Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54949.1
JCVISYN3A_0772

Ribonucleotide reductase assembly protein.
M. mycoides homolog: Q6MSC4.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 15
Unique PROST Go: 11
Unique BLAST Go: 0
Unique Foldseek Go: 1

Total Homologs: 298
Unique PROST Homologs: 135
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 1

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: nrdI; Ribonucleotide reductase Class Ib, NrdI
Zhang et al. [4]: GO:0010181|FMN binding
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B5XVD7 (Protein NrdI) with a FATCAT P-Value: 0 and RMSD of 1.15 angstrom. The sequence alignment identity is 40.0%.
Structural alignment shown in left. Query protein AVX54949.1 colored as red in alignment, homolog B5XVD7 colored as blue. Query protein AVX54949.1 is also shown in right top, homolog B5XVD7 showed in right bottom. They are colored based on secondary structures.

  AVX54949.1 MHSNVKKVTDKDVIKPVGIPFVVYFSSISNNTHRFIQKLEIENIRIPYELDQS--ISVNRDYVLVTPTYSGGGEYVEGAVPKQVIKFLNNKENRSFCRGV 98
      B5XVD7 ------------------MSLIVYFSSRSENTHRFVQRLGLPAVRIP--LNEREHLQVDEPYILIVPSYGGGG--TAGAVPRQAICFLNDVHNRQLIRGV 78

  AVX54949.1 ISSGNTNFGDTFGIAGPIISKKLNVPFLYQFELLGTQYDVSQIKQILLKFWE-DGNNERK 157
      B5XVD7 IAAGNRNFGDAWGRAGEVIAQKCAVPYLYRFELMGTPDDIDNVRKGVSEFWQRQPQNV-- 136

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0010181 FMN binding
1. PBF GO:0006464 cellular protein modification process
1. PBF GO:0071281 cellular response to iron ion
5. P GO:0009399 nitrogen fixation
5. P GO:0010106 cellular response to iron ion starvation
5. P GO:0000906 6,7-dimethyl-8-ribityllumazine synthase activity
5. P GO:0019553 glutamate catabolic process via L-citramalate
5. P GO:0005737 cytoplasm
5. P GO:0019670 anaerobic glutamate catabolic process
5. P GO:0009349 riboflavin synthase complex
5. P GO:0009055 electron transfer activity
5. P GO:0009231 riboflavin biosynthetic process
5. P GO:0031419 cobalamin binding
5. P GO:0050097 methylaspartate mutase activity
6. F GO:0004783 sulfite reductase (NADPH) activity

Uniprot GO Annotations

GO Description
GO:0010181 FMN binding
GO:0036211 protein modification process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q1BB09 Protein NrdI 0.00e+00 2.17e-17 1.99e-41 0.8677
1. PBF A8A3F6 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9707
1. PBF A2RG55 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9611
1. PBF Q8DRF4 Putative NrdI-like protein 1.69e-11 1.83e-17 7.05e-09 0.7719
1. PBF Q9CBP9 Protein NrdI 0.00e+00 7.08e-23 5.57e-41 0.922
1. PBF B2U069 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.97
1. PBF A7MI07 Protein NrdI 0.00e+00 1.11e-21 1.32e-35 0.9625
1. PBF Q7N772 Protein NrdI 0.00e+00 6.74e-26 1.34e-43 0.9467
1. PBF Q5XDK5 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9606
1. PBF Q9XC21 Protein NrdI 0.00e+00 2.77e-34 8.82e-47 0.9193
1. PBF P0A775 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9697
1. PBF B1XCL1 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9702
1. PBF A7ZQA5 Protein NrdI 0.00e+00 7.49e-22 3.50e-44 0.9702
1. PBF A4WDN8 Protein NrdI 0.00e+00 4.78e-20 9.15e-43 0.9725
1. PBF A7WZL9 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8396
1. PBF A1UE06 Protein NrdI 0.00e+00 2.17e-17 1.99e-41 0.8745
1. PBF Q6D1W1 Protein NrdI 0.00e+00 2.56e-22 5.02e-44 0.9619
1. PBF B7UH94 Protein NrdI 0.00e+00 1.28e-21 7.52e-43 0.9698
1. PBF A8ANN2 Protein NrdI 0.00e+00 7.97e-22 4.99e-46 0.9707
1. PBF Q65JA6 Protein NrdI 5.55e-16 1.77e-09 5.79e-10 0.8241
1. PBF A1KN49 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 0.931
1. PBF P65547 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9711
1. PBF B5RDD6 Protein NrdI 0.00e+00 3.56e-20 9.87e-45 0.9639
1. PBF B5XVD7 Protein NrdI 0.00e+00 1.38e-22 2.85e-42 0.9735
1. PBF B7N6R0 Protein NrdI 0.00e+00 6.86e-23 9.82e-44 0.9703
1. PBF A9MG06 Protein NrdI 0.00e+00 5.21e-21 9.61e-46 0.9732
1. PBF Q667N6 Protein NrdI 0.00e+00 8.25e-25 1.17e-42 0.9562
1. PBF Q9XD64 Protein NrdI 0.00e+00 2.06e-16 4.47e-42 0.921
1. PBF Q5X9T2 Putative NrdI-like protein 2.76e-14 1.96e-16 2.73e-11 0.7619
1. PBF Q1R824 Protein NrdI 0.00e+00 6.63e-22 1.68e-44 0.9702
1. PBF Q8UJ69 Protein NrdI 0.00e+00 1.03e-24 2.11e-44 0.9664
1. PBF Q48709 Protein NrdI 0.00e+00 3.96e-16 5.69e-16 0.8788
1. PBF B7MKE7 Protein NrdI 0.00e+00 6.63e-22 1.68e-44 0.9704
1. PBF Q73VB3 Protein NrdI 0.00e+00 8.17e-21 3.99e-44 0.935
1. PBF Q0TEK1 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9702
1. PBF B9DK28 Protein NrdI 0.00e+00 2.54e-11 1.45e-17 0.8793
1. PBF Q1JD89 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.961
1. PBF B4TSY7 Protein NrdI 0.00e+00 1.38e-21 1.16e-45 0.9724
1. PBF Q97T03 Putative NrdI-like protein 5.10e-12 5.04e-17 6.98e-09 0.7659
1. PBF Q0T1A7 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9697
1. PBF B5BEM1 Protein NrdI 0.00e+00 1.13e-21 2.02e-45 0.9729
1. PBF A1JKB8 Protein NrdI 0.00e+00 2.50e-24 1.19e-43 0.9583
1. PBF A0QJJ4 Protein NrdI 0.00e+00 8.17e-21 3.99e-44 0.9353
1. PBF A8GI78 Protein NrdI 0.00e+00 1.50e-23 3.95e-45 0.9594
1. PBF P0C1S2 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8382
1. PBF P0DC73 Putative NrdI-like protein 1.55e-14 4.78e-16 2.16e-11 0.77
1. PBF Q49VS8 Protein NrdI 1.11e-16 1.43e-09 4.21e-18 0.8318
1. PBF B7MYX8 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9703
1. PBF Q6G5I3 Protein NrdI 0.00e+00 9.66e-23 1.25e-29 0.9263
1. PBF B5ZRN9 Protein NrdI 0.00e+00 2.84e-24 5.86e-44 0.9614
1. PBF Q1R0L8 Protein NrdI 0.00e+00 4.12e-22 5.70e-36 0.9426
1. PBF Q56109 Protein NrdI 0.00e+00 3.08e-21 1.24e-45 0.9729
1. PBF P65549 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 0.9358
1. PBF Q8ZDC6 Protein NrdI 0.00e+00 8.25e-25 1.17e-42 0.9567
1. PBF Q2K3W4 Protein NrdI 0.00e+00 1.77e-25 6.51e-46 0.9557
1. PBF C0ZXH4 Protein NrdI 0.00e+00 1.96e-10 3.74e-43 0.8974
1. PBF P0A773 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9707
1. PBF Q9CGW6 Protein NrdI 1.44e-15 3.62e-15 3.80e-15 0.8719
1. PBF B2VDV1 Protein NrdI 0.00e+00 1.79e-18 4.55e-43 0.9688
1. PBF P0DC71 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9612
1. PBF A7FFL7 Protein NrdI 0.00e+00 8.25e-25 1.17e-42 0.9565
1. PBF B5QUL6 Protein NrdI 0.00e+00 1.38e-21 1.16e-45 0.9727
1. PBF A6QF39 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.838
1. PBF B1IUZ9 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9706
1. PBF B7LE91 Protein NrdI 0.00e+00 7.49e-22 3.50e-44 0.9699
1. PBF C1AGH0 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 0.9356
1. PBF A8Z002 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8376
1. PBF A5U766 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 0.932
1. PBF P50618 Protein NrdI 3.33e-16 5.61e-09 3.70e-11 0.8208
1. PBF A5IQT4 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8391
1. PBF B1ME21 Protein NrdI 0.00e+00 8.14e-18 5.26e-41 0.8552
1. PBF B5Z288 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.97
1. PBF A1BA96 Protein NrdI 0.00e+00 2.39e-19 2.08e-38 0.9466
1. PBF C0PWK6 Protein NrdI 0.00e+00 3.08e-21 1.24e-45 0.973
1. PBF P68814 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8397
1. PBF B4T381 Protein NrdI 0.00e+00 2.04e-21 1.42e-45 0.9731
1. PBF B3Q0Y6 Protein NrdI 0.00e+00 4.12e-25 8.78e-44 0.9625
1. PBF Q0S2M1 Protein NrdI 0.00e+00 1.48e-09 7.02e-41 0.9083
1. PBF P47472 Protein NrdI 0.00e+00 1.67e-50 1.46e-71 0.9881
1. PBF B1LPE9 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9699
1. PBF B8DVW3 Protein NrdI 0.00e+00 3.06e-26 8.95e-37 0.9139
1. PBF A9IML0 Protein NrdI 0.00e+00 1.72e-20 3.94e-30 0.9486
1. PBF Q99XX2 Putative NrdI-like protein 2.14e-14 6.34e-16 2.10e-11 0.7707
1. PBF Q8CQ03 Protein NrdI 0.00e+00 6.06e-09 4.82e-13 0.8845
1. PBF Q6MSC4 Protein NrdI 0.00e+00 3.38e-75 3.58e-111 0.9939
1. PBF Q98Q29 Protein NrdI 0.00e+00 2.92e-45 2.54e-73 0.9776
1. PBF P9WIZ2 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 0.9355
1. PBF Q6GBA0 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8379
1. PBF A6X357 Protein NrdI 0.00e+00 1.11e-22 1.56e-45 0.9636
1. PBF P0DC72 Putative NrdI-like protein 1.44e-14 4.78e-16 2.16e-11 0.7642
1. PBF P0A774 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9693
1. PBF A1URS1 Protein NrdI 0.00e+00 1.24e-20 3.57e-29 0.9577
1. PBF Q31X44 Protein NrdI 0.00e+00 2.98e-21 2.07e-44 0.9696
1. PBF A9ME65 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.971
1. PBF Q5HR00 Protein NrdI 0.00e+00 6.06e-09 4.82e-13 0.8846
1. PBF Q1MBD4 Protein NrdI 0.00e+00 3.44e-24 5.36e-44 0.9462
1. PBF B5FSW2 Protein NrdI 0.00e+00 1.70e-21 1.21e-45 0.9728
1. PBF A5VU41 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9709
1. PBF P65551 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9611
1. PBF A9WY13 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.971
1. PBF Q9A176 Protein NrdI 0.00e+00 2.34e-07 3.14e-51 0.9612
1. PBF Q2FIR0 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8425
1. PBF A1T6Q8 Protein NrdI 0.00e+00 9.84e-11 1.72e-43 0.9086
1. PBF Q8EWW3 Protein NrdI 0.00e+00 7.94e-26 1.29e-45 0.8986
1. PBF B2KAB9 Protein NrdI 0.00e+00 8.25e-25 1.17e-42 0.9564
1. PBF Q5HHU1 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8376
1. PBF B8ZS49 Protein NrdI 0.00e+00 7.08e-23 5.57e-41 0.9215
1. PBF Q2YSJ9 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8393
1. PBF B5XK14 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9611
1. PBF P75460 Protein NrdI 0.00e+00 5.75e-47 5.98e-74 0.9936
1. PBF Q1J861 Protein NrdI 0.00e+00 1.06e-22 7.14e-52 0.9509
1. PBF Q32CQ1 Protein NrdI 0.00e+00 5.37e-21 3.13e-44 0.9694
1. PBF A9N099 Protein NrdI 0.00e+00 1.38e-21 1.16e-45 0.9729
1. PBF B1JR56 Protein NrdI 0.00e+00 8.25e-25 1.17e-42 0.9565
1. PBF Q02ZM3 Protein NrdI 0.00e+00 5.11e-16 7.05e-16 0.8797
1. PBF Q6G0R4 Protein NrdI 0.00e+00 1.71e-19 3.14e-28 0.9319
1. PBF Q2YJZ2 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9712
1. PBF Q5PF04 Protein NrdI 0.00e+00 1.13e-21 2.02e-45 0.9728
1. PBF A7Z504 Protein NrdI 2.22e-16 4.20e-08 2.56e-11 0.8213
1. PBF C6DC61 Protein NrdI 0.00e+00 4.16e-23 1.09e-43 0.9618
1. PBF Q1JIB1 Protein NrdI 0.00e+00 2.62e-07 9.02e-53 0.9612
1. PBF Q57KW6 Protein NrdI 0.00e+00 3.08e-21 1.24e-45 0.973
1. PBF Q2ST19 Protein NrdI 0.00e+00 2.73e-75 6.50e-109 0.9798
1. PBF C1B1P5 Protein NrdI 0.00e+00 2.97e-15 3.81e-39 0.9082
1. PBF C5BUY7 Protein NrdI 0.00e+00 2.00e-22 2.30e-43 0.9538
1. PBF A4QGT2 Protein NrdI 0.00e+00 2.06e-16 4.47e-42 0.921
1. PBF B7NSF9 Protein NrdI 0.00e+00 9.28e-22 3.07e-44 0.9699
1. PBF Q577C7 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9708
1. PBF Q9RZL8 Protein NrdI 6.99e-13 6.01e-07 2.16e-07 0.7712
1. PBF B5F333 Protein NrdI 0.00e+00 3.08e-21 1.24e-45 0.9728
1. PBF B4TEZ3 Protein NrdI 0.00e+00 1.38e-21 1.16e-45 0.9724
1. PBF A6TZK9 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8383
1. PBF A6TCU0 Protein NrdI 0.00e+00 3.03e-22 1.22e-42 0.9733
1. PBF Q6F0T6 Protein NrdI 0.00e+00 3.07e-39 1.28e-75 0.9925
1. PBF Q6GIR1 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8799
1. PBF Q1JN60 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9612
1. PBF Q8NZA2 Putative NrdI-like protein 1.20e-14 2.75e-16 1.61e-10 0.7887
1. PBF B7M9B7 Protein NrdI 0.00e+00 7.49e-22 3.50e-44 0.971
1. PBF P68524 SPbeta prophage-derived protein NrdI 0.00e+00 3.79e-09 2.19e-14 0.8071
1. PBF C0RKP1 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9708
1. PBF C4ZYS6 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.97
1. PBF Q4L4F3 Protein NrdI 0.00e+00 1.35e-11 4.84e-14 0.8775
1. PBF B9EAC8 Protein NrdI 0.00e+00 1.36e-10 1.99e-12 0.8227
1. PBF Q1GJB3 Protein NrdI 0.00e+00 2.09e-16 1.18e-42 0.9502
1. PBF Q8D1U5 Protein NrdI 0.00e+00 9.91e-18 1.45e-37 0.95
1. PBF A1AEL9 Protein NrdI 0.00e+00 6.63e-22 1.68e-44 0.9708
1. PBF P0DC70 Protein NrdI 0.00e+00 1.32e-07 1.37e-52 0.9618
1. PBF Q8Z4E6 Protein NrdI 0.00e+00 2.12e-20 1.03e-45 0.9728
1. PBF O69272 Protein NrdI 0.00e+00 2.69e-20 2.79e-40 0.9245
1. PBF P68812 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8389
1. PBF A3PXF8 Protein NrdI 0.00e+00 2.17e-17 1.99e-41 0.8749
1. PBF P65546 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.9716
1. PBF P68811 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 0.8393
1. PBF B2SBS5 Protein NrdI 0.00e+00 7.08e-23 7.67e-45 0.971
1. PBF B6I665 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9698
1. PBF Q48V07 Protein NrdI 0.00e+00 1.82e-07 1.68e-52 0.9606
1. PBF B7LW06 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 0.9694
1. PBF A4TDU4 Protein NrdI 0.00e+00 1.34e-14 8.80e-45 0.9156
4. PB Q2G079 Protein NrdI 0.00e+00 9.38e-10 1.55e-14 NA
4. PB P68525 Phage protein nrdI NA 3.79e-09 2.19e-14 NA
4. PB P9WIZ3 Protein NrdI 0.00e+00 2.00e-20 1.43e-43 NA
4. PB P0A772 Protein NrdI 0.00e+00 7.49e-22 1.96e-44 NA
5. P Q885J3 6,7-dimethyl-8-ribityllumazine synthase 2 1.48e-02 4.20e-02 NA NA
5. P B5Z6D8 6,7-dimethyl-8-ribityllumazine synthase 5.04e-02 4.26e-02 NA NA
5. P O52659 Flavodoxin 4.92e-07 1.48e-02 NA NA
5. P O24753 6,7-dimethyl-8-ribityllumazine synthase 2.60e-02 1.29e-03 NA NA
5. P C3NGF3 6,7-dimethyl-8-ribityllumazine synthase 8.91e-03 1.31e-03 NA NA
5. P O25776 Flavodoxin 2.21e-06 7.13e-06 NA NA
5. P A4YCS3 6,7-dimethyl-8-ribityllumazine synthase 8.65e-03 5.71e-04 NA NA
5. P Q01096 Flavodoxin 6.48e-07 4.44e-14 NA NA
5. P P61725 6,7-dimethyl-8-ribityllumazine synthase 2.61e-02 4.34e-03 NA NA
5. P B8ZUN3 6,7-dimethyl-8-ribityllumazine synthase 2.78e-02 7.83e-03 NA NA
5. P A4WLK4 6,7-dimethyl-8-ribityllumazine synthase 1.21e-02 6.21e-03 NA NA
5. P P00321 Flavodoxin 6.95e-05 2.69e-11 NA NA
5. P P73527 6,7-dimethyl-8-ribityllumazine synthase 3.80e-02 4.81e-02 NA NA
5. P Q2W4S6 6,7-dimethyl-8-ribityllumazine synthase 1.91e-02 9.47e-04 NA NA
5. P Q92QU0 6,7-dimethyl-8-ribityllumazine synthase 1 4.94e-02 7.00e-03 NA NA
5. P P0A3E0 Flavodoxin 1.21e-06 1.43e-02 NA NA
5. P Q975M5 6,7-dimethyl-8-ribityllumazine synthase 8.57e-03 3.03e-04 NA NA
5. P A0RQJ7 6,7-dimethyl-8-ribityllumazine synthase 6.04e-02 4.85e-02 NA NA
5. P B1KJK4 6,7-dimethyl-8-ribityllumazine synthase 2.60e-02 2.18e-02 NA NA
5. P A0PPL7 6,7-dimethyl-8-ribityllumazine synthase 2.67e-02 4.43e-02 NA NA
5. P A3DLT5 6,7-dimethyl-8-ribityllumazine synthase 7.68e-03 1.67e-03 NA NA
5. P A1RHD5 6,7-dimethyl-8-ribityllumazine synthase 2.47e-02 4.92e-02 NA NA
5. P Q8YGH2 6,7-dimethyl-8-ribityllumazine synthase 1 6.72e-02 2.63e-02 NA NA
5. P C5D3M9 6,7-dimethyl-8-ribityllumazine synthase 4.76e-02 4.89e-02 NA NA
5. P P66035 6,7-dimethyl-8-ribityllumazine synthase 2.73e-02 3.32e-03 NA NA
5. P Q8RHY7 Glutamate mutase sigma subunit 3.65e-02 3.36e-02 NA NA
5. P Q9CCP3 6,7-dimethyl-8-ribityllumazine synthase 2.83e-02 7.83e-03 NA NA
5. P B0RC64 6,7-dimethyl-8-ribityllumazine synthase 4.01e-02 7.53e-03 NA NA
5. P P00323 Flavodoxin 4.34e-07 2.01e-10 NA NA
5. P Q9YC88 6,7-dimethyl-8-ribityllumazine synthase 1.54e-02 2.27e-02 NA NA
5. P P61712 6,7-dimethyl-8-ribityllumazine synthase 2 8.92e-03 4.71e-03 NA NA
5. P P71169 Flavodoxin 7.28e-06 2.68e-03 NA NA
5. P P65368 Uncharacterized protein YqcA 3.42e-06 1.19e-09 NA NA
5. P A1T8K2 6,7-dimethyl-8-ribityllumazine synthase 3.13e-02 3.31e-02 NA NA
5. P Q9KVY6 Protein MioC homolog 3.23e-06 2.16e-08 NA NA
5. P Q2G669 6,7-dimethyl-8-ribityllumazine synthase 5.62e-02 3.08e-03 NA NA
5. P P18855 Flavodoxin 7.62e-06 7.08e-04 NA NA
5. P Q9A9S4 6,7-dimethyl-8-ribityllumazine synthase 1 3.48e-02 4.79e-03 NA NA
5. P C3MX02 6,7-dimethyl-8-ribityllumazine synthase 1.04e-02 1.36e-03 NA NA
5. P Q9L6A2 Protein MioC homolog 1.75e-06 4.12e-12 NA NA
5. P Q1GNT5 6,7-dimethyl-8-ribityllumazine synthase 4.95e-02 1.02e-03 NA NA
5. P Q01095 Flavodoxin 3.36e-06 2.85e-11 NA NA
5. P Q89ZW8 6,7-dimethyl-8-ribityllumazine synthase 5.02e-02 5.00e-02 NA NA
5. P P57385 Flavodoxin 9.54e-07 3.22e-04 NA NA
5. P Q47QZ8 6,7-dimethyl-8-ribityllumazine synthase 5.99e-02 4.04e-02 NA NA
5. P Q1B9D5 6,7-dimethyl-8-ribityllumazine synthase 3.11e-02 2.01e-02 NA NA
5. P A4QEG8 6,7-dimethyl-8-ribityllumazine synthase 3.48e-02 3.00e-02 NA NA
5. P P65367 Flavodoxin YqcA 3.52e-06 1.19e-09 NA NA
5. P Q8ZTE3 6,7-dimethyl-8-ribityllumazine synthase 1.08e-02 2.95e-03 NA NA
5. P P58208 Protein MioC 4.04e-06 3.52e-14 NA NA
5. P P9WHE8 6,7-dimethyl-8-ribityllumazine synthase 2.76e-02 3.32e-03 NA NA
5. P B2HP68 6,7-dimethyl-8-ribityllumazine synthase 2.49e-02 2.42e-02 NA NA
5. P Q494E6 6,7-dimethyl-8-ribityllumazine synthase 1.91e-02 1.24e-02 NA NA
5. P P00322 Flavodoxin 6.47e-06 8.27e-15 NA NA
5. P Q2ILH7 6,7-dimethyl-8-ribityllumazine synthase 3.74e-02 4.53e-02 NA NA
5. P A0LUD3 6,7-dimethyl-8-ribityllumazine synthase 2.79e-02 2.50e-03 NA NA
5. P P44813 Protein MioC homolog 2.65e-06 7.44e-13 NA NA
5. P Q0HL88 6,7-dimethyl-8-ribityllumazine synthase 2.43e-02 4.85e-02 NA NA
5. P Q47418 Flavodoxin YqcA 2.11e-06 2.59e-10 NA NA
5. P B4UIM2 6,7-dimethyl-8-ribityllumazine synthase 3.47e-02 2.32e-02 NA NA
5. P O27952 Uncharacterized protein AF_2332 5.57e-06 1.18e-06 NA NA
5. P P80312 Flavodoxin 7.36e-07 3.36e-11 NA NA
5. P Q5NQA8 6,7-dimethyl-8-ribityllumazine synthase 4.69e-02 3.50e-02 NA NA
5. P O34737 Probable flavodoxin 1 2.41e-07 8.20e-10 NA NA
5. P P14070 Flavodoxin 5.99e-06 1.26e-02 NA NA
5. P P31158 Flavodoxin 5.89e-07 6.51e-03 NA NA
5. P C3N782 6,7-dimethyl-8-ribityllumazine synthase 1.02e-02 1.31e-03 NA NA
5. P B6J943 6,7-dimethyl-8-ribityllumazine synthase 1.08e-02 3.89e-02 NA NA
5. P P27319 Flavodoxin 6.05e-07 1.77e-03 NA NA
5. P Q980B5 6,7-dimethyl-8-ribityllumazine synthase 8.28e-03 2.32e-03 NA NA
5. P A9IVC0 6,7-dimethyl-8-ribityllumazine synthase 6.71e-02 1.33e-02 NA NA
5. P Q17Z25 6,7-dimethyl-8-ribityllumazine synthase 6.90e-02 3.47e-02 NA NA
5. P Q57DY1 6,7-dimethyl-8-ribityllumazine synthase 1 6.46e-02 3.92e-02 NA NA
5. P Q92NI1 6,7-dimethyl-8-ribityllumazine synthase 2 2.87e-02 3.72e-02 NA NA
5. P P9WHE9 6,7-dimethyl-8-ribityllumazine synthase 2.84e-02 3.32e-03 NA NA
5. P Q64XS0 6,7-dimethyl-8-ribityllumazine synthase 3.71e-02 1.48e-02 NA NA
5. P Q57746 Uncharacterized protein MJ0298 2.07e-05 3.55e-02 NA NA
5. P Q6A6Y6 6,7-dimethyl-8-ribityllumazine synthase 3.40e-02 3.89e-02 NA NA
5. P A1UFM8 6,7-dimethyl-8-ribityllumazine synthase 3.03e-02 2.01e-02 NA NA
5. P Q8FT58 6,7-dimethyl-8-ribityllumazine synthase 3.19e-02 2.01e-02 NA NA
5. P P26492 Flavodoxin 1.37e-06 2.39e-10 NA NA
5. P Q6AGR7 6,7-dimethyl-8-ribityllumazine synthase 4.96e-02 4.79e-03 NA NA
5. P Q8TYL5 6,7-dimethyl-8-ribityllumazine synthase 1.45e-02 2.80e-02 NA NA
5. P Q8VQF4 Cindoxin 1.37e-05 1.76e-11 NA NA
5. P C4KIE0 6,7-dimethyl-8-ribityllumazine synthase 9.42e-03 1.36e-03 NA NA
5. P A3MX07 6,7-dimethyl-8-ribityllumazine synthase 1.92e-02 5.72e-03 NA NA
5. P B1Y9N5 6,7-dimethyl-8-ribityllumazine synthase 1.45e-02 7.41e-03 NA NA
5. P A9KC67 6,7-dimethyl-8-ribityllumazine synthase 1.70e-02 4.04e-02 NA NA
5. P Q2NAP7 6,7-dimethyl-8-ribityllumazine synthase 4.73e-02 6.21e-03 NA NA
5. P P52964 Flavodoxin 1 2.53e-06 6.44e-04 NA NA
5. P A4Y961 6,7-dimethyl-8-ribityllumazine synthase 2.44e-02 4.92e-02 NA NA
5. P P0A3D9 Flavodoxin 1.19e-06 1.43e-02 NA NA
5. P Q4JAJ2 6,7-dimethyl-8-ribityllumazine synthase 8.42e-03 2.95e-04 NA NA
5. P A4FBK5 6,7-dimethyl-8-ribityllumazine synthase 5.62e-02 1.54e-03 NA NA
5. P Q57847 Uncharacterized protein MJ0404 6.27e-02 7.53e-03 NA NA
5. P B1MCA3 6,7-dimethyl-8-ribityllumazine synthase 3.32e-02 2.89e-02 NA NA
5. P A0QI08 6,7-dimethyl-8-ribityllumazine synthase 2.66e-02 5.54e-03 NA NA
5. P B8JEW4 6,7-dimethyl-8-ribityllumazine synthase 3.49e-02 2.32e-02 NA NA
5. P A5V939 6,7-dimethyl-8-ribityllumazine synthase 5.77e-02 3.91e-03 NA NA
5. P Q5GT94 6,7-dimethyl-8-ribityllumazine synthase 2.51e-02 1.27e-02 NA NA
5. P Q12Q43 6,7-dimethyl-8-ribityllumazine synthase 2.48e-02 1.86e-02 NA NA
5. P Q2YNC6 6,7-dimethyl-8-ribityllumazine synthase 1 6.18e-02 3.92e-02 NA NA
5. P Q9ZK53 Flavodoxin 5.33e-06 7.55e-06 NA NA
5. P Q3AFA7 Glutamate mutase sigma subunit 3.81e-02 2.02e-02 NA NA
5. P A8FSR4 6,7-dimethyl-8-ribityllumazine synthase 2.56e-02 2.13e-02 NA NA
5. P P71165 Flavodoxin 5.89e-07 2.23e-10 NA NA
5. P P65369 Uncharacterized protein YqcA 3.52e-06 1.19e-09 NA NA
5. P P03817 Protein MioC 3.73e-06 1.33e-13 NA NA
5. P P61711 6,7-dimethyl-8-ribityllumazine synthase 2 8.85e-03 4.71e-03 NA NA
5. P P28579 Flavodoxin 1.11e-05 5.54e-03 NA NA
5. P Q086C4 6,7-dimethyl-8-ribityllumazine synthase 2.52e-02 3.44e-02 NA NA
5. P Q8EBP3 6,7-dimethyl-8-ribityllumazine synthase 2.43e-02 4.85e-02 NA NA
5. P Q9HYH1 Uncharacterized protein PA3435 5.13e-06 4.33e-14 NA NA
5. P A3PZ89 6,7-dimethyl-8-ribityllumazine synthase 3.14e-02 2.01e-02 NA NA
5. P C3MZ62 6,7-dimethyl-8-ribityllumazine synthase 1.06e-02 1.36e-03 NA NA
5. P Q2YKV1 6,7-dimethyl-8-ribityllumazine synthase 2 3.09e-02 4.71e-03 NA NA
5. P A9WR65 6,7-dimethyl-8-ribityllumazine synthase 3.06e-02 2.25e-02 NA NA
5. P O83895 Flavodoxin 3.67e-06 4.28e-12 NA NA
5. P P18086 Flavodoxin 1.96e-06 1.47e-13 NA NA
5. P A6WCA2 6,7-dimethyl-8-ribityllumazine synthase 1.01e-01 6.62e-03 NA NA
5. P Q6G005 6,7-dimethyl-8-ribityllumazine synthase 6.46e-02 1.43e-03 NA NA
5. P C4LAE1 6,7-dimethyl-8-ribityllumazine synthase 4.25e-02 2.29e-02 NA NA
5. P O34589 Probable flavodoxin 2 1.90e-07 2.31e-13 NA NA
5. P C5CBJ8 6,7-dimethyl-8-ribityllumazine synthase 6.02e-02 2.57e-02 NA NA
5. P P61713 6,7-dimethyl-8-ribityllumazine synthase 2 9.00e-03 4.71e-03 NA NA
5. P Q8NQ53 6,7-dimethyl-8-ribityllumazine synthase 3.55e-02 3.00e-02 NA NA
5. P Q9A8J4 6,7-dimethyl-8-ribityllumazine synthase 2 8.85e-03 1.84e-03 NA NA
5. P Q8K9N5 Flavodoxin 2.83e-05 4.41e-10 NA NA
5. P Q9REF4 6,7-dimethyl-8-ribityllumazine synthase 2.74e-02 7.77e-03 NA NA
5. P Q0HXJ1 6,7-dimethyl-8-ribityllumazine synthase 2.41e-02 4.85e-02 NA NA
5. P P10340 Flavodoxin 1.36e-06 4.49e-03 NA NA
5. P A1USI4 6,7-dimethyl-8-ribityllumazine synthase 3.02e-02 1.12e-03 NA NA
5. P A7GWZ6 6,7-dimethyl-8-ribityllumazine synthase 5.69e-02 3.44e-02 NA NA
5. P P04668 Flavodoxin 1.77e-05 8.90e-05 NA NA
5. P C3MR14 6,7-dimethyl-8-ribityllumazine synthase 1.07e-02 1.31e-03 NA NA
6. F Q65T53 Sulfite reductase [NADPH] flavoprotein alpha-component 3.05e-02 NA NA 0.4955