Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54948.1
JCVISYN3A_0771
Ribonucleotide-diphosphate reductase subunit alpha.
M. mycoides homolog: Q6MSC5.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 59
Unique PROST Go: 22
Unique BLAST Go: 4
Unique Foldseek Go: 0
Total Homologs: 148
Unique PROST Homologs: 54
Unique BLAST Homologs: 4
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
O54196
(Vitamin B12-dependent ribonucleotide reductase) with a FATCAT P-Value: 0 and RMSD of 3.04 angstrom. The sequence alignment identity is 17.9%.
Structural alignment shown in left. Query protein AVX54948.1 colored as red in alignment, homolog O54196 colored as blue.
Query protein AVX54948.1 is also shown in right top, homolog O54196 showed in right bottom. They are colored based on secondary structures.
AVX54948.1 MKENKNTIVLDDVDDEYIKLNARSKIFSKDQDNFQLDVKAAELYLKNYIE----P----RMK--KFS-SLK-ERLDYLLENKY-YDSEILNKY-SFDQI- 85 O54196 -----------------------------------------------MTETTSGPARGSRTKGTKATKGLRIERV-HTTPGVHPYD-EVV--WERRDVVM 49 AVX54948.1 SQLNDYAYSFNHH---FPSF--MGAL-----KFF-NAYGLKTFDTTMYLETYTDRVLMNALFLGNGN----FTK-----------AKNLLKDMMLGRFQP 159 O54196 TNWRDGSVNFEQRGVEFPDFWSVNAVNIVTSKYFRGAVGTPQRETG--LKQLIDRIV--KTYRKAGEEYKYFASPADAEIFEHELAYALLHQIF--SFN- 142 AVX54948.1 ATPTFLNAAKKHRGEYVS-CYLLRTEDNMESICRTISTSLQLSK------RGG-GVAICLTNLRETGSPIKNISGLSSGPIPVMKILEDSF-TYADQLG- 249 O54196 -SPVWFNVGTP-QPQQVSACFILSVDDSMESI-------LDWYKEEGMIFKGGSGAGLNLSRIR-SSKELLSSGGNASGPVSFMRGADASAGTIKS--GG 230 AVX54948.1 -QRQGAGAVYISAHHPDIISVLDTK-RENADEKIRIKSL-SLGLVIPDITFELARDNKDMALFSPYDVQKVYNKPLSDISITEKYYEMLENPN---IKK- 342 O54196 ATRRAAKMVILDVDHPDIEGFIETKVKE--EEKIR--ALRDAGF---D--MDLGGD--DIT-----SVQ--YQNANNSVRVNDEFMRAVESGSAFGLRAR 312 AVX54948.1 -T-----YISARKFFLTVAELHFESGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYSSDLSFVKTGEDICCNLGSLNIDKMMKS---GKE 433 O54196 MTGEIIEQVDAKALFRKMAQAAWACADPGIQYDDTINRWHTCPESGRINGSNPCSEYMHL--------D----NTS----CNLASLNLMKFLTDDGEGNQ 396 AVX54948.1 FSDSIYNAISALDIVSRNSDLSAA----PSIQK-G-NAQN-HAVGLGAMNLHGFL--ATNKIMYDSP--EAV--DFTNMFFYTVAYNAFKASNKLAQ--- 517 O54196 SFD-VERFAKVVELVITAMDISICFADFPT-QKIGENTRAFRQLGIGYANL-GALLMATGH-AYDSDGGRAIAGAISSLMTGT-SY---RRSAELAAVVG 488 AVX54948.1 EFEKFAS----FDE--SRFADGSWFDKYTKCEFDKWTPQTNRVKELFKDYDVQI-PSQTD-W---IQLVEEIKKTGLANSHLMAVAPTGSISYLSSC-TP 605 O54196 PYDGYARNAAPHNQVMRQHADAN--D--TAVRMD--------------DLDTPIWAAATETWQDVLRLGE---KNGFRNAQASVIAPTGTIGLAMSCDTT 567 AVX54948.1 SLQPVVSTVEVRK---EGKL----G-------RV-YVPAYQI-----------N-FDNMG----YY-----AMGAYELGADPIINIVAAAQQHVDQAISL 669 O54196 GLEPDLALVKFKKLVGGGSMQIVNGTVPQALRRLGY-QAEQIEAIVEHIAEHGNVLDAPGLKTEHYKVFDCAMGERSISAMGHVRMMAAIQPWISGALSK 666 AVX54948.1 TLFMTDKATTRDLNRAYVNAFKQGCS--SIYYVRIRQDVLENSENYECDACKI----------------------------------------------- 720 O54196 TVNMPESATVEEVEEIYFEAWKMGVKALAIY--R---D---N--------CKVGQPLSAKTKEKEQDGIAEKTEDTIRAAVEKVIEYRPVRKRLPKGRPG 750 AVX54948.1 ---------------------------------------------------------------------------------------------------- 720 O54196 ITTSFTVGGAEGYMTANSYPDDGLGEVFLKMSKQGSTLAGMMDAFSIAVSVGLQYGVPLETYVSKFTNMRFEPAGMTDDPDVRMAQSIVDNIFRRLALDF 850 AVX54948.1 ---------------------------------------------------------------------------------------------------- 720 O54196 LPFETRSALGIHSAEERQRHLDTGSYEQVIEEDELDVEGLAQSAPRQQIPAVPAAPAEIPAPKQAHTSAELVEMQLGISADAPLCFSCGTKMQRAGSCYI 950 AVX54948.1 ----------- 720 O54196 CEGCGSTSGCS 961
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006260 | DNA replication |
| 1. PBF | GO:0005971 | ribonucleoside-diphosphate reductase complex |
| 1. PBF | GO:0004748 | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor |
| 1. PBF | GO:0009263 | deoxyribonucleotide biosynthetic process |
| 1. PBF | GO:0016539 | intein-mediated protein splicing |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0071897 | DNA biosynthetic process |
| 1. PBF | GO:0031419 | cobalamin binding |
| 1. PBF | GO:0000166 | nucleotide binding |
| 2. PF | GO:0008998 | ribonucleoside-triphosphate reductase activity |
| 3. BF | GO:0050897 | cobalt ion binding |
| 3. BF | GO:0004519 | endonuclease activity |
| 4. PB | GO:0051290 | protein heterotetramerization |
| 4. PB | GO:0006206 | pyrimidine nucleobase metabolic process |
| 4. PB | GO:0042246 | tissue regeneration |
| 4. PB | GO:0061731 | ribonucleoside-diphosphate reductase activity |
| 4. PB | GO:0031288 | sorocarp morphogenesis |
| 4. PB | GO:0016032 | viral process |
| 4. PB | GO:0042995 | cell projection |
| 4. PB | GO:0008584 | male gonad development |
| 4. PB | GO:0009202 | deoxyribonucleoside triphosphate biosynthetic process |
| 4. PB | GO:0021846 | cell proliferation in forebrain |
| 4. PB | GO:0015949 | nucleobase-containing small molecule interconversion |
| 4. PB | GO:0060041 | retina development in camera-type eye |
| 4. PB | GO:0043457 | regulation of cellular respiration |
| 4. PB | GO:0019046 | release from viral latency |
| 4. PB | GO:0051063 | CDP reductase activity |
| 4. PB | GO:0097718 | disordered domain specific binding |
| 4. PB | GO:0017076 | purine nucleotide binding |
| 4. PB | GO:0000278 | mitotic cell cycle |
| 4. PB | GO:0010212 | response to ionizing radiation |
| 4. PB | GO:0006240 | dCDP biosynthetic process |
| 4. PB | GO:0046704 | CDP metabolic process |
| 5. P | GO:0018805 | benzylsuccinate synthase activity |
| 5. P | GO:0043722 | 4-hydroxyphenylacetate decarboxylase activity |
| 5. P | GO:0033265 | choline binding |
| 5. P | GO:0016829 | lyase activity |
| 5. P | GO:0042203 | toluene catabolic process |
| 5. P | GO:0030430 | host cell cytoplasm |
| 5. P | GO:0070689 | L-threonine catabolic process to propionate |
| 5. P | GO:0042426 | choline catabolic process |
| 5. P | GO:0043875 | 2-ketobutyrate formate-lyase activity |
| 5. P | GO:0006567 | threonine catabolic process |
| 5. P | GO:0019492 | proline salvage |
| 5. P | GO:0009142 | nucleoside triphosphate biosynthetic process |
| 5. P | GO:0051065 | CTP reductase activity |
| 5. P | GO:0032564 | dATP binding |
| 5. P | GO:0009265 | 2'-deoxyribonucleotide biosynthetic process |
| 5. P | GO:0006006 | glucose metabolic process |
| 5. P | GO:0031250 | anaerobic ribonucleoside-triphosphate reductase complex |
| 5. P | GO:0016840 | carbon-nitrogen lyase activity |
| 5. P | GO:0032556 | pyrimidine deoxyribonucleotide binding |
| 5. P | GO:0008861 | formate C-acetyltransferase activity |
| 5. P | GO:0046306 | alkanesulfonate catabolic process |
| 5. P | GO:0032567 | dGTP binding |
| 7. B | GO:0005737 | cytoplasm |
| 7. B | GO:0010804 | negative regulation of tumor necrosis factor-mediated signaling pathway |
| 7. B | GO:0039650 | suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process |
| 7. B | GO:0005635 | nuclear envelope |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0004748 | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor |
| GO:0016491 | oxidoreductase activity |
| GO:0006260 | DNA replication |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q9HI70 | Vitamin B12-dependent ribonucleoside-diphosphate reductase | 4.21e-13 | 3.83e-19 | 4.70e-28 | 0.6548 |
| 1. PBF | Q8K9W3 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 7.51e-39 | 9.61e-45 | 0.8321 |
| 1. PBF | P0CG99 | Ribonucleoside-diphosphate reductase subunit alpha 1 | 0.00e+00 | 9.95e-62 | 0.0 | 0.9607 |
| 1. PBF | P50648 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 1.88e-31 | 7.30e-48 | 0.7715 |
| 1. PBF | P78027 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 2.29e-80 | 0.0 | 0.9572 |
| 1. PBF | P37426 | Ribonucleoside-diphosphate reductase 1 subunit alpha | 0.00e+00 | 5.43e-36 | 9.80e-44 | 0.8246 |
| 1. PBF | Q9CBQ0 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 6.24e-66 | 0.0 | 0.957 |
| 1. PBF | O31875 | Ribonucleoside-diphosphate reductase NrdEB subunit alpha | 0.00e+00 | 1.16e-02 | 3.34e-109 | 0.9224 |
| 1. PBF | Q9ZLF9 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 4.02e-40 | 1.34e-63 | 0.8361 |
| 1. PBF | P0A5W9 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.07e-60 | 0.0 | 0.9535 |
| 1. PBF | P43754 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 8.98e-38 | 2.40e-43 | 0.8282 |
| 1. PBF | Q89AS4 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 4.01e-37 | 1.51e-40 | 0.8348 |
| 1. PBF | O61065 | Ribonucleoside-diphosphate reductase large chain | 0.00e+00 | 3.41e-28 | 6.68e-48 | 0.7432 |
| 1. PBF | Q9PL93 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 3.63e-02 | 1.34e-56 | 0.7804 |
| 1. PBF | O84834 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.18e-03 | 2.42e-58 | 0.7758 |
| 1. PBF | Q5R919 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 6.20e-26 | 2.57e-46 | 0.7475 |
| 1. PBF | Q9UW15 | Ribonucleoside-diphosphate reductase large chain | 0.00e+00 | 2.77e-05 | 3.42e-48 | 0.7839 |
| 1. PBF | P47473 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.83e-75 | 0.0 | 0.9594 |
| 1. PBF | O66503 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 2.81e-33 | 1.44e-75 | 0.8263 |
| 1. PBF | Q08698 | Ribonucleoside-diphosphate reductase 2 subunit alpha | 0.00e+00 | 3.14e-69 | 0.0 | 0.9489 |
| 1. PBF | P9WH76 | Vitamin B12-dependent ribonucleoside-diphosphate reductase | 2.22e-15 | 3.78e-20 | 4.09e-36 | 0.6847 |
| 1. PBF | P9WH74 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.07e-60 | 0.0 | 0.9542 |
| 1. PBF | O15909 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 7.89e-22 | 2.26e-49 | 0.7897 |
| 1. PBF | Q8SR37 | Ribonucleoside-diphosphate reductase large chain | 0.00e+00 | 6.86e-38 | 5.12e-47 | 0.7841 |
| 1. PBF | P74240 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 9.85e-28 | 2.90e-56 | 0.8385 |
| 1. PBF | P50647 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 8.20e-34 | 1.93e-41 | 0.7568 |
| 1. PBF | Q6MNP6 | Vitamin B12-dependent ribonucleotide reductase | 0.00e+00 | 1.46e-21 | 2.40e-13 | 0.6666 |
| 1. PBF | P57276 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 2.05e-39 | 6.92e-40 | 0.8349 |
| 1. PBF | P0CH00 | Ribonucleoside-diphosphate reductase subunit alpha 2 | 0.00e+00 | 9.95e-62 | 0.0 | 0.9602 |
| 1. PBF | P55982 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.33e-39 | 8.80e-64 | 0.8345 |
| 1. PBF | O83972 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 6.02e-09 | 4.76e-63 | 0.8681 |
| 1. PBF | O54196 | Vitamin B12-dependent ribonucleotide reductase | 0.00e+00 | 2.48e-02 | 1.78e-21 | 0.7253 |
| 1. PBF | P50620 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 2.16e-65 | 0.0 | 0.9576 |
| 2. PF | Q1G7W2 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.79e-07 | 1.94e-26 | NA | 0.4964 |
| 2. PF | Q04CQ7 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 1.15e-08 | 2.17e-26 | NA | 0.4988 |
| 2. PF | Q59490 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 3.51e-07 | 5.44e-27 | NA | 0.492 |
| 3. BF | Q72S00 | Vitamin B12-dependent ribonucleotide reductase | 2.21e-10 | NA | 5.41e-04 | 0.628 |
| 3. BF | O69981 | Vitamin B12-dependent ribonucleotide reductase | 0.00e+00 | NA | 2.77e-21 | 0.7117 |
| 3. BF | Q82KE2 | Vitamin B12-dependent ribonucleotide reductase | 0.00e+00 | NA | 1.31e-21 | 0.7094 |
| 3. BF | Q89MB9 | Vitamin B12-dependent ribonucleotide reductase | 8.86e-08 | NA | 1.08e-05 | 0.6263 |
| 3. BF | Q8UEM4 | Vitamin B12-dependent ribonucleotide reductase | 1.23e-08 | NA | 9.92e-10 | 0.6293 |
| 3. BF | Q8F3P1 | Vitamin B12-dependent ribonucleotide reductase | 2.37e-10 | NA | 4.89e-04 | 0.6436 |
| 3. BF | Q7UI46 | Vitamin B12-dependent ribonucleotide reductase | 1.34e-13 | NA | 8.93e-20 | 0.6877 |
| 3. BF | Q9Z6S5 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | NA | 1.43e-64 | 0.7755 |
| 3. BF | E7FHX6 | Vitamin B12-dependent ribonucleoside-diphosphate reductase | 6.35e-03 | NA | 6.83e-11 | 0.506 |
| 4. PB | Q54Q71 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 1.33e-20 | 4.70e-44 | NA |
| 4. PB | P36602 | Ribonucleoside-diphosphate reductase large chain | 0.00e+00 | 7.78e-23 | 8.47e-48 | NA |
| 4. PB | O36411 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.42e-39 | 2.84e-11 | NA |
| 4. PB | P9WH75 | Ribonucleoside-diphosphate reductase subunit alpha | 0.00e+00 | 1.07e-60 | 0.0 | NA |
| 4. PB | P0C8H9 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.74e-45 | 3.93e-28 | NA |
| 4. PB | Q2HR67 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.64e-34 | 2.27e-14 | NA |
| 4. PB | P21524 | Ribonucleoside-diphosphate reductase large chain 1 | 0.00e+00 | 6.52e-15 | 1.06e-48 | NA |
| 4. PB | P50646 | Ribonucleoside-diphosphate reductase large subunit | NA | 6.54e-32 | 2.53e-22 | NA |
| 4. PB | Q66663 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.69e-36 | 7.75e-14 | NA |
| 4. PB | O64173 | Ribonucleoside-diphosphate reductase nrdEB subunit alpha | NA | 1.16e-02 | 3.34e-109 | NA |
| 4. PB | Q76RD8 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.93e-33 | 3.66e-49 | NA |
| 4. PB | Q6GZT8 | Putative ribonucleoside-diphosphate reductase large subunit | NA | 1.64e-17 | 1.80e-20 | NA |
| 4. PB | P39452 | Ribonucleoside-diphosphate reductase 2 subunit alpha | 0.00e+00 | 3.47e-70 | 0.0 | NA |
| 4. PB | P50643 | Ribonucleoside-diphosphate reductase large subunit | NA | 5.45e-14 | 1.37e-21 | NA |
| 4. PB | P00452 | Ribonucleoside-diphosphate reductase 1 subunit alpha | 0.00e+00 | 1.42e-36 | 1.01e-42 | NA |
| 4. PB | P50642 | Ribonucleoside-diphosphate reductase large subunit | NA | 5.95e-34 | 4.86e-26 | NA |
| 4. PB | P0C702 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.07e-29 | 3.30e-17 | NA |
| 4. PB | P20503 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.93e-33 | 3.66e-49 | NA |
| 4. PB | P09248 | Ribonucleoside-diphosphate reductase large subunit | NA | 4.78e-41 | 3.35e-20 | NA |
| 4. PB | P26685 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.44e-44 | 1.31e-28 | NA |
| 4. PB | Q7T6Y8 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.70e-25 | 1.73e-50 | NA |
| 4. PB | Q3KSU5 | Ribonucleoside-diphosphate reductase large subunit | NA | 8.91e-30 | 3.02e-17 | NA |
| 4. PB | Q6R7H4 | Ribonucleoside-diphosphate reductase large subunit | NA | 7.86e-34 | 1.58e-38 | NA |
| 4. PB | P0C8H7 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.09e-45 | 6.62e-28 | NA |
| 4. PB | P0DSV2 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.78e-32 | 4.40e-48 | NA |
| 4. PB | Q03604 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 1.84e-29 | 4.60e-45 | NA |
| 4. PB | P79732 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 1.15e-27 | 7.96e-46 | NA |
| 4. PB | Q77MS1 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.25e-23 | 8.10e-25 | NA |
| 4. PB | Q01037 | Ribonucleoside-diphosphate reductase large subunit | NA | 3.50e-40 | 1.31e-16 | NA |
| 4. PB | P28846 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.00e-31 | 3.64e-23 | NA |
| 4. PB | P03190 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.07e-29 | 3.30e-17 | NA |
| 4. PB | P9WH77 | Vitamin B12-dependent ribonucleoside-diphosphate reductase | 5.66e-15 | 2.24e-19 | 4.10e-36 | NA |
| 4. PB | P21672 | Ribonucleoside-diphosphate reductase large chain 2 | 0.00e+00 | 1.07e-19 | 5.29e-47 | NA |
| 4. PB | P12848 | Ribonucleoside-diphosphate reductase large subunit | NA | 3.58e-32 | 3.11e-49 | NA |
| 4. PB | Q9SJ20 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 3.56e-27 | 1.63e-46 | NA |
| 4. PB | Q196Z5 | Ribonucleoside-diphosphate reductase large subunit | NA | 1.10e-21 | 1.05e-10 | NA |
| 4. PB | Q6UDJ2 | Ribonucleoside-diphosphate reductase large subunit | NA | 4.66e-27 | 4.09e-27 | NA |
| 4. PB | P0C8H8 | Ribonucleoside-diphosphate reductase large subunit | NA | 3.19e-45 | 1.13e-28 | NA |
| 4. PB | P42491 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.50e-45 | 2.62e-28 | NA |
| 4. PB | P32282 | Ribonucleoside-diphosphate reductase subunit alpha | NA | 1.55e-38 | 3.46e-31 | NA |
| 4. PB | P07742 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 6.94e-26 | 2.58e-49 | NA |
| 4. PB | Q4JQV6 | Ribonucleoside-diphosphate reductase large subunit | NA | 4.78e-41 | 3.35e-20 | NA |
| 4. PB | P23921 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 4.32e-26 | 5.68e-47 | NA |
| 4. PB | P0DSV1 | Ribonucleoside-diphosphate reductase large subunit | NA | 2.78e-32 | 4.40e-48 | NA |
| 4. PB | P48591 | Ribonucleoside-diphosphate reductase large subunit | 0.00e+00 | 5.32e-26 | 4.41e-47 | NA |
| 5. P | Q9L646 | Anaerobic ribonucleoside-triphosphate reductase | 1.72e-04 | 1.50e-07 | NA | NA |
| 5. P | Q03PB4 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.45e-06 | 3.45e-25 | NA | NA |
| 5. P | P43753 | Formate acetyltransferase | 6.06e-03 | 6.18e-09 | NA | NA |
| 5. P | P43752 | Anaerobic ribonucleoside-triphosphate reductase | 2.07e-04 | 8.28e-11 | NA | NA |
| 5. P | P44744 | Uncharacterized protein HI_0521 | 2.67e-04 | 4.49e-07 | NA | NA |
| 5. P | Q2PDF6 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.14e-06 | 9.92e-21 | NA | NA |
| 5. P | P52343 | Ribonucleoside-diphosphate reductase large subunit-like protein | NA | 8.28e-20 | NA | NA |
| 5. P | P07071 | Anaerobic ribonucleoside-triphosphate reductase | NA | 2.09e-06 | NA | NA |
| 5. P | Q05262 | Putative adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | NA | 1.81e-24 | NA | NA |
| 5. P | O87943 | Benzylsuccinate synthase alpha subunit | 8.76e-03 | 4.73e-04 | NA | NA |
| 5. P | C9XIS5 | 4-hydroxyphenylacetate decarboxylase glycyl radical subunit | 1.54e-02 | 2.67e-04 | NA | NA |
| 5. P | Q8CTX6 | Formate acetyltransferase | 2.93e-03 | 1.08e-08 | NA | NA |
| 5. P | Q7A1W9 | Formate acetyltransferase | 6.11e-03 | 3.67e-08 | NA | NA |
| 5. P | Q99WZ7 | Formate acetyltransferase | 5.20e-03 | 3.67e-08 | NA | NA |
| 5. P | P42632 | PFL-like enzyme TdcE | 1.10e-02 | 8.46e-08 | NA | NA |
| 5. P | Q6GCQ0 | Formate acetyltransferase | 5.91e-03 | 3.67e-08 | NA | NA |
| 5. P | Q312S2 | Isethionate sulfite-lyase | 3.78e-03 | 3.24e-06 | NA | NA |
| 5. P | Q5HKH9 | Formate acetyltransferase | 2.89e-03 | 9.94e-09 | NA | NA |
| 5. P | O32797 | Formate acetyltransferase | 6.52e-03 | 1.39e-10 | NA | NA |
| 5. P | A0A031WDE4 | Trans-4-hydroxy-L-proline dehydratase | 1.55e-03 | 3.66e-06 | NA | NA |
| 5. P | A8YW74 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 5.13e-07 | 6.69e-26 | NA | NA |
| 5. P | P28903 | Anaerobic ribonucleoside-triphosphate reductase | 4.80e-04 | 3.87e-09 | NA | NA |
| 5. P | Q727N1 | Isethionate sulfite-lyase | 4.18e-03 | 7.50e-05 | NA | NA |
| 5. P | P16782 | Ribonucleoside-diphosphate reductase large subunit-like protein | NA | 1.15e-02 | NA | NA |
| 5. P | Q6GK90 | Formate acetyltransferase | 6.04e-03 | 3.67e-08 | NA | NA |
| 5. P | Q6SW87 | Ribonucleoside-diphosphate reductase large subunit-like protein | NA | 1.31e-02 | NA | NA |
| 5. P | Q2FK44 | Formate acetyltransferase | 6.66e-03 | 3.67e-08 | NA | NA |
| 5. P | O32799 | Formate acetyltransferase | 6.50e-03 | 2.37e-10 | NA | NA |
| 5. P | P32674 | Probable dehydratase PflD | 9.73e-03 | 7.09e-09 | NA | NA |
| 5. P | O64240 | Putative adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | NA | 1.25e-24 | NA | NA |
| 5. P | Q041L3 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.16e-07 | 7.78e-26 | NA | NA |
| 5. P | Q9QJ39 | Ribonucleoside-diphosphate reductase large subunit-like protein | NA | 1.04e-20 | NA | NA |
| 5. P | Q18CP5 | 4-hydroxyphenylacetate decarboxylase glycyl radical subunit | 1.44e-02 | 2.53e-04 | NA | NA |
| 5. P | Q54CW7 | Probable adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.71e-07 | 1.47e-10 | NA | NA |
| 5. P | B8J0R1 | Isethionate sulfite-lyase | 1.05e-02 | 3.99e-04 | NA | NA |
| 5. P | Q59934 | Formate acetyltransferase | 3.92e-03 | 1.20e-08 | NA | NA |
| 5. P | P75793 | Probable dehydratase YbiW | 1.36e-02 | 7.83e-07 | NA | NA |
| 5. P | E5Y378 | Isethionate sulfite-lyase | 1.01e-02 | 4.46e-04 | NA | NA |
| 5. P | P37342 | Uncharacterized protein YjjI | 8.58e-05 | 1.53e-05 | NA | NA |
| 5. P | Q5FMX8 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 1.39e-06 | 1.32e-24 | NA | NA |
| 5. P | Q2YV53 | Formate acetyltransferase | 5.20e-03 | 3.67e-08 | NA | NA |
| 5. P | Q035U1 | Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 1.29e-06 | 1.13e-22 | NA | NA |
| 5. P | Q7A7X6 | Formate acetyltransferase | 6.32e-03 | 3.67e-08 | NA | NA |
| 5. P | P09373 | Formate acetyltransferase 1 | 1.17e-02 | 1.05e-07 | NA | NA |
| 5. P | P50641 | Ribonucleoside-diphosphate reductase large subunit-like protein | NA | 2.93e-17 | NA | NA |
| 5. P | Q30W70 | Choline trimethylamine-lyase | 3.63e-03 | 4.15e-02 | NA | NA |
| 5. P | Q38HX4 | 4-hydroxyphenylacetate decarboxylase glycyl radical subunit | 9.19e-03 | 2.29e-03 | NA | NA |
| 5. P | A6Q367 | Probable adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | 2.00e-08 | 2.39e-28 | NA | NA |
| 5. P | Q5HJF4 | Formate acetyltransferase | 5.89e-03 | 3.67e-08 | NA | NA |
| 5. P | C9YHW1 | 4-hydroxyphenylacetate decarboxylase glycyl radical subunit | 9.46e-03 | 2.67e-04 | NA | NA |
| 5. P | Q857H2 | Putative adenosylcobalamin-dependent ribonucleoside-triphosphate reductase | NA | 4.72e-22 | NA | NA |
| 5. P | Q2G1D8 | Formate acetyltransferase | 6.38e-03 | 3.67e-08 | NA | NA |
| 5. P | Q46266 | Formate acetyltransferase | 2.90e-03 | 2.78e-10 | NA | NA |
| 5. P | Q84F16 | 4-hydroxyphenylacetate decarboxylase glycyl radical subunit | 1.24e-02 | 2.98e-04 | NA | NA |
| 7. B | P89462 | Ribonucleoside-diphosphate reductase large subunit | NA | NA | 2.14e-27 | NA |
| 7. B | P09853 | Ribonucleoside-diphosphate reductase large subunit | NA | NA | 2.20e-26 | NA |
| 7. B | O55716 | Ribonucleoside-diphosphate reductase large subunit | NA | NA | 1.87e-12 | NA |
| 7. B | P08543 | Ribonucleoside-diphosphate reductase large subunit | NA | NA | 1.54e-25 | NA |