.70e-18 | 0.7898 |
1. PBF | Q31CU1 | Phosphoglucosamine mutase | 0.00e+00 | 1.27e-18 | 3.41e-16 | 0.782 |
1. PBF | A4W2Q0 | Phosphoglucosamine mutase | 0.00e+00 | 1.38e-19 | 1.25e-04 | 0.7776 |
1. PBF | B7NDG0 | Phosphoglucosamine mutase | 7.94e-13 | 9.68e-15 | 2.06e-09 | 0.7844 |
1. PBF | Q8CN38 | Phosphoglucomutase | 0.00e+00 | 6.82e-54 | 2.98e-84 | 0.8969 |
1. PBF | A9W9G7 | Phosphoglucosamine mutase | 0.00e+00 | 7.53e-17 | 5.10e-13 | 0.8089 |
1. PBF | Q8XHZ5 | Phosphoglucosamine mutase | 0.00e+00 | 1.48e-18 | 4.28e-12 | 0.7718 |
1. PBF | A7NEF9 | Phosphoglucosamine mutase | 1.78e-15 | 1.32e-14 | 7.11e-06 | 0.7566 |
1. PBF | B4U3I6 | Phosphoglucosamine mutase | 0.00e+00 | 8.91e-18 | 1.32e-04 | 0.7756 |
1. PBF | A1AR93 | Phosphoglucosamine mutase | 3.72e-13 | 1.14e-15 | 6.82e-18 | 0.7666 |
1. PBF | B2IA03 | Phosphoglucosamine mutase | 0.00e+00 | 1.89e-19 | 1.13e-06 | 0.7689 |
1. PBF | P45164 | Phosphoglucosamine mutase | 7.07e-13 | 1.49e-16 | 6.57e-13 | 0.7711 |
1. PBF | A4WQ91 | Phosphoglucosamine mutase | 4.44e-16 | 1.03e-15 | 3.83e-11 | 0.8057 |
1. PBF | A1A2Z2 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-12 | 8.26e-12 | 0.7559 |
1. PBF | B5REP2 | Phosphoglucosamine mutase | 8.36e-13 | 7.73e-14 | 1.38e-08 | 0.7848 |
1. PBF | C4K7K5 | Phosphoglucosamine mutase | 7.64e-13 | 1.49e-15 | 5.50e-11 | 0.774 |
1. PBF | A5G536 | Phosphoglucosamine mutase | 4.69e-13 | 1.09e-17 | 1.30e-14 | 0.7788 |
1. PBF | Q8NUV4 | Phosphoglucomutase | 0.00e+00 | 4.58e-58 | 5.42e-84 | 0.9145 |
1. PBF | Q83Q15 | Phosphoglucosamine mutase | 7.07e-13 | 3.06e-15 | 7.45e-09 | 0.7916 |
1. PBF | B5EHA7 | Phosphoglucosamine mutase | 3.66e-13 | 2.31e-17 | 1.25e-15 | 0.7869 |
1. PBF | B5FA75 | Phosphoglucosamine mutase | 8.25e-13 | 2.35e-17 | 8.72e-11 | 0.7868 |
1. PBF | Q39UF9 | Phosphoglucosamine mutase | 7.44e-13 | 3.79e-17 | 1.13e-15 | 0.7684 |
1. PBF | A5D4W7 | Phosphoglucosamine mutase | 0.00e+00 | 3.79e-17 | 4.39e-14 | 0.776 |
1. PBF | Q1GE79 | Phosphoglucosamine mutase | 5.41e-13 | 2.38e-14 | 4.70e-12 | 0.789 |
1. PBF | B9E9W9 | Phosphoglucosamine mutase | 0.00e+00 | 1.98e-14 | 7.68e-08 | 0.7867 |
1. PBF | Q129M7 | Phosphoglucosamine mutase | 5.79e-13 | 5.39e-18 | 2.94e-14 | 0.7898 |
1. PBF | A8G903 | Phosphoglucosamine mutase | 1.10e-12 | 8.40e-15 | 8.85e-08 | 0.782 |
1. PBF | Q46AY7 | Probable phosphoglucosamine mutase | 0.00e+00 | 2.43e-18 | 5.10e-19 | 0.8213 |
1. PBF | B7ICC7 | Phosphoglucosamine mutase | 6.35e-13 | 3.34e-15 | 1.70e-11 | 0.7429 |
1. PBF | B9MI07 | Phosphoglucosamine mutase | 3.65e-13 | 1.68e-17 | 7.68e-10 | 0.793 |
1. PBF | Q042H3 | Phosphoglucosamine mutase | 6.72e-13 | 6.77e-18 | 8.49e-07 | 0.782 |
1. PBF | Q9P4V2 | Phosphoacetylglucosamine mutase | 6.91e-08 | 7.29e-15 | 0.035 | 0.4981 |
1. PBF | A8FYS5 | Phosphoglucosamine mutase | 9.96e-13 | 5.82e-18 | 2.41e-11 | 0.7794 |
1. PBF | Q8Q037 | Probable phosphoglucosamine mutase | 0.00e+00 | 1.96e-17 | 3.53e-18 | 0.8283 |
1. PBF | Q3AW32 | Phosphoglucosamine mutase | 0.00e+00 | 2.58e-19 | 1.16e-08 | 0.7751 |
1. PBF | C3KVJ0 | Phosphoglucosamine mutase | 0.00e+00 | 1.43e-15 | 4.16e-15 | 0.7745 |
1. PBF | Q1IV19 | Phosphoglucosamine mutase | 6.89e-11 | 1.79e-17 | 7.20e-08 | 0.7199 |
1. PBF | Q83NS5 | Phosphoglucosamine mutase | 0.00e+00 | 1.80e-16 | 6.23e-08 | 0.7595 |
1. PBF | B5YDY1 | Phosphoglucosamine mutase | 0.00e+00 | 1.47e-16 | 7.10e-07 | 0.7269 |
1. PBF | Q2YYE6 | Phosphoglucosamine mutase | 0.00e+00 | 2.27e-15 | 9.53e-08 | 0.7908 |
1. PBF | A4FX97 | Phosphoglucosamine mutase | 0.00e+00 | 1.04e-18 | 6.45e-15 | 0.8086 |
1. PBF | A5U8B7 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | 0.7851 |
1. PBF | Q5F746 | Phosphoglucosamine mutase | 3.13e-13 | 8.75e-16 | 8.79e-10 | 0.7729 |
1. PBF | A4Z0D8 | Phosphoglucosamine mutase | 6.62e-13 | 2.87e-11 | 2.17e-12 | 0.7886 |
1. PBF | A3N856 | Phosphoglucosamine mutase | 2.39e-12 | 8.13e-18 | 1.25e-08 | 0.7639 |
1. PBF | Q6A6T5 | Phosphoglucosamine mutase | 0.00e+00 | 3.55e-16 | 5.11e-08 | 0.7771 |
1. PBF | Q5FQB4 | Phosphoglucosamine mutase | 0.00e+00 | 2.96e-18 | 2.21e-11 | 0.7937 |
1. PBF | B2JFP2 | Phosphoglucosamine mutase | 2.47e-12 | 5.47e-18 | 1.81e-07 | 0.7618 |
1. PBF | A0PXZ6 | Phosphoglucosamine mutase | 6.05e-13 | 7.79e-16 | 1.41e-17 | 0.7616 |
1. PBF | C3PL50 | Phosphoglucosamine mutase | 0.00e+00 | 9.55e-16 | 1.12e-13 | 0.78 |
1. PBF | Q1J6W8 | Phosphoglucosamine mutase | 5.55e-16 | 1.31e-19 | 1.00e-06 | 0.7652 |
1. PBF | P0DB39 | Phosphoglucosamine mutase | 0.00e+00 | 9.11e-20 | 3.15e-06 | 0.7765 |
1. PBF | Q3JTT2 | Phosphoglucosamine mutase | 2.57e-12 | 5.15e-18 | 1.19e-08 | 0.7562 |
1. PBF | B1N017 | Phosphoglucosamine mutase | 0.00e+00 | 3.79e-17 | 2.81e-04 | 0.7442 |
1. PBF | Q7WMD0 | Phosphoglucosamine mutase | 9.62e-13 | 3.97e-17 | 4.22e-14 | 0.7451 |
1. PBF | B7VJI1 | Phosphoglucosamine mutase | 9.42e-13 | 1.68e-17 | 5.70e-06 | 0.7825 |
1. PBF | B1KSG4 | Phosphoglucosamine mutase | 0.00e+00 | 1.32e-14 | 3.52e-16 | 0.7657 |
1. PBF | B7GIY9 | Phosphoglucosamine mutase | 0.00e+00 | 5.26e-16 | 2.30e-10 | 0.7817 |
1. PBF | B8E222 | Phosphoglucosamine mutase | 0.00e+00 | 3.47e-17 | 6.38e-10 | 0.7482 |
1. PBF | Q8X9L2 | Phosphoglucosamine mutase | 9.14e-13 | 1.75e-14 | 2.10e-09 | 0.7855 |
1. PBF | Q5HE43 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-15 | 2.50e-07 | 0.7816 |
1. PBF | C0PZ59 | Phosphoglucosamine mutase | 8.61e-13 | 8.63e-14 | 1.28e-08 | 0.7841 |
1. PBF | B8J1K3 | Phosphoglucosamine mutase | 1.02e-12 | 7.57e-16 | 3.69e-14 | 0.7638 |
1. PBF | B1XXG0 | Phosphoglucosamine mutase | 7.61e-13 | 3.73e-20 | 3.85e-07 | 0.7797 |
1. PBF | B8ID24 | Phosphoglucosamine mutase | 0.00e+00 | 1.17e-15 | 2.13e-12 | 0.7971 |
1. PBF | Q0IDB3 | Phosphoglucosamine mutase | 0.00e+00 | 3.17e-19 | 3.48e-08 | 0.7843 |
1. PBF | Q1GB12 | Phosphoglucosamine mutase | 0.00e+00 | 2.42e-17 | 2.57e-06 | 0.7754 |
1. PBF | A4TEL0 | Phosphoglucosamine mutase | 0.00e+00 | 4.22e-18 | 4.16e-10 | 0.7836 |
1. PBF | Q04BF6 | Phosphoglucosamine mutase | 0.00e+00 | 1.93e-17 | 2.18e-06 | 0.7809 |
1. PBF | B1WR00 | Phosphoglucosamine mutase | 0.00e+00 | 1.65e-22 | 5.03e-17 | 0.7706 |
1. PBF | P26276 | Phosphomannomutase/phosphoglucomutase | 0.00e+00 | 1.99e-17 | 5.25e-08 | 0.8097 |
1. PBF | Q06951 | Phosphomannomutase | 0.00e+00 | 1.27e-15 | 2.26e-07 | 0.8517 |
1. PBF | B4E5F6 | Phosphoglucosamine mutase | 1.88e-12 | 7.72e-19 | 1.58e-08 | 0.7633 |
1. PBF | B8GXK7 | Phosphoglucosamine mutase | 0.00e+00 | 4.18e-12 | 2.88e-14 | 0.7876 |
1. PBF | A1TQF3 | Phosphoglucosamine mutase | 6.28e-13 | 2.58e-18 | 3.21e-10 | 0.7815 |
1. PBF | A3M9W5 | Phosphoglucosamine mutase | 7.10e-13 | 2.58e-15 | 1.61e-11 | 0.7439 |
1. PBF | Q1D498 | Phosphoglucosamine mutase | 8.36e-13 | 2.54e-20 | 3.04e-11 | 0.7686 |
1. PBF | B5ZNL4 | Phosphoglucosamine mutase | 0.00e+00 | 3.91e-17 | 9.76e-19 | 0.8033 |
1. PBF | Q12TN0 | Probable phosphoglucosamine mutase | 0.00e+00 | 3.85e-18 | 6.00e-20 | 0.8246 |
1. PBF | A0QSQ1 | Phosphoglucosamine mutase | 0.00e+00 | 8.26e-18 | 1.29e-05 | 0.7776 |
1. PBF | Q8DTC6 | Phosphoglucosamine mutase | 0.00e+00 | 3.71e-19 | 3.01e-07 | 0.7941 |
1. PBF | B2J997 | Phosphoglucosamine mutase | 0.00e+00 | 9.17e-22 | 4.29e-16 | 0.7347 |
1. PBF | A1VED4 | Phosphoglucosamine mutase | 9.67e-13 | 1.87e-17 | 3.09e-15 | 0.7715 |
1. PBF | B0T1V6 | Phosphoglucosamine mutase | 0.00e+00 | 8.05e-14 | 1.23e-12 | 0.7925 |
1. PBF | B6JIL2 | Phosphoglucosamine mutase | 3.63e-13 | 1.02e-13 | 9.74e-13 | 0.7688 |
1. PBF | A3CM30 | Phosphoglucosamine mutase | 0.00e+00 | 1.09e-18 | 1.19e-06 | 0.7785 |
1. PBF | C3LSP4 | Phosphoglucosamine mutase | 8.74e-13 | 3.85e-15 | 7.34e-06 | 0.7659 |
1. PBF | Q66F64 | Phosphoglucosamine mutase | 9.56e-13 | 2.85e-14 | 9.90e-09 | 0.7741 |
1. PBF | A0R8M4 | Phosphoglucosamine mutase | 0.00e+00 | 1.41e-15 | 3.11e-11 | 0.7892 |
1. PBF | Q97PP4 | Phosphoglucosamine mutase | 0.00e+00 | 1.03e-19 | 8.95e-06 | 0.7658 |
1. PBF | A4SJR0 | Phosphoglucosamine mutase | 5.95e-13 | 9.32e-18 | 7.64e-12 | 0.7847 |
1. PBF | Q83GU5 | Phosphoglucosamine mutase | 0.00e+00 | 1.80e-16 | 6.23e-08 | 0.7592 |
1. PBF | Q9ABV3 | Phosphoglucosamine mutase | 0.00e+00 | 4.18e-12 | 2.88e-14 | 0.7842 |
1. PBF | Q7VP94 | Phosphoglucosamine mutase | 4.73e-13 | 5.64e-18 | 1.00e-10 | 0.7912 |
1. PBF | Q5N0M0 | Phosphoglucosamine mutase | 2.22e-16 | 1.49e-20 | 1.39e-14 | 0.7538 |
1. PBF | A0AKM3 | Phosphoglucosamine mutase | 0.00e+00 | 6.12e-17 | 0.007 | 0.7761 |
1. PBF | Q3BRL9 | Phosphoglucosamine mutase | 0.00e+00 | 8.36e-17 | 3.68e-08 | 0.7659 |
1. PBF | B8ZLM2 | Phosphoglucosamine mutase | 0.00e+00 | 6.53e-20 | 5.54e-06 | 0.7724 |
1. PBF | Q2FE11 | Phosphoglucomutase | 0.00e+00 | 2.57e-59 | 9.30e-84 | 0.9057 |
1. PBF | Q9KG46 | Phosphoglucosamine mutase | 0.00e+00 | 1.94e-15 | 8.04e-11 | 0.7753 |
1. PBF | B1HMT3 | Phosphoglucosamine mutase | 0.00e+00 | 2.02e-17 | 1.12e-06 | 0.7671 |
1. PBF | A1W8G7 | Phosphoglucosamine mutase | 3.38e-13 | 1.71e-17 | 1.55e-09 | 0.7881 |
1. PBF | Q0TCT4 | Phosphoglucosamine mutase | 9.33e-13 | 9.68e-15 | 2.06e-09 | 0.7849 |
1. PBF | Q4UWC8 | Phosphoglucosamine mutase | 8.88e-16 | 1.40e-16 | 7.49e-07 | 0.7691 |
1. PBF | A2CCG3 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-18 | 3.95e-10 | 0.7558 |
1. PBF | Q9JY89 | Phosphoglucosamine mutase | 3.26e-13 | 1.73e-15 | 2.69e-10 | 0.7729 |
1. PBF | Q086H7 | Phosphoglucosamine mutase 1 | 9.58e-13 | 7.09e-18 | 1.63e-13 | 0.786 |
1. PBF | Q0A772 | Phosphoglucosamine mutase | 1.07e-12 | 2.35e-19 | 8.55e-10 | 0.769 |
1. PBF | C1C8F1 | Phosphoglucosamine mutase | 0.00e+00 | 6.03e-20 | 1.02e-05 | 0.7726 |
1. PBF | Q89AF3 | Phosphoglucosamine mutase | 0.00e+00 | 3.48e-15 | 3.56e-08 | 0.7793 |
1. PBF | Q5LZA7 | Phosphoglucosamine mutase | 0.00e+00 | 1.84e-20 | 2.23e-04 | 0.7756 |
1. PBF | O84822 | Phosphoglucosamine mutase | 1.09e-12 | 2.53e-17 | 3.72e-11 | 0.7733 |
1. PBF | B2SVN3 | Phosphoglucosamine mutase | 0.00e+00 | 3.68e-17 | 1.96e-07 | 0.7703 |
1. PBF | P00949 | Phosphoglucomutase-1 | 0.00e+00 | 4.03e-14 | 4.05e-10 | 0.7032 |
1. PBF | Q6AD28 | Phosphoglucosamine mutase | 0.00e+00 | 3.12e-17 | 1.25e-12 | 0.7534 |
1. PBF | Q311T0 | Phosphoglucosamine mutase | 8.67e-13 | 8.26e-16 | 3.28e-12 | 0.7903 |
1. PBF | A2REP8 | Phosphoglucosamine mutase | 0.00e+00 | 1.31e-19 | 1.00e-06 | 0.7763 |
1. PBF | B7UJ69 | Phosphoglucosamine mutase | 1.08e-12 | 9.68e-15 | 2.06e-09 | 0.7904 |
1. PBF | Q53876 | Phosphoglucosamine mutase | 0.00e+00 | 1.96e-17 | 3.07e-12 | 0.7892 |
1. PBF | P18159 | Phosphoglucomutase | 0.00e+00 | 1.17e-62 | 1.15e-124 | 0.9466 |
1. PBF | A7GJ15 | Phosphoglucosamine mutase | 0.00e+00 | 6.99e-15 | 2.29e-15 | 0.7701 |
1. PBF | Q8DP16 | Phosphoglucosamine mutase | 0.00e+00 | 1.35e-19 | 5.26e-06 | 0.7746 |
1. PBF | Q9WY28 | Phosphoglucosamine mutase | 0.00e+00 | 4.19e-13 | 1.19e-09 | 0.7755 |
1. PBF | A9IYI0 | Phosphoglucosamine mutase | 0.00e+00 | 6.24e-15 | 1.15e-10 | 0.7894 |
1. PBF | C5A2H8 | Probable phosphoglucosamine mutase | 0.00e+00 | 3.65e-19 | 5.92e-20 | 0.8214 |
1. PBF | A8G2Q0 | Phosphoglucosamine mutase | 8.88e-16 | 2.15e-16 | 3.32e-16 | 0.7749 |
1. PBF | B7ITV9 | Phosphoglucosamine mutase | 0.00e+00 | 4.19e-15 | 8.03e-12 | 0.7898 |
1. PBF | B4TWE3 | Phosphoglucosamine mutase | 6.69e-13 | 7.73e-14 | 1.38e-08 | 0.7765 |
1. PBF | Q3J826 | Phosphoglucosamine mutase | 1.40e-12 | 1.84e-17 | 4.88e-09 | 0.7581 |
1. PBF | Q0K8Y7 | Phosphoglucosamine mutase | 9.12e-13 | 3.79e-17 | 5.91e-09 | 0.7817 |
1. PBF | A6LPX0 | Phosphoglucosamine mutase | 8.88e-16 | 4.61e-17 | 4.80e-17 | 0.7609 |
1. PBF | Q57290 | Probable phosphomannomutase | 0.00e+00 | 1.17e-19 | 1.13e-55 | 0.9213 |
1. PBF | C4XU39 | Phosphoglucosamine mutase | 9.46e-13 | 1.31e-20 | 5.10e-12 | 0.7686 |
1. PBF | Q92M99 | Phosphoglucosamine mutase | 0.00e+00 | 1.26e-15 | 5.90e-11 | 0.797 |
1. PBF | Q2SUW3 | Phosphoglucosamine mutase | 2.56e-12 | 1.51e-16 | 2.01e-09 | 0.7622 |
1. PBF | B2G638 | Phosphoglucosamine mutase | 0.00e+00 | 1.72e-19 | 3.58e-13 | 0.7892 |
1. PBF | B8D0U9 | Phosphoglucosamine mutase | 0.00e+00 | 7.57e-16 | 4.24e-15 | 0.7781 |
1. PBF | Q2YBS8 | Phosphoglucosamine mutase | 2.80e-12 | 3.20e-18 | 7.32e-14 | 0.7537 |
1. PBF | A1RGX0 | Phosphoglucosamine mutase | 1.11e-12 | 4.89e-17 | 9.97e-13 | 0.7681 |
1. PBF | A8M4B8 | Phosphoglucosamine mutase | 0.00e+00 | 4.54e-17 | 7.10e-12 | 0.7859 |
1. PBF | P73648 | Phosphoglucosamine mutase | 0.00e+00 | 7.40e-22 | 1.12e-14 | 0.7592 |
1. PBF | A8YUF8 | Phosphoglucosamine mutase | 0.00e+00 | 1.49e-16 | 4.45e-05 | 0.7757 |
1. PBF | A1K5A1 | Phosphoglucosamine mutase | 1.08e-12 | 2.03e-16 | 1.66e-07 | 0.7753 |
1. PBF | A5ECX6 | Phosphoglucosamine mutase | 2.86e-13 | 2.71e-12 | 4.15e-12 | 0.7825 |
1. PBF | A9MP31 | Phosphoglucosamine mutase | 7.26e-13 | 2.02e-13 | 3.69e-09 | 0.784 |
1. PBF | Q5P1F7 | Phosphoglucosamine mutase | 1.42e-12 | 1.56e-15 | 6.32e-06 | 0.789 |
1. PBF | A5UKY3 | Probable phosphoglucosamine mutase | 0.00e+00 | 9.45e-19 | 2.27e-20 | 0.8523 |
1. PBF | B0RB78 | Phosphoglucosamine mutase | 0.00e+00 | 1.71e-17 | 4.00e-09 | 0.7785 |
1. PBF | Q5RFI8 | Phosphoglucomutase-2 | 0.00e+00 | 3.35e-38 | 1.36e-68 | 0.9157 |
1. PBF | Q5L588 | Phosphoglucosamine mutase | 1.24e-12 | 7.83e-15 | 3.68e-10 | 0.7712 |
1. PBF | B7HJK3 | Phosphoglucosamine mutase | 0.00e+00 | 1.13e-14 | 1.06e-11 | 0.7907 |
1. PBF | A3NTW6 | Phosphoglucosamine mutase | 2.48e-12 | 5.15e-18 | 1.19e-08 | 0.7513 |
1. PBF | Q0HLG6 | Phosphoglucosamine mutase 1 | 9.69e-13 | 9.42e-17 | 6.86e-15 | 0.7672 |
1. PBF | Q63V83 | Phosphoglucosamine mutase | 2.37e-12 | 2.75e-18 | 9.36e-09 | 0.7536 |
1. PBF | Q5ZRT4 | Phosphoglucosamine mutase | 1.45e-12 | 1.24e-17 | 2.77e-07 | 0.7421 |
1. PBF | Q3J5C2 | Phosphoglucosamine mutase | 4.44e-16 | 1.91e-15 | 3.30e-10 | 0.7885 |
1. PBF | Q7V4W4 | Phosphoglucosamine mutase | 0.00e+00 | 5.31e-19 | 5.14e-10 | 0.777 |
1. PBF | B8DN76 | Phosphoglucosamine mutase | 8.22e-13 | 1.94e-15 | 4.74e-13 | 0.7777 |
1. PBF | Q87WQ0 | Phosphoglucosamine mutase | 7.13e-13 | 7.49e-19 | 1.35e-08 | 0.7759 |
1. PBF | Q976E4 | Phosphoglucosamine/phosphogalactosamine mutase | 0.00e+00 | 7.58e-21 | 3.95e-29 | 0.8263 |
1. PBF | Q21WW5 | Phosphoglucosamine mutase | 4.12e-13 | 2.35e-19 | 1.20e-15 | 0.7917 |
1. PBF | Q6NJ50 | Phosphoglucosamine mutase | 0.00e+00 | 2.08e-17 | 3.55e-07 | 0.7751 |
1. PBF | A0LRQ7 | Phosphoglucosamine mutase | 0.00e+00 | 7.52e-22 | 3.18e-14 | 0.765 |
1. PBF | Q81VN7 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7848 |
1. PBF | Q1BCY7 | Phosphoglucosamine mutase | 0.00e+00 | 3.12e-17 | 5.59e-06 | 0.7716 |
1. PBF | Q38VX2 | Phosphoglucosamine mutase | 0.00e+00 | 7.21e-14 | 4.17e-04 | 0.7716 |
1. PBF | Q255P2 | Phosphoglucosamine mutase | 1.06e-12 | 1.91e-15 | 8.77e-09 | 0.7551 |
1. PBF | Q8TLL2 | Probable phosphoglucosamine mutase | 0.00e+00 | 5.31e-18 | 2.08e-16 | 0.8369 |
1. PBF | B8CKG8 | Phosphoglucosamine mutase | 1.07e-12 | 4.35e-18 | 2.79e-12 | 0.7798 |
1. PBF | A1WXX0 | Phosphoglucosamine mutase | 0.00e+00 | 2.77e-17 | 8.84e-11 | 0.7821 |
1. PBF | Q2FEX1 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-15 | 2.50e-07 | 0.784 |
1. PBF | A3D7L1 | Phosphoglucosamine mutase | 8.97e-13 | 5.85e-17 | 8.06e-13 | 0.7761 |
1. PBF | B9J0F1 | Phosphoglucosamine mutase | 0.00e+00 | 6.07e-15 | 4.58e-11 | 0.7741 |
1. PBF | B4R906 | Phosphoglucosamine mutase | 0.00e+00 | 3.82e-14 | 8.52e-14 | 0.7834 |
1. PBF | B0RVK5 | Phosphohexose mutases | 0.00e+00 | 1.63e-17 | 8.52e-07 | 0.8604 |
1. PBF | Q027B2 | Phosphoglucosamine mutase | 4.82e-13 | 5.43e-17 | 1.35e-10 | 0.7495 |
1. PBF | Q73F50 | Phosphoglucosamine mutase | 0.00e+00 | 2.37e-15 | 4.66e-11 | 0.7866 |
1. PBF | B0TWU1 | Phosphoglucosamine mutase | 0.00e+00 | 9.14e-16 | 7.66e-07 | 0.7508 |
1. PBF | Q131V4 | Phosphoglucosamine mutase | 5.91e-13 | 4.60e-13 | 1.60e-12 | 0.787 |
1. PBF | Q2YQH8 | Phosphoglucosamine mutase | 3.49e-13 | 5.04e-16 | 1.12e-16 | 0.7858 |
1. PBF | B5XSW5 | Phosphoglucosamine mutase | 8.87e-13 | 7.68e-16 | 4.40e-09 | 0.7711 |
1. PBF | Q18CL0 | Phosphoglucosamine mutase | 0.00e+00 | 1.66e-17 | 1.70e-18 | 0.7716 |
1. PBF | B0RR88 | Phosphoglucosamine mutase | 0.00e+00 | 1.40e-16 | 7.49e-07 | 0.7651 |
1. PBF | P26341 | Phosphomannomutase | 0.00e+00 | 2.02e-18 | 2.88e-07 | 0.8615 |
1. PBF | B2SEZ6 | Phosphoglucosamine mutase | 1.67e-15 | 2.89e-15 | 3.05e-06 | 0.7583 |
1. PBF | B4T705 | Phosphoglucosamine mutase | 1.05e-12 | 7.73e-14 | 1.38e-08 | 0.7797 |
1. PBF | P37742 | Phosphomannomutase | 0.00e+00 | 1.24e-15 | 2.31e-06 | 0.8285 |
1. PBF | A1AVH5 | Phosphoglucosamine mutase | 4.74e-13 | 7.89e-18 | 1.36e-08 | 0.7849 |
1. PBF | C6BTS9 | Phosphoglucosamine mutase | 9.15e-13 | 4.03e-18 | 1.98e-07 | 0.7883 |
1. PBF | Q7MYY3 | Phosphoglucosamine mutase | 6.21e-13 | 1.34e-13 | 7.57e-10 | 0.7779 |
1. PBF | A7MUV2 | Phosphoglucosamine mutase | 8.34e-13 | 6.57e-18 | 7.51e-07 | 0.7939 |
1. PBF | B3WD16 | Phosphoglucosamine mutase | 0.00e+00 | 1.02e-14 | 0.025 | 0.7631 |
1. PBF | B7JYN0 | Phosphoglucosamine mutase | 0.00e+00 | 1.83e-22 | 1.06e-18 | 0.7467 |
1. PBF | Q8YVS4 | Phosphoglucosamine mutase | 4.44e-16 | 3.57e-22 | 1.20e-19 | 0.7325 |
1. PBF | Q6N1T6 | Phosphoglucosamine mutase | 6.69e-13 | 1.60e-12 | 2.53e-11 | 0.792 |
1. PBF | Q6I7B6 | Phosphopentomutase | 0.00e+00 | 2.11e-19 | 4.53e-15 | 0.7945 |
1. PBF | Q57BJ0 | Phosphoglucosamine mutase | 3.57e-13 | 5.04e-16 | 1.12e-16 | 0.7854 |
1. PBF | P40391 | Phosphoglucomutase | 0.00e+00 | 9.56e-20 | 1.09e-07 | 0.8175 |
1. PBF | Q1JH49 | Phosphoglucosamine mutase | 0.00e+00 | 1.31e-19 | 1.00e-06 | 0.7664 |
1. PBF | Q89DN1 | Phosphoglucosamine mutase | 0.00e+00 | 8.11e-11 | 5.92e-12 | 0.7896 |
1. PBF | A4G4B3 | Phosphoglucosamine mutase | 5.34e-13 | 1.02e-17 | 1.15e-09 | 0.7636 |
1. PBF | Q1GUJ4 | Phosphoglucosamine mutase | 0.00e+00 | 4.45e-14 | 7.55e-10 | 0.7749 |
1. PBF | Q03VW4 | Phosphoglucosamine mutase | 0.00e+00 | 1.63e-18 | 2.10e-09 | 0.7563 |
1. PBF | A3N2A2 | Phosphoglucosamine mutase | 6.71e-13 | 7.53e-17 | 4.94e-10 | 0.7785 |
1. PBF | Q1QSY5 | Phosphoglucosamine mutase | 0.00e+00 | 4.70e-15 | 2.05e-10 | 0.7676 |
1. PBF | A0JZ25 | Phosphoglucosamine mutase | 0.00e+00 | 1.17e-17 | 2.01e-12 | 0.7716 |
1. PBF | B9KE78 | Phosphoglucosamine mutase | 0.00e+00 | 3.51e-14 | 7.24e-13 | 0.7977 |
1. PBF | B0V9C8 | Phosphoglucosamine mutase | 8.89e-13 | 3.34e-15 | 1.70e-11 | 0.7456 |
1. PBF | B9L5Z7 | Phosphoglucosamine mutase | 0.00e+00 | 1.03e-16 | 4.93e-15 | 0.7764 |
1. PBF | P55356 | Phosphomannomutase | 0.00e+00 | 1.50e-21 | 4.67e-08 | 0.78 |
1. PBF | A4XYE5 | Phosphoglucosamine mutase | 6.12e-13 | 1.58e-18 | 1.88e-07 | 0.7865 |
1. PBF | Q3K1H1 | Phosphoglucosamine mutase | 0.00e+00 | 8.61e-19 | 7.44e-05 | 0.7753 |
1. PBF | B5YGX0 | Phosphoglucosamine mutase | 0.00e+00 | 2.94e-20 | 1.34e-14 | 0.7966 |
1. PBF | Q8FZ13 | Phosphoglucosamine mutase | 0.00e+00 | 3.60e-16 | 8.69e-17 | 0.7852 |
1. PBF | Q8TWY8 | Probable phosphoglucosamine mutase | 0.00e+00 | 9.90e-19 | 1.31e-19 | 0.8058 |
1. PBF | B3E692 | Phosphoglucosamine mutase | 9.50e-13 | 3.20e-16 | 3.08e-17 | 0.7714 |
1. PBF | B2TIN7 | Phosphoglucosamine mutase | 0.00e+00 | 2.21e-18 | 2.94e-14 | 0.7871 |
1. PBF | Q4QKI9 | Phosphoglucosamine mutase | 7.34e-13 | 2.57e-16 | 5.60e-13 | 0.771 |
1. PBF | A3DEL6 | Phosphoglucosamine mutase | 3.69e-13 | 7.68e-16 | 1.17e-15 | 0.7698 |
1. PBF | C4ZSR5 | Phosphoglucosamine mutase | 1.02e-12 | 7.40e-15 | 2.06e-09 | 0.7901 |
1. PBF | B1XGY6 | Phosphoglucosamine mutase | 8.66e-13 | 7.40e-15 | 2.06e-09 | 0.7926 |
1. PBF | B8GNY2 | Phosphoglucosamine mutase | 0.00e+00 | 8.09e-19 | 1.21e-09 | 0.7672 |
1. PBF | B7M082 | Phosphoglucosamine mutase | 9.68e-13 | 7.40e-15 | 2.06e-09 | 0.7828 |
1. PBF | Q8FS18 | Phosphoglucosamine mutase | 0.00e+00 | 4.49e-18 | 3.07e-10 | 0.7644 |
1. PBF | A7ZB08 | Phosphoglucosamine mutase | 0.00e+00 | 3.66e-14 | 2.29e-18 | 0.7816 |
1. PBF | A5GII9 | Phosphoglucosamine mutase | 0.00e+00 | 1.68e-18 | 4.80e-08 | 0.7721 |
1. PBF | A5CU74 | Phosphoglucosamine mutase | 0.00e+00 | 4.09e-14 | 6.77e-10 | 0.784 |
1. PBF | P57749 | Phosphoglucomutase | 0.00e+00 | 1.59e-10 | 6.63e-04 | 0.7174 |
1. PBF | A0QKT1 | Phosphoglucosamine mutase | 0.00e+00 | 1.08e-16 | 2.90e-08 | 0.7723 |
1. PBF | A8AWM5 | Phosphoglucosamine mutase | 0.00e+00 | 3.97e-18 | 8.78e-07 | 0.7775 |
1. PBF | Q49869 | Phosphoglucosamine mutase | 0.00e+00 | 3.90e-15 | 7.19e-11 | 0.7684 |
1. PBF | Q8Y5E6 | Phosphoglucosamine mutase | 0.00e+00 | 2.18e-17 | 0.007 | 0.7749 |
1. PBF | Q5E7M0 | Phosphoglucosamine mutase | 8.21e-13 | 1.84e-17 | 8.88e-11 | 0.7931 |
1. PBF | A9R599 | Phosphoglucosamine mutase | 1.11e-12 | 2.85e-14 | 9.90e-09 | 0.7768 |
1. PBF | Q8ZBB8 | Phosphoglucosamine mutase | 1.04e-12 | 2.85e-14 | 9.90e-09 | 0.7795 |
1. PBF | A9KGE3 | Phosphoglucosamine mutase | 7.80e-13 | 1.14e-18 | 3.32e-08 | 0.7935 |
1. PBF | Q8NST4 | Phosphoglucosamine mutase | 0.00e+00 | 1.21e-17 | 4.15e-12 | 0.7705 |
1. PBF | C4KZK4 | Phosphoglucosamine mutase | 0.00e+00 | 1.04e-17 | 2.08e-08 | 0.7662 |
1. PBF | Q0I2Q5 | Phosphoglucosamine mutase | 5.61e-13 | 1.83e-15 | 7.89e-11 | 0.7655 |
1. PBF | A7HV12 | Phosphoglucosamine mutase | 0.00e+00 | 2.98e-15 | 4.62e-16 | 0.7921 |
1. PBF | B4F2B5 | Phosphoglucosamine mutase | 6.55e-13 | 3.61e-14 | 9.77e-10 | 0.771 |
1. PBF | A3QGV0 | Phosphoglucosamine mutase | 1.11e-12 | 2.73e-17 | 3.28e-12 | 0.7856 |
1. PBF | B3R1R9 | Phosphoglucosamine mutase | 8.46e-13 | 4.44e-15 | 2.25e-09 | 0.7848 |
1. PBF | A0RRK2 | Phosphoglucosamine mutase | 0.00e+00 | 5.34e-15 | 2.19e-18 | 0.7825 |
1. PBF | B0C132 | Phosphoglucosamine mutase | 0.00e+00 | 7.53e-20 | 6.69e-15 | 0.7867 |
1. PBF | Q7U9H6 | Phosphoglucosamine mutase | 0.00e+00 | 5.48e-19 | 6.48e-04 | 0.7551 |
1. PBF | B1W3X3 | Phosphoglucosamine mutase | 0.00e+00 | 1.44e-18 | 1.14e-11 | 0.7922 |
1. PBF | Q97LS0 | Phosphoglucosamine mutase | 0.00e+00 | 4.37e-15 | 1.01e-16 | 0.769 |
1. PBF | B1M3G3 | Phosphoglucosamine mutase | 7.30e-13 | 2.44e-14 | 7.76e-14 | 0.7967 |
1. PBF | Q2K4M3 | Phosphoglucosamine mutase | 0.00e+00 | 2.24e-17 | 1.47e-18 | 0.8031 |
1. PBF | P47299 | Phosphomannomutase | 0.00e+00 | 6.00e-63 | 1.13e-88 | 0.9357 |
1. PBF | Q0HKK5 | Phosphoglucosamine mutase 2 | 0.00e+00 | 1.54e-17 | 1.29e-08 | 0.7907 |
1. PBF | Q8ETM7 | Phosphoglucosamine mutase | 0.00e+00 | 3.91e-17 | 9.46e-10 | 0.7821 |
1. PBF | Q2N850 | Phosphoglucosamine mutase | 0.00e+00 | 4.48e-16 | 9.07e-08 | 0.7727 |
1. PBF | Q821Z6 | Phosphoglucosamine mutase | 9.91e-13 | 9.41e-16 | 2.50e-10 | 0.7653 |
1. PBF | Q607B4 | Phosphoglucosamine mutase | 4.04e-13 | 7.77e-18 | 1.62e-08 | 0.7904 |
1. PBF | A9ACL5 | Phosphoglucosamine mutase | 1.05e-12 | 4.69e-19 | 3.20e-09 | 0.7686 |
1. PBF | P9WN40 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | 0.7841 |
1. PBF | A7X524 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7839 |
1. PBF | Q72JS7 | Phosphoglucosamine mutase | 8.88e-16 | 1.82e-17 | 4.79e-06 | 0.7628 |
1. PBF | A1U605 | Phosphoglucosamine mutase | 7.64e-13 | 3.79e-18 | 3.77e-08 | 0.7582 |
1. PBF | Q70GH6 | Phosphoglucosamine mutase | 3.55e-13 | 5.83e-16 | 5.81e-08 | 0.7684 |
1. PBF | A5IUV1 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7907 |
1. PBF | B6I1P9 | Phosphoglucosamine mutase | 8.77e-13 | 7.40e-15 | 2.06e-09 | 0.7916 |
1. PBF | B1IQU7 | Phosphoglucosamine mutase | 7.49e-13 | 7.40e-15 | 2.06e-09 | 0.792 |
1. PBF | Q9CID9 | Phosphoglucosamine mutase | 0.00e+00 | 1.04e-18 | 1.50e-08 | 0.7641 |
1. PBF | Q1BXC7 | Phosphoglucosamine mutase | 1.92e-12 | 4.41e-19 | 1.56e-09 | 0.7604 |
1. PBF | B0KHY3 | Phosphoglucosamine mutase | 6.04e-13 | 1.52e-20 | 2.36e-06 | 0.7796 |
1. PBF | A8HUR7 | Phosphoglucosamine mutase | 0.00e+00 | 2.44e-13 | 3.21e-10 | 0.783 |
1. PBF | A4VWE5 | Phosphoglucosamine mutase | 0.00e+00 | 1.38e-19 | 1.25e-04 | 0.777 |
1. PBF | Q65TY6 | Phosphoglucosamine mutase | 6.27e-13 | 6.21e-17 | 5.33e-13 | 0.7824 |
1. PBF | P75050 | Phosphomannomutase | 0.00e+00 | 6.02e-59 | 4.70e-82 | 0.9377 |
1. PBF | A9KVT4 | Phosphoglucosamine mutase 2 | 0.00e+00 | 1.38e-16 | 7.23e-11 | 0.7753 |
1. PBF | Q39HM9 | Phosphoglucosamine mutase | 2.23e-12 | 2.21e-18 | 1.49e-09 | 0.7674 |
1. PBF | B6ITH3 | Phosphoglucosamine mutase | 0.00e+00 | 3.47e-17 | 1.39e-05 | 0.7702 |
1. PBF | Q57JH3 | Phosphoglucosamine mutase | 8.24e-13 | 8.63e-14 | 1.28e-08 | 0.7871 |
1. PBF | A7H514 | Phosphoglucosamine mutase | 0.00e+00 | 9.69e-16 | 3.46e-13 | 0.7873 |
1. PBF | Q9CNJ0 | Phosphoglucosamine mutase | 0.00e+00 | 5.85e-17 | 2.63e-09 | 0.782 |
1. PBF | Q5SMH2 | Phosphoglucosamine mutase | 0.00e+00 | 4.47e-17 | 3.89e-05 | 0.7728 |
1. PBF | B3DTC2 | Phosphoglucosamine mutase | 0.00e+00 | 1.19e-15 | 4.24e-16 | 0.7586 |
1. PBF | Q8P7S2 | Phosphoglucosamine mutase | 0.00e+00 | 1.40e-16 | 7.49e-07 | 0.7663 |
1. PBF | C6E5P5 | Phosphoglucosamine mutase | 7.92e-13 | 1.99e-17 | 1.53e-15 | 0.7903 |
1. PBF | Q31W53 | Phosphoglucosamine mutase | 8.18e-13 | 1.95e-14 | 9.96e-09 | 0.7884 |
1. PBF | Q30NW8 | Phosphoglucosamine mutase | 0.00e+00 | 1.75e-14 | 3.72e-17 | 0.7917 |
1. PBF | Q2J0J3 | Phosphoglucosamine mutase | 4.40e-13 | 5.80e-12 | 1.11e-12 | 0.7718 |
1. PBF | A5N4Y9 | Phosphoglucosamine mutase | 3.33e-16 | 2.08e-17 | 8.58e-15 | 0.7701 |
1. PBF | A4TRI7 | Phosphoglucosamine mutase | 1.08e-12 | 2.85e-14 | 9.90e-09 | 0.776 |
1. PBF | Q9HV50 | Phosphoglucosamine mutase | 4.45e-13 | 4.01e-19 | 1.91e-12 | 0.7932 |
1. PBF | Q72CK1 | Phosphoglucosamine mutase | 9.31e-13 | 1.87e-17 | 3.09e-15 | 0.774 |
1. PBF | A4XH45 | Phosphoglucosamine mutase | 0.00e+00 | 2.49e-17 | 2.91e-12 | 0.7734 |
1. PBF | Q5M3V8 | Phosphoglucosamine mutase | 0.00e+00 | 2.75e-20 | 0.001 | 0.7778 |
1. PBF | B7MB95 | Phosphoglucosamine mutase | 7.35e-13 | 9.68e-15 | 2.06e-09 | 0.786 |
1. PBF | Q3KKM5 | Phosphoglucosamine mutase | 1.41e-12 | 3.52e-17 | 3.53e-11 | 0.7723 |
1. PBF | B0JVZ6 | Phosphoglucosamine mutase | 1.11e-16 | 9.21e-21 | 7.53e-15 | 0.7689 |
1. PBF | Q82WX6 | Phosphoglucosamine mutase | 1.22e-12 | 1.68e-18 | 1.45e-11 | 0.7785 |
1. PBF | B1I1Y5 | Phosphoglucosamine mutase | 0.00e+00 | 5.27e-17 | 4.66e-13 | 0.7827 |
1. PBF | C5BFB3 | Phosphoglucosamine mutase | 9.74e-13 | 4.57e-14 | 1.57e-09 | 0.7788 |
1. PBF | Q9PLA5 | Phosphoglucosamine mutase | 1.55e-12 | 1.46e-18 | 3.29e-12 | 0.7571 |
1. PBF | Q2JFE2 | Phosphoglucosamine mutase | 0.00e+00 | 1.34e-21 | 1.20e-12 | 0.7819 |
1. PBF | B1JMH4 | Phosphoglucosamine mutase | 9.28e-13 | 2.85e-14 | 9.90e-09 | 0.7763 |
1. PBF | B0VNX9 | Phosphoglucosamine mutase | 7.17e-13 | 2.58e-15 | 1.61e-11 | 0.7479 |
1. PBF | B5BGK0 | Phosphoglucosamine mutase | 9.06e-13 | 5.25e-14 | 1.79e-08 | 0.7823 |
1. PBF | B2UYH3 | Phosphoglucosamine mutase | 0.00e+00 | 1.31e-19 | 1.61e-13 | 0.7865 |
1. PBF | Q71XP5 | Phosphoglucosamine mutase | 0.00e+00 | 9.70e-17 | 0.007 | 0.7783 |
1. PBF | B7KL75 | Phosphoglucosamine mutase | 0.00e+00 | 2.34e-21 | 7.46e-19 | 0.7578 |
1. PBF | Q1MRX8 | Phosphoglucosamine mutase | 1.24e-12 | 1.09e-15 | 1.42e-16 | 0.7679 |
1. PBF | Q9JT71 | Phosphoglucosamine mutase | 3.65e-13 | 3.63e-15 | 2.39e-11 | 0.7685 |
1. PBF | Q4KIG0 | Phosphoglucosamine mutase | 6.08e-13 | 2.63e-20 | 2.91e-08 | 0.791 |
1. PBF | B0TCS1 | Phosphoglucosamine mutase | 3.51e-13 | 4.62e-18 | 8.57e-13 | 0.7601 |
1. PBF | Q3KI89 | Phosphoglucosamine mutase | 6.81e-13 | 4.90e-20 | 6.57e-08 | 0.7845 |
1. PBF | B9KJ94 | Phosphoglucosamine mutase | 0.00e+00 | 6.18e-18 | 1.72e-07 | 0.7821 |
1. PBF | Q0ALR7 | Phosphoglucosamine mutase | 0.00e+00 | 2.96e-18 | 1.95e-14 | 0.7836 |
1. PBF | A9N8M1 | Phosphoglucosamine mutase | 6.97e-13 | 1.33e-18 | 2.16e-08 | 0.7982 |
1. PBF | A2SF93 | Phosphoglucosamine mutase | 1.13e-12 | 8.35e-21 | 6.35e-13 | 0.7796 |
1. PBF | A7FZ14 | Phosphoglucosamine mutase | 0.00e+00 | 3.29e-15 | 4.81e-16 | 0.7657 |
1. PBF | A5IKN6 | Phosphoglucosamine mutase | 0.00e+00 | 1.20e-13 | 6.43e-08 | 0.7823 |
1. PBF | A3PVN7 | Phosphoglucosamine mutase | 0.00e+00 | 3.12e-17 | 5.59e-06 | 0.7718 |
1. PBF | B1JZF2 | Phosphoglucosamine mutase | 1.62e-12 | 4.41e-19 | 1.56e-09 | 0.7636 |
1. PBF | A6U3P1 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.79 |
1. PBF | C1CFE3 | Phosphoglucosamine mutase | 0.00e+00 | 6.03e-20 | 1.02e-05 | 0.7755 |
1. PBF | Q07ZA3 | Phosphoglucosamine mutase 2 | 0.00e+00 | 2.50e-18 | 6.96e-15 | 0.7948 |
1. PBF | A8LS40 | Phosphoglucosamine mutase | 0.00e+00 | 1.21e-14 | 5.30e-13 | 0.7782 |
1. PBF | Q2GB44 | Phosphoglucosamine mutase | 1.22e-12 | 4.97e-15 | 7.12e-10 | 0.7768 |
1. PBF | B0BR43 | Phosphoglucosamine mutase | 5.87e-13 | 7.53e-17 | 4.94e-10 | 0.7734 |
1. PBF | B7LR43 | Phosphoglucosamine mutase | 1.14e-12 | 1.80e-14 | 1.92e-09 | 0.7852 |
1. PBF | Q929Q1 | Phosphoglucosamine mutase | 0.00e+00 | 8.24e-17 | 0.007 | 0.7745 |
1. PBF | B8I0I6 | Phosphoglucosamine mutase | 0.00e+00 | 1.04e-16 | 8.53e-11 | 0.7815 |
1. PBF | A5IHW7 | Phosphoglucosamine mutase | 0.00e+00 | 2.08e-17 | 2.29e-07 | 0.7433 |
1. PBF | Q2RGA6 | Phosphoglucosamine mutase | 0.00e+00 | 4.96e-16 | 1.49e-08 | 0.7837 |
1. PBF | B9J9H0 | Phosphoglucosamine mutase | 0.00e+00 | 7.20e-18 | 1.20e-14 | 0.8031 |
1. PBF | B0S2Q1 | Phosphoglucosamine mutase | 0.00e+00 | 3.19e-14 | 1.00e-13 | 0.756 |
1. PBF | Q0C5U1 | Phosphoglucosamine mutase | 0.00e+00 | 9.15e-15 | 1.03e-14 | 0.8116 |
1. PBF | A0LMD8 | Phosphoglucosamine mutase | 1.04e-12 | 1.65e-16 | 1.69e-11 | 0.7905 |
1. PBF | B5FI19 | Phosphoglucosamine mutase | 8.31e-13 | 7.73e-14 | 1.38e-08 | 0.7875 |
1. PBF | Q5LTP9 | Phosphoglucosamine mutase | 0.00e+00 | 1.65e-14 | 9.68e-10 | 0.7978 |
1. PBF | A1T554 | Phosphoglucosamine mutase | 0.00e+00 | 1.44e-18 | 4.58e-11 | 0.7821 |
1. PBF | Q8D2X3 | Phosphoglucosamine mutase | 7.93e-13 | 1.68e-15 | 3.57e-07 | 0.7999 |
1. PBF | Q5WLG9 | Phosphoglucosamine mutase | 0.00e+00 | 2.89e-16 | 1.62e-09 | 0.7756 |
1. PBF | A6UCS2 | Phosphoglucosamine mutase | 0.00e+00 | 7.25e-16 | 5.53e-13 | 0.7861 |
1. PBF | Q04JI8 | Phosphoglucosamine mutase | 0.00e+00 | 1.35e-19 | 5.26e-06 | 0.776 |
1. PBF | B8D9G5 | Phosphoglucosamine mutase | 1.78e-12 | 1.17e-17 | 2.61e-09 | 0.8077 |
1. PBF | Q5NII8 | Phosphoglucosamine mutase | 1.33e-12 | 2.20e-15 | 1.47e-05 | 0.7547 |
1. PBF | Q7VQM5 | Phosphoglucosamine mutase | 8.52e-13 | 7.85e-19 | 6.82e-12 | 0.7952 |
1. PBF | A9M7I9 | Phosphoglucosamine mutase | 3.10e-13 | 3.60e-16 | 8.69e-17 | 0.7865 |
1. PBF | Q8XF81 | Phosphoglucosamine mutase | 8.11e-13 | 7.73e-14 | 1.38e-08 | 0.7869 |
1. PBF | A9G862 | Phosphoglucosamine mutase | 7.17e-13 | 3.38e-19 | 1.59e-14 | 0.7226 |
1. PBF | Q8R6A7 | Phosphoglucosamine mutase | 0.00e+00 | 1.06e-16 | 5.85e-08 | 0.8038 |
1. PBF | P65705 | Phosphoglucosamine mutase | 0.00e+00 | 2.69e-15 | 8.81e-08 | 0.7837 |
1. PBF | Q00330 | Phosphomannomutase | 8.88e-16 | 6.92e-25 | 6.79e-05 | 0.7479 |
1. PBF | Q47YJ7 | Phosphoglucosamine mutase | 8.12e-13 | 2.61e-17 | 6.80e-08 | 0.7813 |
2. PF | P47244 | Phosphoglucomutase-1 | 0.00e+00 | 9.90e-19 | NA | 0.7028 |
2. PF | Q9M4G5 | Phosphoglucomutase, chloroplastic | 0.00e+00 | 1.47e-04 | NA | 0.7358 |
2. PF | O18719 | Phosphoglucomutase | 0.00e+00 | 4.11e-16 | NA | 0.7225 |
2. PF | O02606 | Phosphoglucomutase-2 | 0.00e+00 | 3.10e-18 | NA | 0.6887 |
2. PF | Q9M4G4 | Phosphoglucomutase, cytoplasmic | 0.00e+00 | 4.09e-14 | NA | 0.7096 |
2. PF | Q8SSL7 | Probable phosphoacetylglucosamine mutase | 3.92e-05 | 6.00e-18 | NA | 0.5209 |
2. PF | Q1AU65 | Phosphoglucosamine mutase | 0.00e+00 | 5.27e-17 | NA | 0.7571 |
2. PF | Q9SNX2 | Phosphoglucomutase, cytoplasmic | 0.00e+00 | 2.16e-13 | NA | 0.7077 |
2. PF | Q9SM60 | Phosphoglucomutase, cytoplasmic | 0.00e+00 | 2.01e-14 | NA | 0.704 |
2. PF | P93262 | Phosphoglucomutase, cytoplasmic | 0.00e+00 | 1.82e-12 | NA | 0.7095 |
2. PF | O15820 | Phosphoglucomutase | 0.00e+00 | 1.73e-16 | NA | 0.7263 |
2. PF | P39671 | Phosphoglucomutase | 0.00e+00 | 7.20e-18 | NA | 0.7263 |
2. PF | F1RQM2 | Phosphoacetylglucosamine mutase | 3.76e-06 | 2.98e-11 | NA | 0.4603 |
2. PF | A6W5X2 | Phosphoglucosamine mutase | 0.00e+00 | 2.07e-19 | NA | 0.7516 |
3. BF | Q48463 | Phosphomannomutase (Fragment) | 1.11e-06 | NA | 0.023 | 0.7968 |
4. PB | O74478 | Probable phosphoribomutase | 0.00e+00 | 3.62e-51 | 1.39e-71 | NA |
4. PB | Q57842 | Phosphomannomutase | 0.00e+00 | 4.20e-19 | 1.29e-04 | NA |
4. PB | P24175 | Phosphomannomutase | 0.00e+00 | 1.99e-18 | 1.83e-06 | NA |
4. PB | Q9VUY9 | Phosphoglucomutase | 0.00e+00 | 5.27e-13 | 1.82e-11 | NA |
4. PB | Q54UQ2 | Probable phosphoglucomutase-2 | 0.00e+00 | 7.16e-45 | 8.49e-66 | NA |
4. PB | P36871 | Phosphoglucomutase-1 | 0.00e+00 | 2.16e-14 | 3.55e-11 | NA |
4. PB | Q6PCE3 | Glucose 1,6-bisphosphate synthase | 0.00e+00 | 6.11e-36 | 1.02e-69 | NA |
4. PB | B5E6K3 | Phosphoglucosamine mutase | NA | 3.39e-20 | 1.86e-05 | NA |
4. PB | Q8BZF8 | Phosphoglucomutase-like protein 5 | 0.00e+00 | 1.00e-12 | 8.26e-07 | NA |
4. PB | Q15124 | Phosphoglucomutase-like protein 5 | 0.00e+00 | 4.93e-13 | 3.45e-06 | NA |
4. PB | Q9CYR6 | Phosphoacetylglucosamine mutase | 9.69e-05 | 1.42e-11 | 0.040 | NA |
4. PB | P33401 | Phosphoglucomutase 1 | 0.00e+00 | 2.57e-13 | 0.009 | NA |
4. PB | Q96G03 | Phosphoglucomutase-2 | 0.00e+00 | 1.69e-37 | 1.00e-67 | NA |
4. PB | Q2FVC1 | Phosphoglucomutase | 0.00e+00 | 2.57e-59 | 9.30e-84 | NA |
4. PB | Q9SCY0 | Phosphoglucomutase, chloroplastic | 0.00e+00 | 1.05e-08 | 6.13e-06 | NA |
4. PB | Q23919 | Phosphoglucomutase-1 | 0.00e+00 | 8.05e-14 | 1.06e-10 | NA |
4. PB | Q03262 | Phosphoribomutase | 0.00e+00 | 3.34e-44 | 9.40e-59 | NA |
4. PB | P31120 | Phosphoglucosamine mutase | 9.98e-13 | 7.40e-15 | 2.06e-09 | NA |
4. PB | P9WN41 | Phosphoglucosamine mutase | 0.00e+00 | 1.56e-16 | 4.91e-13 | NA |
4. PB | Q58500 | Phosphoglucosamine mutase | 3.33e-16 | 1.03e-19 | 6.23e-10 | NA |
4. PB | P38652 | Phosphoglucomutase-1 | 0.00e+00 | 3.92e-14 | 2.39e-09 | NA |
4. PB | P36938 | Phosphoglucomutase | 0.00e+00 | 7.62e-38 | 3.55e-18 | NA |
4. PB | Q7TSV4 | Phosphoglucomutase-2 | 0.00e+00 | 9.97e-35 | 1.26e-69 | NA |
4. PB | Q8CAA7 | Glucose 1,6-bisphosphate synthase | 0.00e+00 | 7.98e-36 | 1.29e-67 | NA |
4. PB | P0C0V7 | Phosphoglucosamine mutase | 0.00e+00 | 1.39e-15 | 2.50e-07 | NA |
4. PB | Q9D0F9 | Phosphoglucomutase-1 | 0.00e+00 | 1.04e-14 | 2.33e-09 | NA |
4. PB | P37012 | Phosphoglucomutase 2 | 0.00e+00 | 2.82e-12 | 2.18e-07 | NA |
5. P | Q09687 | Phosphoacetylglucosamine mutase 1 | 1.60e-09 | 3.47e-13 | NA | NA |
5. P | Q6ZDQ1 | Phosphoacetylglucosamine mutase | 1.60e-04 | 6.89e-11 | NA | NA |
5. P | P93804 | Phosphoglucomutase, cytoplasmic 1 | 0.00e+00 | 2.47e-13 | NA | NA |
5. P | P93805 | Phosphoglucomutase, cytoplasmic 2 | 0.00e+00 | 3.66e-13 | NA | NA |
5. P | Q9SGC1 | Probable phosphoglucomutase, cytoplasmic 2 | 0.00e+00 | 3.29e-13 | NA | NA |
5. P | P57750 | Phosphoacetylglucosamine mutase | 8.02e-05 | 6.24e-15 | NA | NA |
5. P | O74374 | Phosphoglucomutase | 0.00e+00 | 2.40e-11 | NA | NA |
5. P | Q09770 | Phosphoacetylglucosamine mutase 2 | 5.87e-06 | 1.37e-18 | NA | NA |
5. P | O95394 | Phosphoacetylglucosamine mutase | 2.60e-06 | 1.17e-11 | NA | NA |
5. P | Q9ZSQ4 | Phosphoglucomutase, cytoplasmic | NA | 1.93e-13 | NA | NA |
5. P | O49299 | Probable phosphoglucomutase, cytoplasmic 1 | 0.00e+00 | 4.18e-12 | NA | NA |
5. P | P38628 | Phosphoacetylglucosamine mutase | 7.76e-05 | 6.94e-16 | NA | NA |