Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54947.1
JCVISYN3A_0747
Purine-nucleoside phosphorylase.
M. mycoides homolog: Q6MSE0.
TIGRfam Classification: 4=Probable.
Category: Quasiessential.
Statistics
Total GO Annotation: 79
Unique PROST Go: 47
Unique BLAST Go: 0
Unique Foldseek Go: 4
Total Homologs: 560
Unique PROST Homologs: 31
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 50
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
B4EWA1
(Purine nucleoside phosphorylase DeoD-type) with a FATCAT P-Value: 0 and RMSD of 2.09 angstrom. The sequence alignment identity is 31.7%.
Structural alignment shown in left. Query protein AVX54947.1 colored as red in alignment, homolog B4EWA1 colored as blue.
Query protein AVX54947.1 is also shown in right top, homolog B4EWA1 showed in right bottom. They are colored based on secondary structures.
AVX54947.1 M---HIDKNA---DIANIVLIAGDPKRTKWAAENLLTDYKLVSEVRNAFVYTGYYKNHKVSFATSGMGQPSIAIYVHELFNNHNVNTIIRVGTCGTY--N 92 B4EWA1 MATPHI--NAEMGDFADVVLMPGDPLRAKYIAETFLQDVRQVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKVIIRVGSCGAVLPD 98 AVX54947.1 ---NNIKIG----T---V--IEAK-NAFSEVNIFE--PNKTGWQINQPSLDLNIGLKANVHCSDVFYRLSK--LDIKE-HNLDVVDMESFALFYLANHFN 174 B4EWA1 VELRDVVIGMGACTDSKVNRLRFKDQDFAAIADFELVQNAVS-AAKAKDIKVRVG---NIFSADLFYSPDPEMFDVMEKYGILGVEMEAAGIYGVAAEYG 194 AVX54947.1 KKAATILTVSDNLNDHSNDLTAKQREIATL-KMYQDVLEK--LFAN 217 B4EWA1 ARALTICTVSDHIKKGTQ-TTSEERQ-TTFNEMIEIALESVLLLED 238
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006166 | purine ribonucleoside salvage |
| 1. PBF | GO:0047975 | guanosine phosphorylase activity |
| 1. PBF | GO:0019509 | L-methionine salvage from methylthioadenosine |
| 1. PBF | GO:0009166 | nucleotide catabolic process |
| 1. PBF | GO:0006195 | purine nucleotide catabolic process |
| 1. PBF | GO:0044206 | UMP salvage |
| 1. PBF | GO:0008930 | methylthioadenosine nucleosidase activity |
| 1. PBF | GO:0006148 | inosine catabolic process |
| 1. PBF | GO:0004850 | uridine phosphorylase activity |
| 1. PBF | GO:0004731 | purine-nucleoside phosphorylase activity |
| 1. PBF | GO:0006139 | nucleobase-containing compound metabolic process |
| 1. PBF | GO:0009164 | nucleoside catabolic process |
| 1. PBF | GO:0009116 | nucleoside metabolic process |
| 1. PBF | GO:0019284 | L-methionine salvage from S-adenosylmethionine |
| 1. PBF | GO:0017061 | S-methyl-5-thioadenosine phosphorylase activity |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0042278 | purine nucleoside metabolic process |
| 1. PBF | GO:0046124 | purine deoxyribonucleoside catabolic process |
| 1. PBF | GO:0008782 | adenosylhomocysteine nucleosidase activity |
| 2. PF | GO:0102246 | 6-amino-6-deoxyfutalosine hydrolase activity |
| 2. PF | GO:0005829 | cytosol |
| 2. PF | GO:0009234 | menaquinone biosynthetic process |
| 2. PF | GO:0006537 | glutamate biosynthetic process |
| 2. PF | GO:0016799 | hydrolase activity, hydrolyzing N-glycosyl compounds |
| 2. PF | GO:0003824 | catalytic activity |
| 2. PF | GO:0006218 | uridine catabolic process |
| 4. PB | GO:0019686 | purine nucleoside interconversion |
| 4. PB | GO:0006152 | purine nucleoside catabolic process |
| 5. P | GO:0034418 | urate biosynthetic process |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0034356 | NAD biosynthesis via nicotinamide riboside salvage pathway |
| 5. P | GO:0046059 | dAMP catabolic process |
| 5. P | GO:0046055 | dGMP catabolic process |
| 5. P | GO:0032743 | positive regulation of interleukin-2 production |
| 5. P | GO:0010087 | phloem or xylem histogenesis |
| 5. P | GO:0046115 | guanosine catabolic process |
| 5. P | GO:0000003 | reproduction |
| 5. P | GO:0000255 | allantoin metabolic process |
| 5. P | GO:0006204 | IMP catabolic process |
| 5. P | GO:0046070 | dGTP metabolic process |
| 5. P | GO:0002060 | purine nucleobase binding |
| 5. P | GO:0009165 | nucleotide biosynthetic process |
| 5. P | GO:0006249 | dCMP catabolic process |
| 5. P | GO:0045098 | type III intermediate filament |
| 5. P | GO:0046038 | GMP catabolic process |
| 5. P | GO:0009032 | thymidine phosphorylase activity |
| 5. P | GO:0042102 | positive regulation of T cell proliferation |
| 5. P | GO:0046079 | dUMP catabolic process |
| 5. P | GO:0047847 | deoxyuridine phosphorylase activity |
| 5. P | GO:0006157 | deoxyadenosine catabolic process |
| 5. P | GO:0046074 | dTMP catabolic process |
| 5. P | GO:0005524 | ATP binding |
| 5. P | GO:0015860 | purine nucleoside transmembrane transport |
| 5. P | GO:0015858 | nucleoside transport |
| 5. P | GO:0046638 | positive regulation of alpha-beta T cell differentiation |
| 5. P | GO:0043101 | purine-containing compound salvage |
| 5. P | GO:0046050 | UMP catabolic process |
| 5. P | GO:0001882 | nucleoside binding |
| 5. P | GO:0110052 | toxic metabolite repair |
| 5. P | GO:0006738 | nicotinamide riboside catabolic process |
| 5. P | GO:0006248 | CMP catabolic process |
| 5. P | GO:0006149 | deoxyinosine catabolic process |
| 5. P | GO:0016021 | integral component of membrane |
| 5. P | GO:0046108 | uridine metabolic process |
| 5. P | GO:1903228 | xanthosine catabolic process |
| 5. P | GO:0042802 | identical protein binding |
| 5. P | GO:0055086 | nucleobase-containing small molecule metabolic process |
| 5. P | GO:0015506 | nucleoside:proton symporter activity |
| 5. P | GO:0070635 | nicotinamide riboside hydrolase activity |
| 5. P | GO:0019860 | uracil metabolic process |
| 5. P | GO:0042301 | phosphate ion binding |
| 5. P | GO:0047724 | inosine nucleosidase activity |
| 5. P | GO:0006161 | deoxyguanosine catabolic process |
| 5. P | GO:0019358 | nicotinate nucleotide salvage |
| 5. P | GO:0019428 | allantoin biosynthetic process |
| 6. F | GO:0004045 | aminoacyl-tRNA hydrolase activity |
| 6. F | GO:0005576 | extracellular region |
| 6. F | GO:0016920 | pyroglutamyl-peptidase activity |
| 6. F | GO:0008714 | AMP nucleosidase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0009116 | nucleoside metabolic process |
| GO:0004731 | purine-nucleoside phosphorylase activity |
| GO:0016763 | pentosyltransferase activity |
| GO:0003824 | catalytic activity |
| GO:0016757 | glycosyltransferase activity |
| GO:0009164 | nucleoside catabolic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | B2VH53 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.28e-42 | 1.72e-28 | 0.9107 |
| 1. PBF | B5FTC8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.62e-41 | 2.52e-28 | 0.9197 |
| 1. PBF | C4LAY8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.16e-40 | 9.04e-27 | 0.8938 |
| 1. PBF | A9VLN1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9081 |
| 1. PBF | Q483Q8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.53e-46 | 8.28e-35 | 0.9101 |
| 1. PBF | Q3ICU8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.07e-44 | 1.51e-33 | 0.8939 |
| 1. PBF | Q56037 | Purine nucleoside phosphorylase DeoD-type (Fragment) | 0.00e+00 | 6.19e-24 | 2.02e-26 | 0.8082 |
| 1. PBF | Q6LUH1 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 4.64e-38 | 6.87e-30 | 0.907 |
| 1. PBF | B9IVI6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9081 |
| 1. PBF | B2INV3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.47e-43 | 4.03e-33 | 0.8768 |
| 1. PBF | B1YJP1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.00e-44 | 1.36e-23 | 0.8943 |
| 1. PBF | Q31SV5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.8873 |
| 1. PBF | Q03CD2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.13e-47 | 1.46e-30 | 0.8937 |
| 1. PBF | A8ALX7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 9.91e-42 | 1.88e-29 | 0.9189 |
| 1. PBF | Q9KPM0 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 5.87e-40 | 7.52e-29 | 0.8986 |
| 1. PBF | A3D7J1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-43 | 1.88e-25 | 0.9099 |
| 1. PBF | Q8EDM4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.64e-44 | 3.26e-25 | 0.8798 |
| 1. PBF | Q8KRT5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.03e-42 | 7.44e-26 | 0.9032 |
| 1. PBF | B8D7B4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.91e-14 | 8.23e-21 | 0.003 | 0.735 |
| 1. PBF | Q38XI0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.34e-39 | 1.16e-34 | 0.8677 |
| 1. PBF | A6TVU0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.93e-44 | 1.18e-31 | 0.8792 |
| 1. PBF | O83990 | Uridine phosphorylase | 1.11e-16 | 2.13e-32 | 5.29e-12 | 0.7503 |
| 1. PBF | Q89AQ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 7.98e-14 | 6.56e-20 | 1.44e-04 | 0.729 |
| 1. PBF | Q73B32 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9079 |
| 1. PBF | A9N7E3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.62e-41 | 2.52e-28 | 0.9198 |
| 1. PBF | B8ZNN8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 6.06e-34 | 0.8765 |
| 1. PBF | Q0I1K5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.08e-44 | 1.03e-31 | 0.8983 |
| 1. PBF | Q2YT29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.91e-14 | 5.49e-22 | 0.033 | 0.7449 |
| 1. PBF | C4L559 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.42e-14 | 1.40e-16 | 0.008 | 0.7601 |
| 1. PBF | Q1JM69 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.33e-45 | 2.61e-38 | 0.863 |
| 1. PBF | B0BPV3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.12e-41 | 1.18e-29 | 0.8962 |
| 1. PBF | A5EV41 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.16e-45 | 1.75e-22 | 0.8846 |
| 1. PBF | B0URX4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.39e-13 | 4.48e-18 | 0.045 | 0.7413 |
| 1. PBF | B2K3J1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.04e-39 | 2.24e-28 | 0.9157 |
| 1. PBF | A6M0X2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.94e-42 | 1.08e-32 | 0.8704 |
| 1. PBF | A3N122 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.72e-41 | 9.64e-30 | 0.8914 |
| 1. PBF | Q327L2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.10e-41 | 2.03e-28 | 0.9198 |
| 1. PBF | Q1CS88 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.38e-49 | 2.76e-22 | 0.9057 |
| 1. PBF | Q7A0R5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.44e-14 | 1.12e-21 | 0.026 | 0.7415 |
| 1. PBF | O34925 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.96e-38 | 1.06e-29 | 0.9029 |
| 1. PBF | Q5HFG2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.64e-14 | 1.12e-21 | 0.026 | 0.7416 |
| 1. PBF | B5E3K8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 6.06e-34 | 0.8765 |
| 1. PBF | Q9KNB2 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 6.52e-43 | 1.32e-30 | 0.87 |
| 1. PBF | B1LEI9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9132 |
| 1. PBF | C1CS55 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.47e-43 | 4.03e-33 | 0.8712 |
| 1. PBF | Q7N930 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.04e-41 | 3.80e-27 | 0.9134 |
| 1. PBF | B5Z4R6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9136 |
| 1. PBF | Q02ZT0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.72e-44 | 1.82e-30 | 0.8962 |
| 1. PBF | Q81T09 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9081 |
| 1. PBF | Q6LLA7 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 1.01e-44 | 8.78e-31 | 0.9142 |
| 1. PBF | Q8D3Z2 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 1.75e-45 | 4.94e-30 | 0.9114 |
| 1. PBF | B1IS35 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9201 |
| 1. PBF | Q086F7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.87e-44 | 3.30e-27 | 0.9046 |
| 1. PBF | Q1D9Z7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.43e-44 | 2.59e-26 | 0.9047 |
| 1. PBF | Q8ZIQ2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.74e-39 | 8.62e-28 | 0.908 |
| 1. PBF | Q6HL92 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.8812 |
| 1. PBF | Q4QN30 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.12e-43 | 6.94e-29 | 0.8686 |
| 1. PBF | Q65RA4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.19e-41 | 1.51e-27 | 0.8938 |
| 1. PBF | Q8ZJV7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.06e-41 | 2.36e-27 | 0.9192 |
| 1. PBF | B4TH02 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.06e-41 | 2.36e-27 | 0.9187 |
| 1. PBF | P57306 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.66e-14 | 2.15e-20 | 0.005 | 0.7203 |
| 1. PBF | A5UH23 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.45e-44 | 6.18e-29 | 0.8875 |
| 1. PBF | A5K9M4 | Purine nucleoside phosphorylase | 0.00e+00 | 2.22e-40 | 5.59e-04 | 0.8267 |
| 1. PBF | Q03KK1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.78e-44 | 1.22e-33 | 0.877 |
| 1. PBF | C5BHJ5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.70e-41 | 3.78e-29 | 0.9036 |
| 1. PBF | P57606 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.55e-52 | 4.45e-29 | 0.9053 |
| 1. PBF | Q8R973 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.43e-45 | 1.43e-35 | 0.8874 |
| 1. PBF | A6QHE1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.85e-14 | 1.12e-21 | 0.026 | 0.7418 |
| 1. PBF | Q6D989 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.30e-39 | 1.36e-26 | 0.9013 |
| 1. PBF | A6U271 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.64e-14 | 1.12e-21 | 0.026 | 0.7417 |
| 1. PBF | Q6GGA2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.84e-14 | 1.22e-21 | 0.033 | 0.745 |
| 1. PBF | Q9CH10 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.60e-44 | 5.58e-30 | 0.8977 |
| 1. PBF | A7MIG7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.62e-40 | 4.50e-29 | 0.907 |
| 1. PBF | B7LNS4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9135 |
| 1. PBF | Q7NRT2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.25e-46 | 2.50e-26 | 0.8929 |
| 1. PBF | Q12QG0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.28e-43 | 9.00e-25 | 0.8758 |
| 1. PBF | Q57G38 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.62e-41 | 2.52e-28 | 0.919 |
| 1. PBF | A6WRB5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-43 | 1.88e-25 | 0.9133 |
| 1. PBF | A6VM01 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.39e-42 | 3.42e-28 | 0.8979 |
| 1. PBF | Q7VMS8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.73e-42 | 1.08e-31 | 0.9021 |
| 1. PBF | P56463 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.54e-47 | 8.98e-23 | 0.896 |
| 1. PBF | B6EKZ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.86e-14 | 1.07e-20 | 0.017 | 0.7387 |
| 1. PBF | Q0HLE7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.05e-42 | 4.57e-26 | 0.9019 |
| 1. PBF | A8LJI8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 9.19e-45 | 2.81e-33 | 0.8748 |
| 1. PBF | Q81FV5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.56e-45 | 3.35e-33 | 0.9002 |
| 1. PBF | A1SYK4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.39e-44 | 1.78e-28 | 0.9161 |
| 1. PBF | A7FMH2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.04e-39 | 2.24e-28 | 0.9157 |
| 1. PBF | Q169T2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.36e-44 | 6.34e-37 | 0.8912 |
| 1. PBF | A4W6A1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 9.30e-28 | 0.9163 |
| 1. PBF | A3QGT0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.63e-45 | 3.71e-27 | 0.9028 |
| 1. PBF | P44417 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.12e-43 | 6.94e-29 | 0.8964 |
| 1. PBF | A7ZVS7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9135 |
| 1. PBF | A7X306 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.68e-14 | 1.12e-21 | 0.026 | 0.7418 |
| 1. PBF | A0Q1A0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.80e-48 | 1.95e-36 | 0.9031 |
| 1. PBF | Q59482 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.75e-40 | 9.28e-28 | 0.903 |
| 1. PBF | Q8EHK0 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 8.98e-43 | 2.40e-26 | 0.884 |
| 1. PBF | Q1CMY7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.74e-39 | 8.62e-28 | 0.908 |
| 1. PBF | Q0HXQ1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.05e-42 | 4.57e-26 | 0.8951 |
| 1. PBF | B2TZR7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9134 |
| 1. PBF | C4ZT66 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9134 |
| 1. PBF | Q9ZK38 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.53e-48 | 2.54e-23 | 0.9058 |
| 1. PBF | Q7N841 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.44e-13 | 8.52e-19 | 0.037 | 0.7032 |
| 1. PBF | A7Z5M8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.54e-38 | 1.30e-31 | 0.9063 |
| 1. PBF | Q8Y644 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-46 | 2.86e-34 | 0.8896 |
| 1. PBF | B1JL34 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.04e-39 | 2.24e-28 | 0.916 |
| 1. PBF | B6I6N1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9131 |
| 1. PBF | Q5DYV8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.66e-41 | 1.94e-24 | 0.8968 |
| 1. PBF | Q2SHN2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.42e-43 | 1.25e-28 | 0.9075 |
| 1. PBF | Q1JC85 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.33e-45 | 2.61e-38 | 0.8623 |
| 1. PBF | B4TU44 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.9185 |
| 1. PBF | B5R2J9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.62e-41 | 2.52e-28 | 0.9196 |
| 1. PBF | Q0TQJ7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.22e-44 | 1.78e-27 | 0.9155 |
| 1. PBF | B7MNJ1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9135 |
| 1. PBF | Q8DBS9 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 1.06e-40 | 9.19e-28 | 0.8952 |
| 1. PBF | A1S477 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.51e-43 | 1.25e-25 | 0.9139 |
| 1. PBF | B3H1P6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.72e-41 | 9.64e-30 | 0.8906 |
| 1. PBF | B8D909 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.52e-14 | 8.23e-21 | 0.003 | 0.7356 |
| 1. PBF | B0K889 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.15e-45 | 2.56e-35 | 0.9003 |
| 1. PBF | Q8FA51 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9196 |
| 1. PBF | O83716 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.86e-47 | 4.85e-30 | 0.8969 |
| 1. PBF | P94164 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.72e-41 | 9.64e-30 | 0.8908 |
| 1. PBF | B5R9V2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.35e-39 | 3.39e-28 | 0.9189 |
| 1. PBF | B8D9W3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.47e-52 | 1.25e-28 | 0.9112 |
| 1. PBF | Q8T9Z7 | Purine nucleoside phosphorylase | 0.00e+00 | 3.95e-40 | 4.03e-04 | 0.8154 |
| 1. PBF | B7LEN0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9135 |
| 1. PBF | B5F527 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.9194 |
| 1. PBF | P47295 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.85e-50 | 8.33e-34 | 0.894 |
| 1. PBF | B7LXU6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.8874 |
| 1. PBF | C3L9J6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.908 |
| 1. PBF | C4L2Y4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.96e-43 | 1.21e-25 | 0.8948 |
| 1. PBF | B6ER81 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.18e-42 | 7.07e-32 | 0.9053 |
| 1. PBF | B7UR12 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9077 |
| 1. PBF | Q5EEL8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.8812 |
| 1. PBF | A5U9X5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.26e-45 | 1.64e-28 | 0.9047 |
| 1. PBF | Q7A5B0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.70e-14 | 1.12e-21 | 0.026 | 0.7407 |
| 1. PBF | B4T4H3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.919 |
| 1. PBF | B6JN17 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.48e-48 | 7.91e-23 | 0.9058 |
| 1. PBF | Q3YU09 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9135 |
| 1. PBF | B5Y274 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.30e-40 | 2.94e-29 | 0.919 |
| 1. PBF | B7NW64 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9198 |
| 1. PBF | Q894Z3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.38e-45 | 2.13e-32 | 0.8746 |
| 1. PBF | A9MRA4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.24e-41 | 1.85e-28 | 0.9144 |
| 1. PBF | Q5E2X3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.36e-14 | 9.69e-20 | 0.017 | 0.737 |
| 1. PBF | C1C6H0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 6.06e-34 | 0.8775 |
| 1. PBF | A4IN93 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 4.16e-33 | 0.9145 |
| 1. PBF | Q87G42 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 1.01e-44 | 1.20e-30 | 0.8838 |
| 1. PBF | Q5KZM1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.64e-45 | 7.92e-34 | 0.8993 |
| 1. PBF | B5FAL1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.97e-14 | 9.69e-20 | 0.017 | 0.7532 |
| 1. PBF | Q0ST47 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.22e-44 | 3.91e-27 | 0.9155 |
| 1. PBF | C6DKM0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.83e-40 | 3.13e-25 | 0.9026 |
| 1. PBF | Q8K937 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.68e-49 | 2.52e-31 | 0.9049 |
| 1. PBF | A4W2M2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.92e-45 | 2.48e-39 | 0.8747 |
| 1. PBF | Q92AF2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.43e-46 | 2.24e-34 | 0.9039 |
| 1. PBF | Q5E7J4 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 1.33e-44 | 6.96e-28 | 0.9115 |
| 1. PBF | Q7MI41 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 1.06e-40 | 9.19e-28 | 0.894 |
| 1. PBF | B9DNJ2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.10e-14 | 2.18e-22 | 0.015 | 0.7487 |
| 1. PBF | B7HHL7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.43e-45 | 3.35e-33 | 0.9071 |
| 1. PBF | Q65IE9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.04e-41 | 7.89e-31 | 0.9044 |
| 1. PBF | Q89A58 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.05e-45 | 2.33e-27 | 0.8907 |
| 1. PBF | B2UUU1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.05e-48 | 1.11e-22 | 0.9033 |
| 1. PBF | B9DUK0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.14e-45 | 3.16e-37 | 0.8696 |
| 1. PBF | B4EWA1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.17e-40 | 8.87e-27 | 0.9023 |
| 1. PBF | A0RBS0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9081 |
| 1. PBF | O32810 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.72e-44 | 1.82e-30 | 0.8595 |
| 1. PBF | A4VWC2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.92e-45 | 2.48e-39 | 0.8753 |
| 1. PBF | B3W8N4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.13e-47 | 1.46e-30 | 0.8907 |
| 1. PBF | Q63DR9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.67e-45 | 3.61e-33 | 0.8788 |
| 1. PBF | Q66EV7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.04e-39 | 2.24e-28 | 0.9158 |
| 1. PBF | B5BAK0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.9075 |
| 1. PBF | Q0I5K4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.13e-13 | 4.38e-17 | 0.021 | 0.7349 |
| 1. PBF | B5Z8H2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.82e-49 | 3.13e-22 | 0.9058 |
| 1. PBF | B1IB05 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-44 | 3.78e-33 | 0.8766 |
| 1. PBF | A5ITC6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.45e-14 | 1.12e-21 | 0.026 | 0.7407 |
| 1. PBF | C0ZDZ3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 9.52e-46 | 2.40e-32 | 0.886 |
| 1. PBF | A7GN01 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.00e-45 | 1.05e-34 | 0.9116 |
| 1. PBF | C1CJS5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 6.06e-34 | 0.8766 |
| 1. PBF | Q04L76 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.06e-45 | 6.06e-34 | 0.8702 |
| 1. PBF | B7HKX2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9082 |
| 1. PBF | Q83P00 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9199 |
| 1. PBF | A1JJA0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.40e-39 | 2.11e-28 | 0.9158 |
| 1. PBF | B8D865 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.55e-52 | 4.45e-29 | 0.9115 |
| 1. PBF | A9R046 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.74e-39 | 8.62e-28 | 0.9064 |
| 1. PBF | A8A8B3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9131 |
| 1. PBF | P43770 | Uridine phosphorylase | 0.00e+00 | 8.07e-36 | 9.63e-07 | 0.8443 |
| 1. PBF | Q0SX27 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9197 |
| 1. PBF | Q0T8S9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9192 |
| 1. PBF | Q87M25 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 4.17e-41 | 7.05e-28 | 0.8863 |
| 1. PBF | B0K6Y4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.15e-45 | 2.56e-35 | 0.8993 |
| 1. PBF | B7JGU6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9081 |
| 1. PBF | Q8Z0U2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.919 |
| 1. PBF | B7NH52 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9131 |
| 1. PBF | Q99TQ0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.39e-14 | 1.12e-21 | 0.026 | 0.7411 |
| 1. PBF | Q17YP0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.15e-49 | 8.58e-21 | 0.9055 |
| 1. PBF | A5VHR2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.28e-47 | 9.92e-34 | 0.9046 |
| 1. PBF | Q03Q52 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.03e-42 | 4.57e-31 | 0.8914 |
| 1. PBF | P77835 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.77e-48 | 1.20e-36 | 0.9127 |
| 1. PBF | Q5E0H4 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 3.00e-46 | 5.16e-34 | 0.9071 |
| 1. PBF | B0UVM2 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 5.86e-44 | 4.47e-33 | 0.8953 |
| 1. PBF | A0AJW1 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.43e-46 | 2.24e-34 | 0.8935 |
| 1. PBF | P75053 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.99e-42 | 5.63e-38 | 0.8907 |
| 1. PBF | B7IP41 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.881 |
| 1. PBF | Q28U96 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.44e-44 | 4.31e-33 | 0.9067 |
| 1. PBF | Q8EKK0 | Purine nucleoside phosphorylase DeoD-type 1 | 0.00e+00 | 6.38e-46 | 1.05e-27 | 0.9057 |
| 1. PBF | C1EMV9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.9082 |
| 1. PBF | A2RF09 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.79e-45 | 1.06e-43 | 0.8639 |
| 1. PBF | C5D2F9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.39e-45 | 2.85e-35 | 0.9087 |
| 1. PBF | B8F672 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 2.18e-42 | 2.91e-32 | 0.9069 |
| 1. PBF | Q9CLE6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.30e-42 | 8.02e-31 | 0.9172 |
| 1. PBF | P0ABP9 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9134 |
| 1. PBF | Q5PK20 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 8.46e-42 | 2.41e-28 | 0.9074 |
| 1. PBF | B7N2V8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.29e-41 | 1.81e-28 | 0.9196 |
| 1. PBF | B8E6P7 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.12e-43 | 2.09e-25 | 0.9095 |
| 1. PBF | Q2FGC5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.62e-14 | 1.12e-21 | 0.026 | 0.7417 |
| 1. PBF | A1IGA8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.06e-14 | 6.67e-20 | 0.017 | 0.7213 |
| 1. PBF | A8Z4D8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.24e-14 | 1.12e-21 | 0.026 | 0.7415 |
| 1. PBF | C3P552 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.14e-45 | 3.53e-33 | 0.8811 |
| 1. PBF | Q6G8W9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.99e-14 | 1.12e-21 | 0.026 | 0.7318 |
| 1. PBF | Q71YG0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-46 | 2.86e-34 | 0.8932 |
| 1. PBF | Q8ENY0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.55e-46 | 1.47e-36 | 0.8967 |
| 1. PBF | B1XFJ4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | 0.9137 |
| 1. PBF | Q1C166 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.74e-39 | 8.62e-28 | 0.9197 |
| 1. PBF | Q7MFG6 | Purine nucleoside phosphorylase DeoD-type 2 | 0.00e+00 | 1.75e-45 | 4.94e-30 | 0.9088 |
| 1. PBF | A4TQJ0 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.74e-39 | 8.62e-28 | 0.9078 |
| 1. PBF | C1KWF5 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-46 | 2.86e-34 | 0.8894 |
| 1. PBF | Q1J733 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.64e-44 | 2.22e-38 | 0.8631 |
| 1. PBF | B8DDP6 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.09e-46 | 2.86e-34 | 0.8934 |
| 1. PBF | P50389 | Purine nucleoside phosphorylase | 0.00e+00 | 3.59e-42 | 6.11e-19 | 0.8746 |
| 1. PBF | B2G592 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 6.28e-47 | 9.92e-34 | 0.9033 |
| 1. PBF | B7GKU4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 3.08e-48 | 7.61e-37 | 0.9129 |
| 1. PBF | A8AXN4 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 1.85e-44 | 8.30e-34 | 0.8759 |
| 1. PBF | C1CDI3 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 7.63e-45 | 6.82e-34 | 0.8762 |
| 2. PF | P0DJF8 | S-methyl-5'-thioadenosine phosphorylase | 9.19e-10 | 3.41e-03 | NA | 0.6397 |
| 2. PF | C4K6C1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.74e-14 | 4.81e-15 | NA | 0.7308 |
| 2. PF | A6WKN2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.93e-14 | 5.28e-19 | NA | 0.7225 |
| 2. PF | C3L5Y0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.24e-14 | 1.74e-21 | NA | 0.748 |
| 2. PF | C4YQD9 | S-methyl-5'-thioadenosine phosphorylase | 1.45e-08 | 1.84e-07 | NA | 0.6274 |
| 2. PF | Q1CLU1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.13e-13 | 2.48e-16 | NA | 0.7229 |
| 2. PF | B7LGM1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 9.68e-19 | NA | 0.7541 |
| 2. PF | E3K7C1 | S-methyl-5'-thioadenosine phosphorylase 2 | 7.16e-09 | 1.32e-05 | NA | 0.6005 |
| 2. PF | B6HZD5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.32e-13 | 9.68e-19 | NA | 0.7543 |
| 2. PF | B1L719 | Probable 6-oxopurine nucleoside phosphorylase | 1.84e-09 | 5.25e-08 | NA | 0.6308 |
| 2. PF | C3P964 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.25e-14 | 1.74e-21 | NA | 0.7469 |
| 2. PF | Q1RG29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.01e-13 | 9.68e-19 | NA | 0.7544 |
| 2. PF | P77834 | Purine nucleoside phosphorylase 1 | 1.53e-10 | 1.28e-09 | NA | 0.6645 |
| 2. PF | Q9KXN0 | Futalosine hydrolase | 6.39e-12 | 2.60e-21 | NA | 0.6637 |
| 2. PF | B7M1A0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.00e-13 | 9.68e-19 | NA | 0.7568 |
| 2. PF | Q6HDF1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.72e-14 | 1.83e-21 | NA | 0.7644 |
| 2. PF | B8CQP2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.50e-14 | 2.39e-21 | NA | 0.7304 |
| 2. PF | A0KIZ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.34e-14 | 4.37e-21 | NA | 0.7554 |
| 2. PF | Q0HSG5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.63e-14 | 2.05e-20 | NA | 0.7252 |
| 2. PF | B7UIK6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.11e-13 | 9.68e-19 | NA | 0.7542 |
| 2. PF | Q92BL9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.67e-14 | 3.11e-19 | NA | 0.7339 |
| 2. PF | Q72LZ4 | S-methyl-5'-thioadenosine phosphorylase | 4.05e-10 | 7.52e-05 | NA | 0.6586 |
| 2. PF | P0AF14 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.06e-13 | 9.68e-19 | NA | 0.7572 |
| 2. PF | B0TIS5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.18e-14 | 2.35e-21 | NA | 0.7133 |
| 2. PF | Q5SKT7 | Futalosine hydrolase | 2.86e-13 | 1.34e-15 | NA | 0.6754 |
| 2. PF | O66839 | Probable 6-oxopurine nucleoside phosphorylase | 2.88e-09 | 4.38e-06 | NA | 0.6001 |
| 2. PF | A4Y4H9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.50e-14 | 6.52e-21 | NA | 0.7228 |
| 2. PF | B1HUJ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.52e-14 | 3.64e-20 | NA | 0.7366 |
| 2. PF | Q5JJB8 | Probable 6-oxopurine nucleoside phosphorylase | 4.19e-10 | 4.46e-08 | NA | 0.624 |
| 2. PF | Q8PB40 | Probable S-methyl-5'-thioinosine phosphorylase | 3.01e-10 | 4.34e-10 | NA | 0.6317 |
| 2. PF | B2K553 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.41e-13 | 1.24e-17 | NA | 0.7284 |
| 2. PF | G4VGI0 | Uridine phosphorylase A | 2.70e-11 | 5.48e-15 | NA | 0.7229 |
| 2. PF | Q9X0L3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.25e-14 | 6.00e-23 | NA | 0.6676 |
| 2. PF | F6X2V8 | S-methyl-5'-thioadenosine phosphorylase | 3.85e-10 | 7.02e-07 | NA | 0.6254 |
| 2. PF | Q5JEQ6 | S-methyl-5'-thioadenosine phosphorylase | 3.09e-10 | 3.03e-08 | NA | 0.6159 |
| 2. PF | Q0TLH2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.06e-13 | 9.68e-19 | NA | 0.7542 |
| 2. PF | Q87SE5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.91e-14 | 2.98e-18 | NA | 0.7157 |
| 2. PF | B5R3H1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.20e-13 | 3.06e-19 | NA | 0.7634 |
| 2. PF | A9MPK2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.35e-13 | 3.01e-19 | NA | 0.7608 |
| 2. PF | Q2RKL6 | Probable 6-oxopurine nucleoside phosphorylase | 2.66e-10 | 2.01e-08 | NA | 0.6383 |
| 2. PF | B8EBS7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.65e-14 | 4.64e-19 | NA | 0.7275 |
| 2. PF | Q9HZK1 | S-methyl-5'-thioinosine phosphorylase | 6.35e-10 | 1.16e-17 | NA | 0.6586 |
| 2. PF | A7SN31 | S-methyl-5'-thioadenosine phosphorylase | 9.15e-10 | 4.17e-03 | NA | 0.6216 |
| 2. PF | Q09117 | Bark storage protein B | 3.42e-11 | 9.80e-15 | NA | 0.6996 |
| 2. PF | C6BU87 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.84e-14 | 3.37e-19 | NA | 0.7798 |
| 2. PF | B5Y1L0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.16e-13 | 7.87e-19 | NA | 0.7622 |
| 2. PF | Q49Y40 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.75e-14 | 3.05e-23 | NA | 0.7794 |
| 2. PF | A7MXP2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.46e-14 | 1.14e-17 | NA | 0.7382 |
| 2. PF | Q74E52 | S-methyl-5'-thioadenosine phosphorylase | 3.09e-10 | 1.26e-02 | NA | 0.5977 |
| 2. PF | B3H2N4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.34e-13 | 6.63e-21 | NA | 0.7528 |
| 2. PF | A7ZHQ1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.94e-14 | 9.68e-19 | NA | 0.7544 |
| 2. PF | P9WJM2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 7.92e-14 | 1.15e-14 | NA | 0.7115 |
| 2. PF | A4IR66 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.47e-13 | 4.41e-18 | NA | 0.7287 |
| 2. PF | Q9KYV7 | Purine nucleoside phosphorylase | 1.01e-09 | 2.20e-03 | NA | 0.6417 |
| 2. PF | P0AF13 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.40e-14 | 9.68e-19 | NA | 0.7545 |
| 2. PF | C0NRX4 | S-methyl-5'-thioadenosine phosphorylase | 1.46e-06 | 4.18e-05 | NA | 0.6071 |
| 2. PF | Q5HNU8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.60e-14 | 8.26e-22 | NA | 0.7454 |
| 2. PF | Q0HG72 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.56e-14 | 2.58e-20 | NA | 0.7557 |
| 2. PF | Q7VDN6 | S-methyl-5'-thioadenosine phosphorylase | 1.38e-09 | 1.97e-05 | NA | 0.6169 |
| 2. PF | B8F704 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.62e-14 | 3.16e-19 | NA | 0.7481 |
| 2. PF | B1IQI1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 9.68e-19 | NA | 0.7573 |
| 2. PF | Q3Z5J8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.06e-13 | 9.68e-19 | NA | 0.7567 |
| 2. PF | A4TPX2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.75e-14 | 2.48e-16 | NA | 0.7153 |
| 2. PF | A2BIU4 | S-methyl-5'-thioadenosine phosphorylase | 4.57e-11 | 1.15e-11 | NA | 0.5807 |
| 2. PF | A7FM04 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.11e-13 | 1.24e-17 | NA | 0.7331 |
| 2. PF | Q89VT5 | S-methyl-5'-thioadenosine phosphorylase | 5.11e-10 | 1.35e-02 | NA | 0.6371 |
| 2. PF | A4SP53 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.96e-14 | 3.46e-21 | NA | 0.7785 |
| 2. PF | A9L5L1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.67e-14 | 4.64e-19 | NA | 0.7207 |
| 2. PF | B7NIC2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.13e-13 | 9.68e-19 | NA | 0.7541 |
| 2. PF | P0A539 | Purine nucleoside phosphorylase | 5.30e-10 | 6.37e-09 | NA | 0.663 |
| 2. PF | Q730G0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.15e-14 | 1.74e-21 | NA | 0.7475 |
| 2. PF | E3XFR6 | S-methyl-5'-thioadenosine phosphorylase | 4.94e-10 | 1.90e-04 | NA | 0.6326 |
| 2. PF | A1S3V6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.60e-14 | 5.04e-22 | NA | 0.7322 |
| 2. PF | Q07469 | Bark storage protein A | 2.70e-11 | 4.88e-15 | NA | 0.7034 |
| 2. PF | A0LR22 | Futalosine hydrolase | 2.28e-11 | 1.18e-11 | NA | 0.63 |
| 2. PF | Q71ZH6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 7.59e-14 | 1.55e-19 | NA | 0.6892 |
| 2. PF | B2U303 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.08e-13 | 9.68e-19 | NA | 0.7538 |
| 2. PF | O51931 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.02e-14 | 9.70e-17 | NA | 0.7759 |
| 2. PF | B0BRW3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.59e-14 | 2.16e-21 | NA | 0.7517 |
| 2. PF | Q8DJE4 | S-methyl-5'-thioadenosine phosphorylase | 1.46e-10 | 1.75e-02 | NA | 0.6001 |
| 2. PF | A0QR54 | S-methyl-5'-thioadenosine phosphorylase | 8.40e-10 | 6.52e-09 | NA | 0.6348 |
| 2. PF | A5UCP4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.23e-14 | 8.10e-21 | NA | 0.698 |
| 2. PF | Q12KE6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.21e-15 | 1.18e-22 | NA | 0.7217 |
| 2. PF | A7MGS5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.31e-13 | 7.74e-19 | NA | 0.7457 |
| 2. PF | Q5PD46 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.73e-13 | 8.79e-20 | NA | 0.7669 |
| 2. PF | Q4PH43 | S-methyl-5'-thioadenosine phosphorylase | 3.84e-06 | 8.92e-06 | NA | 0.6427 |
| 2. PF | Q87ZC3 | Probable S-methyl-5'-thioinosine phosphorylase | 1.02e-09 | 4.88e-15 | NA | 0.636 |
| 2. PF | O24915 | Aminodeoxyfutalosine nucleosidase | 6.66e-15 | 2.02e-21 | NA | 0.7829 |
| 2. PF | B4EUF0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.77e-14 | 3.54e-18 | NA | 0.77 |
| 2. PF | A5UIX8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.40e-14 | 1.82e-19 | NA | 0.7326 |
| 2. PF | O08444 | Uridine phosphorylase | 1.11e-16 | 1.08e-35 | NA | 0.8011 |
| 2. PF | B2VE28 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.12e-13 | 4.81e-20 | NA | 0.732 |
| 2. PF | Q65SB6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 7.31e-14 | 1.34e-19 | NA | 0.7486 |
| 2. PF | B5Z0D9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.16e-13 | 9.68e-19 | NA | 0.7543 |
| 2. PF | B4TXR1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.04e-13 | 3.26e-19 | NA | 0.7663 |
| 2. PF | Q297F5 | Purine nucleoside phosphorylase | 2.09e-10 | 2.48e-08 | NA | 0.6429 |
| 2. PF | Q97W94 | S-methyl-5'-thioadenosine phosphorylase | 6.99e-11 | 1.09e-10 | NA | 0.6279 |
| 2. PF | B1YJD6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.22e-13 | 3.63e-21 | NA | 0.7193 |
| 2. PF | Q6AQW7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.47e-14 | 1.83e-18 | NA | 0.7374 |
| 2. PF | Q6CES3 | S-methyl-5'-thioadenosine phosphorylase | 8.21e-09 | 1.23e-06 | NA | 0.6243 |
| 2. PF | Q8TZB4 | Probable S-methyl-5'-thioinosine phosphorylase | 3.12e-09 | 1.43e-07 | NA | 0.6244 |
| 2. PF | P9WP00 | Purine nucleoside phosphorylase | 5.03e-10 | 6.37e-09 | NA | 0.6861 |
| 2. PF | B7N828 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.78e-14 | 9.68e-19 | NA | 0.7569 |
| 2. PF | Q7RZA5 | S-methyl-5'-thioadenosine phosphorylase | 2.01e-09 | 2.30e-03 | NA | 0.646 |
| 2. PF | B1LGW2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.05e-13 | 9.68e-19 | NA | 0.7539 |
| 2. PF | A7Z721 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 7.31e-14 | 1.71e-18 | NA | 0.7462 |
| 2. PF | C1KVE1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.33e-14 | 1.58e-19 | NA | 0.7099 |
| 2. PF | O32028 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.45e-14 | 1.03e-18 | NA | 0.7446 |
| 2. PF | Q6D1Z4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.48e-14 | 1.95e-20 | NA | 0.7532 |
| 2. PF | Q7VKK0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.79e-14 | 3.02e-21 | NA | 0.7353 |
| 2. PF | C6DC27 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.03e-13 | 1.43e-19 | NA | 0.7525 |
| 2. PF | Q8EHA7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.09e-14 | 2.64e-19 | NA | 0.7401 |
| 2. PF | C7YLQ3 | S-methyl-5'-thioadenosine phosphorylase | 1.95e-09 | 4.46e-04 | NA | 0.6424 |
| 2. PF | Q812S1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.45e-14 | 3.40e-21 | NA | 0.7403 |
| 2. PF | Q1C3X7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.39e-14 | 1.38e-16 | NA | 0.7214 |
| 2. PF | A9VHZ5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.76e-14 | 2.39e-21 | NA | 0.7564 |
| 2. PF | Q6LUR4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 8.79e-20 | NA | 0.7164 |
| 2. PF | A8FFL1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.49e-14 | 3.64e-20 | NA | 0.7494 |
| 2. PF | B7MBE2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 9.68e-19 | NA | 0.7542 |
| 2. PF | C0Q5S0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.63e-13 | 8.11e-20 | NA | 0.7544 |
| 2. PF | B7GIU7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.12e-13 | 3.37e-19 | NA | 0.7724 |
| 2. PF | B7MP21 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.04e-13 | 9.68e-19 | NA | 0.7542 |
| 2. PF | Q1LTN6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.77e-14 | 1.73e-24 | NA | 0.7574 |
| 2. PF | A1RMF2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.63e-14 | 2.30e-20 | NA | 0.7186 |
| 2. PF | O57865 | S-methyl-5'-thioadenosine phosphorylase | 3.23e-10 | 1.05e-09 | NA | 0.6076 |
| 2. PF | Q4L6V0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.90e-14 | 2.12e-21 | NA | 0.7599 |
| 2. PF | P52671 | Uridine phosphorylase | 1.17e-13 | 3.69e-23 | NA | 0.7739 |
| 2. PF | B5RHE5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.73e-14 | 3.06e-19 | NA | 0.7632 |
| 2. PF | B7JP64 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.38e-14 | 1.74e-21 | NA | 0.7557 |
| 2. PF | Q8CP08 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.96e-14 | 8.26e-22 | NA | 0.7479 |
| 2. PF | Q9HL98 | S-methyl-5'-thioadenosine phosphorylase | 2.66e-10 | 3.11e-09 | NA | 0.6126 |
| 2. PF | A9A3N5 | S-methyl-5'-thioadenosine phosphorylase | 1.09e-10 | 1.03e-07 | NA | 0.6345 |
| 2. PF | B8E181 | Probable 6-oxopurine nucleoside phosphorylase | 2.80e-10 | 4.73e-08 | NA | 0.6501 |
| 2. PF | P0DJF9 | S-methyl-5'-thioadenosine phosphorylase | 9.48e-10 | 3.41e-03 | NA | 0.6397 |
| 2. PF | Q8DEM9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.77e-14 | 2.52e-17 | NA | 0.7248 |
| 2. PF | Q1QVV7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.64e-14 | 8.37e-20 | NA | 0.7566 |
| 2. PF | E3K7C3 | S-methyl-5'-thioadenosine phosphorylase 1 | 1.32e-08 | 1.49e-03 | NA | 0.6018 |
| 2. PF | A8XGS6 | S-methyl-5'-thioadenosine phosphorylase | 5.84e-10 | 8.83e-05 | NA | 0.6156 |
| 2. PF | P55859 | Purine nucleoside phosphorylase | 6.67e-10 | 1.53e-07 | NA | 0.6345 |
| 2. PF | P60216 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.78e-14 | 8.65e-20 | NA | 0.7633 |
| 2. PF | G4VGH9 | Inactive uridine phosphorylase B | 3.45e-11 | 2.23e-14 | NA | 0.7084 |
| 2. PF | A1RXU2 | S-methyl-5'-thioadenosine phosphorylase | 1.55e-10 | 5.12e-09 | NA | 0.6503 |
| 2. PF | B8DE17 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.36e-14 | 1.41e-19 | NA | 0.7526 |
| 2. PF | B7LWC0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.21e-13 | 4.35e-19 | NA | 0.7451 |
| 2. PF | O93844 | Purine nucleoside permease | 1.37e-07 | 2.13e-07 | NA | 0.6079 |
| 2. PF | Q8CXR2 | S-methyl-5'-thioadenosine phosphorylase | 4.77e-10 | 1.59e-05 | NA | 0.6398 |
| 2. PF | B7IYM7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.02e-14 | 3.07e-21 | NA | 0.7574 |
| 2. PF | A4W6Q6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.24e-13 | 5.63e-19 | NA | 0.7637 |
| 2. PF | P0AF15 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.74e-14 | 9.68e-19 | NA | 0.7567 |
| 2. PF | P0A1F6 | Uridine phosphorylase | 1.11e-16 | 6.27e-36 | NA | 0.8003 |
| 2. PF | Q9KPI8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.34e-14 | 3.42e-19 | NA | 0.7508 |
| 2. PF | B4SUY9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.48e-14 | 3.06e-19 | NA | 0.7634 |
| 2. PF | Q81LL4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.98e-14 | 1.74e-21 | NA | 0.7556 |
| 2. PF | Q9PAZ2 | Probable S-methyl-5'-thioinosine phosphorylase | 1.21e-09 | 2.08e-11 | NA | 0.6064 |
| 2. PF | A5F5R2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.18e-14 | 3.42e-19 | NA | 0.7491 |
| 2. PF | A9WAL0 | S-methyl-5'-thioadenosine phosphorylase | 1.32e-10 | 3.11e-03 | NA | 0.6925 |
| 2. PF | Q32JU9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.12e-13 | 9.68e-19 | NA | 0.7541 |
| 2. PF | A6W3C9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.49e-14 | 4.24e-23 | NA | 0.7037 |
| 2. PF | Q8Y729 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.52e-14 | 2.87e-19 | NA | 0.7164 |
| 2. PF | Q325Y0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.05e-13 | 1.05e-18 | NA | 0.7521 |
| 2. PF | Q5KWV9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.38e-13 | 7.62e-19 | NA | 0.7422 |
| 2. PF | Q8EPT8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.79e-14 | 1.04e-20 | NA | 0.7447 |
| 2. PF | Q07YV9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.94e-14 | 2.92e-21 | NA | 0.7175 |
| 2. PF | C3LQF1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.55e-14 | 3.42e-19 | NA | 0.7463 |
| 2. PF | A1A7K5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 9.68e-19 | NA | 0.7544 |
| 2. PF | Q0T847 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.03e-13 | 9.68e-19 | NA | 0.7568 |
| 2. PF | Q4WMU1 | S-methyl-5'-thioadenosine phosphorylase | 2.29e-06 | 2.83e-05 | NA | 0.6004 |
| 2. PF | F6V515 | S-methyl-5'-thioadenosine phosphorylase | 5.83e-10 | 7.33e-07 | NA | 0.6296 |
| 2. PF | P60217 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.06e-13 | 8.65e-20 | NA | 0.7632 |
| 2. PF | C4LAP0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.65e-14 | 1.11e-23 | NA | 0.6928 |
| 2. PF | Q57T48 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.65e-13 | 8.11e-20 | NA | 0.7543 |
| 2. PF | A6VPH1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.73e-14 | 1.42e-18 | NA | 0.7602 |
| 2. PF | A7GT52 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.02e-14 | 9.25e-21 | NA | 0.7479 |
| 2. PF | B1KI32 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.45e-14 | 1.07e-20 | NA | 0.733 |
| 2. PF | B5F8S1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.48e-13 | 3.26e-19 | NA | 0.7632 |
| 2. PF | P45113 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.10e-14 | 4.29e-20 | NA | 0.7438 |
| 2. PF | Q9V2F1 | S-methyl-5'-thioadenosine phosphorylase | 3.10e-10 | 3.55e-10 | NA | 0.6037 |
| 2. PF | A1JJQ6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.48e-13 | 1.09e-17 | NA | 0.732 |
| 2. PF | Q291H4 | S-methyl-5'-thioadenosine phosphorylase | 6.54e-10 | 1.21e-06 | NA | 0.6539 |
| 2. PF | C5D4X9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.99e-14 | 2.84e-18 | NA | 0.7407 |
| 2. PF | B4TK35 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.01e-13 | 3.06e-19 | NA | 0.7662 |
| 2. PF | Q7CKD4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.93e-14 | 2.48e-16 | NA | 0.7205 |
| 2. PF | A8ALC9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 1.20e-19 | NA | 0.7543 |
| 2. PF | P67657 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.19e-14 | 1.15e-14 | NA | 0.7491 |
| 2. PF | A9N0Q5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.20e-13 | 8.65e-20 | NA | 0.7666 |
| 2. PF | O28486 | Probable 6-oxopurine nucleoside phosphorylase | 1.19e-10 | 4.04e-15 | NA | 0.6109 |
| 2. PF | A6T4W3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.02e-13 | 1.58e-19 | NA | 0.7627 |
| 2. PF | A8FSA3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.12e-14 | 2.78e-22 | NA | 0.731 |
| 2. PF | B7HE08 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.39e-14 | 3.40e-21 | NA | 0.7567 |
| 2. PF | P46354 | Purine nucleoside phosphorylase 1 | 1.40e-10 | 2.90e-10 | NA | 0.6526 |
| 2. PF | Q3ILJ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.33e-14 | 6.53e-18 | NA | 0.7389 |
| 2. PF | P0A1F7 | Uridine phosphorylase | 1.11e-16 | 6.27e-36 | NA | 0.8005 |
| 2. PF | Q31DQ5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.08e-13 | 4.40e-22 | NA | 0.7147 |
| 2. PF | A7ZWA7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.08e-13 | 1.46e-18 | NA | 0.754 |
| 2. PF | B5YKP5 | Probable S-methyl-5'-thioinosine phosphorylase | 2.33e-09 | 4.43e-09 | NA | 0.6346 |
| 2. PF | Q8U4Q8 | S-methyl-5'-thioadenosine phosphorylase | 3.90e-10 | 7.34e-10 | NA | 0.5999 |
| 2. PF | C5BAP4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.48e-13 | 2.22e-20 | NA | 0.7765 |
| 2. PF | Q47UY5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.33e-14 | 1.70e-15 | NA | 0.7474 |
| 2. PF | A7EAA1 | S-methyl-5'-thioadenosine phosphorylase | 8.70e-10 | 7.77e-04 | NA | 0.6595 |
| 2. PF | Q4QL83 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.15e-14 | 8.11e-20 | NA | 0.7446 |
| 2. PF | A8G9V3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.64e-13 | 8.25e-18 | NA | 0.732 |
| 2. PF | Q9YAQ8 | S-methyl-5'-thioadenosine phosphorylase | 9.02e-11 | 9.95e-12 | NA | 0.625 |
| 2. PF | C1ESR9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.76e-14 | 1.74e-21 | NA | 0.7444 |
| 2. PF | B7VJ21 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.06e-14 | 5.63e-19 | NA | 0.7184 |
| 2. PF | A3N2T5 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.39e-13 | 6.63e-21 | NA | 0.7533 |
| 2. PF | B1JK17 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.49e-14 | 1.24e-17 | NA | 0.7351 |
| 2. PF | A0AIU3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.78e-14 | 9.23e-20 | NA | 0.715 |
| 2. PF | Q8ZTB2 | S-methyl-5'-thioadenosine phosphorylase | 9.67e-11 | 7.07e-10 | NA | 0.6783 |
| 2. PF | Q7Q9N9 | S-methyl-5'-thioadenosine phosphorylase | 4.76e-10 | 1.25e-04 | NA | 0.6253 |
| 2. PF | Q9KDD4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 3.70e-14 | 4.96e-22 | NA | 0.7447 |
| 2. PF | F6RQL9 | S-methyl-5'-thioadenosine phosphorylase | 2.80e-10 | 2.56e-07 | NA | 0.6178 |
| 2. PF | A1STE7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.76e-14 | 1.81e-22 | NA | 0.7418 |
| 2. PF | P46862 | Purine nucleoside phosphorylase | 6.91e-10 | 1.66e-08 | NA | 0.6611 |
| 2. PF | Q634H0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.03e-14 | 1.74e-21 | NA | 0.7559 |
| 2. PF | A0KZQ7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.42e-14 | 1.85e-19 | NA | 0.7271 |
| 2. PF | Q65GT9 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.06e-14 | 6.85e-21 | NA | 0.7328 |
| 2. PF | Q2RXH9 | S-methyl-5'-thioadenosine phosphorylase | 2.82e-10 | 3.51e-05 | NA | 0.5845 |
| 2. PF | A3D1T1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.71e-14 | 1.03e-19 | NA | 0.7187 |
| 2. PF | Q16MW6 | S-methyl-5'-thioadenosine phosphorylase | 4.71e-10 | 6.57e-06 | NA | 0.6314 |
| 2. PF | Q7MNT0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.30e-14 | 9.95e-18 | NA | 0.7281 |
| 2. PF | P96122 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.08e-12 | 8.50e-09 | NA | 0.7747 |
| 2. PF | Q3MHF7 | S-methyl-5'-thioadenosine phosphorylase | 7.11e-10 | 8.19e-07 | NA | 0.5968 |
| 2. PF | A8H191 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.71e-14 | 4.18e-22 | NA | 0.7321 |
| 2. PF | B7HQD2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 5.14e-14 | 1.74e-21 | NA | 0.7555 |
| 2. PF | Q9CP62 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 6.58e-14 | 7.62e-19 | NA | 0.7412 |
| 2. PF | C4ZRQ2 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.07e-13 | 9.68e-19 | NA | 0.754 |
| 2. PF | Q0PC20 | Aminodeoxyfutalosine nucleosidase | 7.77e-15 | 4.37e-21 | NA | 0.7649 |
| 2. PF | B5FJ06 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.40e-13 | 2.78e-19 | NA | 0.7629 |
| 2. PF | B1XD29 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.06e-13 | 9.68e-19 | NA | 0.757 |
| 2. PF | A0RIY7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 4.96e-14 | 1.74e-21 | NA | 0.7556 |
| 2. PF | Q2NVP7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.04e-13 | 5.85e-20 | NA | 0.7468 |
| 2. PF | Q87BR7 | Probable S-methyl-5'-thioinosine phosphorylase | 1.82e-10 | 1.76e-13 | NA | 0.6458 |
| 2. PF | Q5WHL7 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.03e-14 | 3.89e-19 | NA | 0.7208 |
| 2. PF | D5GFR0 | S-methyl-5'-thioadenosine phosphorylase | 4.07e-09 | 1.59e-04 | NA | 0.6086 |
| 2. PF | A9R1E0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 8.42e-14 | 2.48e-16 | NA | 0.7123 |
| 2. PF | Q8TQX8 | Probable S-methyl-5'-thioinosine phosphorylase | 3.91e-09 | 2.75e-09 | NA | 0.6265 |
| 2. PF | Q66EE6 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.99e-14 | 1.24e-17 | NA | 0.7363 |
| 2. PF | A0RVQ7 | S-methyl-5'-thioadenosine phosphorylase | 1.58e-10 | 4.09e-04 | NA | 0.5876 |
| 2. PF | P81989 | Purine nucleoside phosphorylase | 4.42e-07 | 8.60e-09 | NA | 0.5843 |
| 2. PF | Q8U2I1 | Probable 6-oxopurine nucleoside phosphorylase | 6.44e-10 | 8.19e-07 | NA | 0.635 |
| 2. PF | Q9ZMY2 | Aminodeoxyfutalosine nucleosidase | 6.44e-15 | 1.77e-21 | NA | 0.7798 |
| 2. PF | B5BL87 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.57e-13 | 8.65e-20 | NA | 0.7662 |
| 2. PF | A3QBQ0 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.19e-14 | 2.35e-21 | NA | 0.7267 |
| 2. PF | Q3J5E8 | S-methyl-5'-thioadenosine phosphorylase | 7.99e-10 | 7.27e-04 | NA | 0.6305 |
| 2. PF | Q5KPU2 | S-methyl-5'-thioadenosine phosphorylase | 4.89e-09 | 2.16e-03 | NA | 0.6505 |
| 4. PB | Q8I3X4 | Purine nucleoside phosphorylase | 0.00e+00 | 3.95e-40 | 4.03e-04 | NA |
| 4. PB | Q2FXX8 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.45e-14 | 1.12e-21 | 0.026 | NA |
| 4. PB | P0ABP8 | Purine nucleoside phosphorylase DeoD-type | 0.00e+00 | 4.26e-41 | 1.42e-28 | NA |
| 5. P | Q9V813 | S-methyl-5'-thioadenosine phosphorylase | 5.17e-10 | 1.33e-06 | NA | NA |
| 5. P | Q23588 | Uridine and thymidine phosphorylase | 4.41e-12 | 2.03e-15 | NA | NA |
| 5. P | Q7XA67 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 1.18e-12 | 3.98e-31 | NA | NA |
| 5. P | Q9UTG1 | Putative purine nucleoside phosphorylase | 1.32e-09 | 6.66e-05 | NA | NA |
| 5. P | P23492 | Purine nucleoside phosphorylase | 5.80e-10 | 2.26e-07 | NA | NA |
| 5. P | Q5AGW8 | Purine nucleoside permease | 1.04e-07 | 2.71e-07 | NA | NA |
| 5. P | P52624 | Uridine phosphorylase 1 | 3.78e-11 | 2.90e-12 | NA | NA |
| 5. P | Q8CGR7 | Uridine phosphorylase 2 | 4.45e-11 | 4.71e-09 | NA | NA |
| 5. P | Q7ZV22 | S-methyl-5'-thioadenosine phosphorylase | 6.26e-10 | 2.80e-07 | NA | NA |
| 5. P | P45563 | Purine nucleoside phosphorylase 2 | 1.72e-10 | 5.05e-10 | NA | NA |
| 5. P | P9WP01 | Purine nucleoside phosphorylase | 7.58e-10 | 6.37e-09 | NA | NA |
| 5. P | P00491 | Purine nucleoside phosphorylase | 5.78e-10 | 1.07e-06 | NA | NA |
| 5. P | Q07938 | S-methyl-5'-thioadenosine phosphorylase | 2.29e-06 | 2.34e-08 | NA | NA |
| 5. P | Q13126 | S-methyl-5'-thioadenosine phosphorylase | 2.95e-10 | 2.56e-07 | NA | NA |
| 5. P | Q60367 | Probable S-methyl-5'-thioinosine phosphorylase | 3.07e-09 | 3.97e-09 | NA | NA |
| 5. P | Q9CQ65 | S-methyl-5'-thioadenosine phosphorylase | 9.60e-10 | 1.71e-06 | NA | NA |
| 5. P | O74493 | Probable purine nucleoside permease C285.05 | 2.30e-08 | 5.72e-10 | NA | NA |
| 5. P | Q8IMU4 | Purine nucleoside phosphorylase | 2.67e-10 | 5.92e-09 | NA | NA |
| 5. P | P85973 | Purine nucleoside phosphorylase | 3.45e-10 | 1.43e-07 | NA | NA |
| 5. P | P12758 | Uridine phosphorylase | 1.11e-16 | 4.05e-35 | NA | NA |
| 5. P | Q9T0I8 | 5'-methylthioadenosine nucleosidase | 1.30e-12 | 5.13e-22 | NA | NA |
| 5. P | Q09816 | S-methyl-5'-thioadenosine phosphorylase | 1.57e-06 | 7.22e-05 | NA | NA |
| 5. P | O06401 | S-methyl-5'-thioadenosine phosphorylase | 7.59e-10 | 1.62e-08 | NA | NA |
| 5. P | P0AF12 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 9.77e-14 | 9.68e-19 | NA | NA |
| 5. P | Q16831 | Uridine phosphorylase 1 | 3.70e-11 | 1.20e-12 | NA | NA |
| 5. P | Q09438 | S-methyl-5'-thioadenosine phosphorylase | 1.04e-09 | 8.15e-04 | NA | NA |
| 5. P | Q5UR60 | Uncharacterized protein R802 | NA | 6.23e-37 | NA | NA |
| 5. P | O95045 | Uridine phosphorylase 2 | 5.14e-11 | 1.37e-07 | NA | NA |
| 5. P | P9WJM3 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 2.91e-14 | 1.15e-14 | NA | NA |
| 5. P | Q05788 | Purine nucleoside phosphorylase | 2.90e-09 | 4.82e-06 | NA | NA |
| 5. P | Q59ST1 | S-methyl-5'-thioadenosine phosphorylase | 2.16e-08 | 1.59e-07 | NA | NA |
| 6. F | C8VP37 | S-methyl-5'-thioadenosine phosphorylase | 9.81e-07 | NA | NA | 0.6297 |
| 6. F | B0K0D9 | Pyrrolidone-carboxylate peptidase | 2.39e-08 | NA | NA | 0.5115 |
| 6. F | Q9UYQ9 | Pyrrolidone-carboxylate peptidase | 3.65e-07 | NA | NA | 0.4941 |
| 6. F | B3W7M8 | Pyrrolidone-carboxylate peptidase | 1.91e-07 | NA | NA | 0.4723 |
| 6. F | B7IEE2 | Pyrrolidone-carboxylate peptidase | 1.55e-07 | NA | NA | 0.4942 |
| 6. F | Q2S4D2 | Peptidyl-tRNA hydrolase | 1.73e-06 | NA | NA | 0.5168 |
| 6. F | A4VS92 | Peptidyl-tRNA hydrolase | 7.63e-05 | NA | NA | 0.5062 |
| 6. F | Q1JP56 | Peptidyl-tRNA hydrolase | 1.30e-04 | NA | NA | 0.4677 |
| 6. F | O27633 | Probable S-methyl-5'-thioinosine phosphorylase | 5.76e-10 | NA | NA | 0.6321 |
| 6. F | A9KR32 | Peptidyl-tRNA hydrolase | 5.28e-05 | NA | NA | 0.4889 |
| 6. F | Q88Z39 | Peptidyl-tRNA hydrolase | 7.55e-05 | NA | NA | 0.4626 |
| 6. F | Q1J7Y1 | Pyrrolidone-carboxylate peptidase | 9.56e-08 | NA | NA | 0.4482 |
| 6. F | P0DC94 | Pyrrolidone-carboxylate peptidase | 1.02e-07 | NA | NA | 0.4395 |
| 6. F | A6LL24 | Pyrrolidone-carboxylate peptidase | 1.39e-06 | NA | NA | 0.4788 |
| 6. F | P55519 | Uncharacterized protein y4jS | 9.01e-10 | NA | NA | 0.6559 |
| 6. F | C0M9G4 | Peptidyl-tRNA hydrolase | 8.66e-05 | NA | NA | 0.4738 |
| 6. F | Q0TMG7 | Peptidyl-tRNA hydrolase | 4.17e-05 | NA | NA | 0.5105 |
| 6. F | Q8P243 | Pyrrolidone-carboxylate peptidase | 1.02e-07 | NA | NA | 0.4364 |
| 6. F | Q1JI40 | Pyrrolidone-carboxylate peptidase | 7.46e-08 | NA | NA | 0.4633 |
| 6. F | P27711 | Fibril protein | 5.81e-08 | NA | NA | 0.6944 |
| 6. F | Q1JD20 | Pyrrolidone-carboxylate peptidase | 1.04e-07 | NA | NA | 0.4453 |
| 6. F | Q1JMZ5 | Pyrrolidone-carboxylate peptidase | 1.17e-07 | NA | NA | 0.4632 |
| 6. F | Q48UT7 | Pyrrolidone-carboxylate peptidase | 9.35e-08 | NA | NA | 0.4405 |
| 6. F | P0AE13 | AMP nucleosidase | 2.48e-09 | NA | NA | 0.7388 |
| 6. F | Q1JEA1 | Peptidyl-tRNA hydrolase | 1.31e-04 | NA | NA | 0.4898 |
| 6. F | A4Q998 | Purine nucleoside phosphorylase | 7.67e-09 | NA | NA | 0.5839 |
| 6. F | Q1JJA3 | Peptidyl-tRNA hydrolase | 1.25e-04 | NA | NA | 0.4677 |
| 6. F | B5XIP6 | Peptidyl-tRNA hydrolase | 1.27e-04 | NA | NA | 0.492 |
| 6. F | P68896 | Pyrrolidone-carboxylate peptidase | 9.75e-08 | NA | NA | 0.4722 |
| 6. F | Q8E2I1 | Peptidyl-tRNA hydrolase | 1.28e-04 | NA | NA | 0.4182 |
| 6. F | Q1INC3 | S-methyl-5'-thioadenosine phosphorylase | 2.48e-10 | NA | NA | 0.6121 |
| 6. F | A6LPJ5 | Peptidyl-tRNA hydrolase | 7.44e-05 | NA | NA | 0.5043 |
| 6. F | Q2JNF7 | Peptidyl-tRNA hydrolase | 3.11e-04 | NA | NA | 0.4214 |
| 6. F | Q3K419 | Peptidyl-tRNA hydrolase | 1.24e-04 | NA | NA | 0.4641 |
| 6. F | Q8E7Y8 | Peptidyl-tRNA hydrolase | 1.36e-04 | NA | NA | 0.4758 |
| 6. F | Q03CK3 | Pyrrolidone-carboxylate peptidase | 1.52e-07 | NA | NA | 0.4721 |
| 6. F | B9DSP2 | Peptidyl-tRNA hydrolase | 1.27e-04 | NA | NA | 0.4569 |
| 6. F | A8B006 | Peptidyl-tRNA hydrolase | 1.11e-04 | NA | NA | 0.4529 |
| 6. F | A8P7Y3 | S-methyl-5'-thioadenosine phosphorylase | 1.48e-08 | NA | NA | 0.64 |
| 6. F | Q186N3 | Pyrrolidone-carboxylate peptidase | 4.00e-08 | NA | NA | 0.5077 |
| 6. F | Q5XDD4 | Pyrrolidone-carboxylate peptidase | 1.01e-07 | NA | NA | 0.4412 |
| 6. F | Q8XHJ8 | Peptidyl-tRNA hydrolase | 4.17e-05 | NA | NA | 0.5105 |
| 6. F | P0DC95 | Pyrrolidone-carboxylate peptidase | 9.76e-08 | NA | NA | 0.4642 |
| 6. F | O87765 | Pyrrolidone-carboxylate peptidase | 1.18e-07 | NA | NA | 0.4472 |
| 6. F | Q48VW8 | Peptidyl-tRNA hydrolase | 1.30e-04 | NA | NA | 0.4673 |
| 6. F | Q0U796 | S-methyl-5'-thioadenosine phosphorylase | 3.33e-05 | NA | NA | 0.5668 |
| 6. F | A2RFZ5 | Pyrrolidone-carboxylate peptidase | 7.71e-08 | NA | NA | 0.4631 |
| 6. F | Q97NG9 | Pyrrolidone-carboxylate peptidase 2 | 7.48e-08 | NA | NA | 0.4358 |
| 6. F | Q7NHW1 | S-methyl-5'-thioadenosine phosphorylase | 2.65e-10 | NA | NA | 0.6457 |
| 6. F | Q9A206 | Peptidyl-tRNA hydrolase | 1.33e-04 | NA | NA | 0.4866 |