Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54950.1
JCVISYN3A_0773
Ribonucleoside-diphosphate reductase subunit beta.
M. mycoides homolog: Q6MSC3.
TIGRfam Classification: 4=Probable.
Category: Quasiessential.
Statistics
Total GO Annotation: 75
Unique PROST Go: 40
Unique BLAST Go: 8
Unique Foldseek Go: 0
Total Homologs: 282
Unique PROST Homologs: 203
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
P9WH72
(Ribonucleoside-diphosphate reductase subunit beta nrdF1) with a FATCAT P-Value: 0 and RMSD of 2.88 angstrom. The sequence alignment identity is 47.4%.
Structural alignment shown in left. Query protein AVX54950.1 colored as red in alignment, homolog P9WH72 colored as blue.
Query protein AVX54950.1 is also shown in right top, homolog P9WH72 showed in right bottom. They are colored based on secondary structures.
AVX54950.1 MAKEQKYYHESVSPIEFVKNNFKGNL--R--SVNWNVINDEKDLEVWNRITQNFWLPEKIPVSNDLSSWRSLSS-EWQQLVTRTFTGLTLLDTVQATVGD 95 P9WH72 ---------------------MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTE-QQTTIRVFTGLTLLDTAQATVGA 78 AVX54950.1 VAQIEHSLTDHEQVIYSNFAFMVGVHARSYGTIFSTLCSSEQIEEAHEWVVKTETLQKRAKALIPYYTGTDPLKSKVAAALM-PGFLLYGGFYLPFYLSA 194 P9WH72 VAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRK-ASSVMLESFLFYSGFYLPMYWSS 177 AVX54950.1 RGKLPNTSDIIRLILRDKVIHNYYSGYKYQKKVAKLPVEKQAEMKEFVFKLLYEL----IDLETAYLKELY--AGFDIVDDAIRFSVYNAGKFLQNLGYD 288 P9WH72 RGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEID----YAHDLYDELGW--TDDVLPYMRYNANKALANLGY- 270 AVX54950.1 SPFSEEET-RIEPEIFNQLSARADENHDFFSGNGSSYVMGVSVETEDEDWEF 339 P9WH72 QPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDWDF 322
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006260 | DNA replication |
| 1. PBF | GO:0005971 | ribonucleoside-diphosphate reductase complex |
| 1. PBF | GO:0004748 | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor |
| 1. PBF | GO:0009263 | deoxyribonucleotide biosynthetic process |
| 1. PBF | GO:0003014 | renal system process |
| 1. PBF | GO:0009200 | deoxyribonucleoside triphosphate metabolic process |
| 1. PBF | GO:1902254 | negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 1. PBF | GO:0006240 | dCDP biosynthetic process |
| 1. PBF | GO:0046872 | metal ion binding |
| 1. PBF | GO:0046704 | CDP metabolic process |
| 1. PBF | GO:0006264 | mitochondrial DNA replication |
| 2. PF | GO:0016491 | oxidoreductase activity |
| 2. PF | GO:0051063 | CDP reductase activity |
| 3. BF | GO:0006314 | intron homing |
| 3. BF | GO:0016539 | intein-mediated protein splicing |
| 4. PB | GO:0008199 | ferric iron binding |
| 4. PB | GO:0009186 | deoxyribonucleoside diphosphate metabolic process |
| 4. PB | GO:0019046 | release from viral latency |
| 4. PB | GO:0001822 | kidney development |
| 4. PB | GO:0009262 | deoxyribonucleotide metabolic process |
| 4. PB | GO:0051290 | protein heterotetramerization |
| 4. PB | GO:0014075 | response to amine |
| 4. PB | GO:0009216 | purine deoxyribonucleoside triphosphate biosynthetic process |
| 4. PB | GO:0033644 | host cell membrane |
| 4. PB | GO:0001824 | blastocyst development |
| 4. PB | GO:0009212 | pyrimidine deoxyribonucleoside triphosphate biosynthetic process |
| 4. PB | GO:0009259 | ribonucleotide metabolic process |
| 5. P | GO:0016709 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen |
| 5. P | GO:0015995 | chlorophyll biosynthetic process |
| 5. P | GO:0046191 | aerobic phenol-containing compound catabolic process |
| 5. P | GO:0006744 | ubiquinone biosynthetic process |
| 5. P | GO:0009924 | octadecanal decarbonylase activity |
| 5. P | GO:0009570 | chloroplast stroma |
| 5. P | GO:0071771 | aldehyde decarbonylase activity |
| 5. P | GO:0005886 | plasma membrane |
| 5. P | GO:0009507 | chloroplast |
| 5. P | GO:0106317 | methane monooxygenase NADH activity |
| 5. P | GO:0106318 | methane monooxygenase NADPH activity |
| 5. P | GO:0048529 | magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase activity |
| 5. P | GO:0045301 | tRNA-(2-methylthio-N-6-(cis-hydroxy)isopentenyl adenosine)-hydroxylase activity |
| 5. P | GO:0030494 | bacteriochlorophyll biosynthetic process |
| 5. P | GO:0009658 | chloroplast organization |
| 5. P | GO:0005727 | extrachromosomal circular DNA |
| 5. P | GO:0042203 | toluene catabolic process |
| 5. P | GO:0006633 | fatty acid biosynthetic process |
| 5. P | GO:0018645 | alkene monooxygenase activity |
| 5. P | GO:0046914 | transition metal ion binding |
| 5. P | GO:0006631 | fatty acid metabolic process |
| 5. P | GO:1990465 | aldehyde oxygenase (deformylating) activity |
| 5. P | GO:0048472 | threonine-phosphate decarboxylase activity |
| 5. P | GO:0045300 | acyl-[acyl-carrier-protein] desaturase activity |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0009236 | cobalamin biosynthetic process |
| 5. P | GO:1901401 | regulation of tetrapyrrole metabolic process |
| 5. P | GO:0015420 | ABC-type vitamin B12 transporter activity |
| 5. P | GO:0006952 | defense response |
| 5. P | GO:0036068 | light-independent chlorophyll biosynthetic process |
| 5. P | GO:0009706 | chloroplast inner membrane |
| 5. P | GO:0005506 | iron ion binding |
| 5. P | GO:0004768 | stearoyl-CoA 9-desaturase activity |
| 5. P | GO:0102786 | stearoyl-[acp] desaturase activity |
| 5. P | GO:0008682 | 3-demethoxyubiquinol 3-hydroxylase activity |
| 5. P | GO:0052572 | response to host immune response |
| 5. P | GO:0015979 | photosynthesis |
| 5. P | GO:0018662 | phenol 2-monooxygenase activity |
| 5. P | GO:0036070 | light-independent bacteriochlorophyll biosynthetic process |
| 5. P | GO:0006725 | cellular aromatic compound metabolic process |
| 7. B | GO:0051726 | regulation of cell cycle |
| 7. B | GO:0006979 | response to oxidative stress |
| 7. B | GO:0005635 | nuclear envelope |
| 7. B | GO:0006281 | DNA repair |
| 7. B | GO:0005829 | cytosol |
| 7. B | GO:0042802 | identical protein binding |
| 7. B | GO:0006213 | pyrimidine nucleoside metabolic process |
| 7. B | GO:0015949 | nucleobase-containing small molecule interconversion |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006260 | DNA replication |
| GO:0016021 | integral component of membrane |
| GO:0005971 | ribonucleoside-diphosphate reductase complex |
| GO:0004748 | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor |
| GO:0016491 | oxidoreductase activity |
| GO:0009263 | deoxyribonucleotide biosynthetic process |
| GO:0016020 | membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q89AS5 | Ribonucleoside-diphosphate reductase subunit beta | 1.29e-14 | 1.91e-29 | 2.67e-06 | 0.6995 |
| 1. PBF | O84835 | Ribonucleoside-diphosphate reductase subunit beta | 2.70e-13 | 7.76e-29 | 3.60e-04 | 0.7982 |
| 1. PBF | Q9KFH7 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 3.04e-36 | 4.20e-13 | 0.8076 |
| 1. PBF | Q4R7Q7 | Ribonucleoside-diphosphate reductase subunit M2 | 5.17e-13 | 1.12e-13 | 0.001 | 0.7391 |
| 1. PBF | Q9ZKC3 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 2.60e-37 | 4.82e-07 | 0.725 |
| 1. PBF | O46310 | Ribonucleoside-diphosphate reductase small subunit | 0.00e+00 | 6.83e-20 | 3.62e-06 | 0.6777 |
| 1. PBF | P37427 | Ribonucleoside-diphosphate reductase 1 subunit beta | 0.00e+00 | 3.30e-22 | 2.94e-09 | 0.7424 |
| 1. PBF | P07201 | Ribonucleoside-diphosphate reductase small chain | 3.02e-13 | 1.13e-16 | 3.13e-04 | 0.7606 |
| 1. PBF | O15910 | Ribonucleoside-diphosphate reductase small chain | 0.00e+00 | 6.49e-25 | 5.79e-06 | 0.7462 |
| 1. PBF | Q9XC20 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 1.92e-90 | 0.0 | 0.9766 |
| 1. PBF | O30601 | SPbeta prophage-derived ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 1.05e-34 | 3.28e-57 | 0.9229 |
| 1. PBF | Q9PL92 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 2.37e-30 | 0.008 | 0.733 |
| 1. PBF | P17424 | Ribonucleoside-diphosphate reductase 2 subunit beta | 0.00e+00 | 3.23e-44 | 4.24e-120 | 0.9534 |
| 1. PBF | P69925 | Ribonucleoside-diphosphate reductase 1 subunit beta | 2.75e-14 | 1.36e-22 | 1.01e-08 | 0.7442 |
| 1. PBF | O83092 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 4.27e-33 | 2.74e-14 | 0.8095 |
| 1. PBF | Q8K9W4 | Ribonucleoside-diphosphate reductase subunit beta | 1.23e-14 | 2.56e-29 | 4.80e-05 | 0.7313 |
| 1. PBF | P49730 | Ribonucleoside-diphosphate reductase small chain | 0.00e+00 | 2.32e-20 | 5.39e-06 | 0.7228 |
| 1. PBF | Q8SRR2 | Ribonucleoside-diphosphate reductase small chain | 4.35e-13 | 1.96e-24 | 0.005 | 0.7706 |
| 1. PBF | Q60561 | Ribonucleoside-diphosphate reductase subunit M2 | 0.00e+00 | 1.47e-10 | 0.003 | 0.7225 |
| 1. PBF | P0DKH3 | Ribonucleoside-diphosphate reductase small chain B | 0.00e+00 | 1.59e-18 | 0.003 | 0.6846 |
| 1. PBF | Q9Z6S4 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 9.82e-30 | 2.99e-05 | 0.7371 |
| 1. PBF | Q9CBQ2 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 2.41e-54 | 8.38e-126 | 0.9419 |
| 1. PBF | P9WH70 | Ribonucleoside-diphosphate reductase subunit beta nrdF2 | 0.00e+00 | 7.76e-51 | 4.66e-122 | 0.9428 |
| 1. PBF | P57275 | Ribonucleoside-diphosphate reductase subunit beta | 1.92e-14 | 1.02e-23 | 6.94e-04 | 0.7318 |
| 1. PBF | P55983 | Ribonucleoside-diphosphate reductase subunit beta | 1.43e-14 | 4.77e-37 | 5.52e-07 | 0.7737 |
| 1. PBF | P75461 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 8.29e-94 | 0.0 | 0.9713 |
| 1. PBF | P47471 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 3.48e-93 | 0.0 | 0.9664 |
| 1. PBF | P43755 | Ribonucleoside-diphosphate reductase subunit beta | 1.19e-14 | 3.13e-20 | 2.64e-05 | 0.7039 |
| 1. PBF | P50621 | Ribonucleoside-diphosphate reductase subunit beta | 0.00e+00 | 5.55e-37 | 1.79e-60 | 0.9144 |
| 1. PBF | Q5R9G0 | Ribonucleoside-diphosphate reductase subunit M2 B | 9.84e-14 | 8.96e-22 | 3.51e-04 | 0.7409 |
| 1. PBF | P9WH72 | Ribonucleoside-diphosphate reductase subunit beta nrdF1 | 0.00e+00 | 2.23e-48 | 3.34e-115 | 0.9404 |
| 1. PBF | Q4R741 | Ribonucleoside-diphosphate reductase subunit M2 B | 1.70e-12 | 8.33e-23 | 2.57e-04 | 0.7408 |
| 2. PF | B1MHK0 | R2-like ligand binding oxidase | 2.52e-14 | 1.03e-21 | NA | 0.7213 |
| 2. PF | A0QPD3 | R2-like ligand binding oxidase | 3.55e-14 | 5.19e-23 | NA | 0.6975 |
| 2. PF | A4TB76 | R2-like ligand binding oxidase | 2.03e-14 | 6.69e-21 | NA | 0.671 |
| 2. PF | Q7U2I1 | R2-like ligand binding oxidase | 3.65e-14 | 1.06e-22 | NA | 0.6818 |
| 2. PF | Q0S392 | R2-like ligand binding oxidase | 4.34e-14 | 1.47e-21 | NA | 0.6342 |
| 2. PF | A4F7B2 | R2-like ligand binding oxidase | 8.65e-14 | 4.17e-24 | NA | 0.6798 |
| 2. PF | Q9C167 | Ribonucleoside-diphosphate reductase small chain | 1.32e-13 | 2.32e-12 | NA | 0.7653 |
| 2. PF | A1TAR1 | R2-like ligand binding oxidase | 2.20e-14 | 9.50e-20 | NA | 0.6655 |
| 2. PF | A3Q4Y5 | R2-like ligand binding oxidase | 2.51e-14 | 1.63e-20 | NA | 0.6745 |
| 2. PF | P50650 | Ribonucleoside-diphosphate reductase small chain | 8.12e-14 | 1.16e-27 | NA | 0.7375 |
| 2. PF | P50649 | Ribonucleoside-diphosphate reductase small subunit | 0.00e+00 | 1.92e-22 | NA | 0.7899 |
| 2. PF | A0QMC0 | R2-like ligand binding oxidase | 3.57e-14 | 2.33e-22 | NA | 0.6983 |
| 2. PF | A1UKW4 | R2-like ligand binding oxidase | 2.72e-14 | 2.69e-20 | NA | 0.6904 |
| 2. PF | Q73TP6 | R2-like ligand binding oxidase | 3.49e-14 | 3.59e-22 | NA | 0.6991 |
| 2. PF | A5TYV8 | R2-like ligand binding oxidase | 1.35e-13 | 3.65e-23 | NA | 0.7284 |
| 2. PF | P9WH68 | R2-like ligand binding oxidase | 3.73e-14 | 1.06e-22 | NA | 0.711 |
| 2. PF | A1KF53 | R2-like ligand binding oxidase | 3.82e-14 | 1.06e-22 | NA | 0.7098 |
| 2. PF | Q1B465 | R2-like ligand binding oxidase | 2.56e-14 | 2.69e-20 | NA | 0.6744 |
| 3. BF | O67475 | Ribonucleoside-diphosphate reductase subunit beta | 3.09e-04 | NA | 5.56e-06 | 0.8142 |
| 4. PB | P37146 | Ribonucleoside-diphosphate reductase 2 subunit beta | 0.00e+00 | 1.48e-46 | 8.70e-123 | NA |
| 4. PB | P69924 | Ribonucleoside-diphosphate reductase 1 subunit beta | 3.57e-14 | 1.36e-22 | 1.01e-08 | NA |
| 4. PB | O36410 | Ribonucleoside-diphosphate reductase small subunit | NA | 6.62e-27 | 5.76e-05 | NA |
| 4. PB | O64174 | Ribonucleoside-diphosphate reductase subunit beta | NA | 1.05e-34 | 3.28e-57 | NA |
| 4. PB | P42170 | Ribonucleoside-diphosphate reductase small chain | 8.69e-14 | 2.20e-15 | 1.44e-05 | NA |
| 4. PB | P0CAP6 | Ribonucleoside-diphosphate reductase small subunit | NA | 1.31e-18 | 0.001 | NA |
| 4. PB | P0DSS8 | Ribonucleoside-diphosphate reductase small chain | NA | 1.98e-27 | 0.011 | NA |
| 4. PB | Q7LG56 | Ribonucleoside-diphosphate reductase subunit M2 B | 1.56e-13 | 1.40e-21 | 3.39e-04 | NA |
| 4. PB | Q4KLN6 | Ribonucleoside-diphosphate reductase subunit M2 | 1.50e-13 | 5.80e-12 | 0.001 | NA |
| 4. PB | P0C701 | Ribonucleoside-diphosphate reductase small subunit | NA | 1.31e-18 | 0.001 | NA |
| 4. PB | Q6PEE3 | Ribonucleoside-diphosphate reductase subunit M2 B | 6.61e-14 | 7.13e-24 | 2.46e-04 | NA |
| 4. PB | P79733 | Ribonucleoside-diphosphate reductase subunit M2 | 3.81e-13 | 3.64e-14 | 2.42e-05 | NA |
| 4. PB | P0CAP7 | Ribonucleoside-diphosphate reductase small subunit | NA | 1.31e-18 | 0.001 | NA |
| 4. PB | P9WH71 | Ribonucleoside-diphosphate reductase subunit beta nrdF2 | 0.00e+00 | 7.76e-51 | 4.66e-122 | NA |
| 4. PB | P0DSS7 | Ribonucleoside-diphosphate reductase small chain | NA | 2.13e-27 | 0.023 | NA |
| 4. PB | P32209 | Ribonucleoside-diphosphate reductase small chain | NA | 3.49e-10 | 0.003 | NA |
| 4. PB | P50651 | Ribonucleoside-diphosphate reductase small chain A | 0.00e+00 | 5.26e-18 | 8.83e-09 | NA |
| 4. PB | P31350 | Ribonucleoside-diphosphate reductase subunit M2 | 0.00e+00 | 7.16e-14 | 0.001 | NA |
| 4. PB | P9WH73 | Ribonucleoside-diphosphate reductase subunit beta nrdF1 | 0.00e+00 | 2.23e-48 | 3.34e-115 | NA |
| 4. PB | P36603 | Ribonucleoside-diphosphate reductase small chain | 0.00e+00 | 3.61e-16 | 4.37e-04 | NA |
| 4. PB | P48592 | Ribonucleoside-diphosphate reductase subunit M2 | 0.00e+00 | 1.81e-13 | 0.001 | NA |
| 4. PB | Q9LSD0 | Ribonucleoside-diphosphate reductase small chain C | 0.00e+00 | 9.12e-22 | 0.022 | NA |
| 4. PB | Q9QTF2 | Ribonucleoside-diphosphate reductase small chain | NA | 6.93e-22 | 1.36e-07 | NA |
| 4. PB | P09247 | Ribonucleoside-diphosphate reductase small subunit | NA | 8.91e-21 | 0.022 | NA |
| 4. PB | Q91FE8 | Probable ribonucleoside-diphosphate reductase small subunit 376L | NA | 4.80e-19 | 3.39e-04 | NA |
| 4. PB | P09938 | Ribonucleoside-diphosphate reductase small chain 1 | 5.95e-13 | 4.79e-14 | 0.003 | NA |
| 4. PB | Q4JQV7 | Ribonucleoside-diphosphate reductase small subunit | NA | 8.91e-21 | 0.022 | NA |
| 4. PB | P11157 | Ribonucleoside-diphosphate reductase subunit M2 | 7.67e-13 | 4.42e-12 | 0.005 | NA |
| 5. P | Q6UDJ1 | Ribonucleoside-diphosphate reductase small subunit | NA | 1.25e-26 | NA | NA |
| 5. P | Q3AK18 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.50e-05 | 3.06e-16 | NA | NA |
| 5. P | Q7WTJ6 | Phenol hydroxylase P1 protein | 1.82e-08 | 2.56e-09 | NA | NA |
| 5. P | Q7V1M1 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.61e-08 | 1.51e-08 | NA | NA |
| 5. P | A4YNQ1 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 9.11e-06 | 6.83e-16 | NA | NA |
| 5. P | A3NZM5 | 3-demethoxyubiquinol 3-hydroxylase | 1.11e-07 | 6.09e-03 | NA | NA |
| 5. P | Q2KYH8 | 3-demethoxyubiquinol 3-hydroxylase | 6.19e-08 | 1.75e-02 | NA | NA |
| 5. P | A3MR53 | 3-demethoxyubiquinol 3-hydroxylase | 9.52e-08 | 2.79e-03 | NA | NA |
| 5. P | Q220S2 | 3-demethoxyubiquinol 3-hydroxylase | 7.43e-08 | 1.42e-02 | NA | NA |
| 5. P | Q01753 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.46e-04 | 4.91e-02 | NA | NA |
| 5. P | A9BXN5 | 3-demethoxyubiquinol 3-hydroxylase | 5.06e-08 | 2.28e-02 | NA | NA |
| 5. P | Q85FX6 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.49e-05 | 1.04e-15 | NA | NA |
| 5. P | P32061 | Acyl-[acyl-carrier-protein] desaturase, chloroplastic | 1.58e-04 | 3.72e-04 | NA | NA |
| 5. P | A2XSL4 | Stearoyl-[acyl-carrier-protein] 9-desaturase 5, chloroplastic | 1.21e-04 | 4.66e-07 | NA | NA |
| 5. P | Q77MS0 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.38e-25 | NA | NA |
| 5. P | P42521 | Ribonucleoside-diphosphate reductase small subunit | 5.55e-15 | 2.22e-24 | NA | NA |
| 5. P | Q8LJJ9 | Stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic | 1.03e-04 | 2.13e-05 | NA | NA |
| 5. P | Q4K507 | 3-demethoxyubiquinol 3-hydroxylase | 5.49e-08 | 1.77e-02 | NA | NA |
| 5. P | B1JUW2 | 3-demethoxyubiquinol 3-hydroxylase | 7.98e-08 | 9.31e-03 | NA | NA |
| 5. P | P28645 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 8.92e-05 | 1.66e-02 | NA | NA |
| 5. P | B2J1M1 | Aldehyde decarbonylase | 3.52e-13 | 9.16e-04 | NA | NA |
| 5. P | Q75FR2 | Cobalamin biosynthesis protein CobD | 1.14e-03 | 1.38e-02 | NA | NA |
| 5. P | Q8DI68 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 2 | 1.50e-08 | 6.73e-16 | NA | NA |
| 5. P | P32063 | Palmitoyl-[acyl-carrier-protein] 4-desaturase, chloroplastic | 1.09e-04 | 6.75e-06 | NA | NA |
| 5. P | Q9ZCW2 | Uncharacterized protein RP592 | 4.60e-06 | 2.27e-03 | NA | NA |
| 5. P | Q7U6Y8 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.22e-05 | 9.82e-15 | NA | NA |
| 5. P | A1V0S8 | 3-demethoxyubiquinol 3-hydroxylase | 9.85e-08 | 2.79e-03 | NA | NA |
| 5. P | Q3JNC9 | 3-demethoxyubiquinol 3-hydroxylase | 9.43e-08 | 6.09e-03 | NA | NA |
| 5. P | Q3SGX7 | 3-demethoxyubiquinol 3-hydroxylase | 4.96e-08 | 1.69e-02 | NA | NA |
| 5. P | P21395 | Xylene monooxygenase subunit 1 | 2.51e-03 | 4.91e-02 | NA | NA |
| 5. P | E3PZS2 | Palmitoyl-[acyl-carrier-protein] 4-desaturase 2, chloroplastic | 1.43e-04 | 1.26e-09 | NA | NA |
| 5. P | A6UUW7 | Probable cobalamin biosynthesis protein CobD | 1.09e-03 | 4.95e-02 | NA | NA |
| 5. P | E3PZS1 | Palmitoyl-[acyl-carrier-protein] 4-desaturase 1, chloroplastic | 7.98e-05 | 5.57e-09 | NA | NA |
| 5. P | Q00460 | Toluene-4-monooxygenase system, hydroxylase component subunit beta | 2.17e-08 | 9.39e-05 | NA | NA |
| 5. P | Q2SZJ3 | 3-demethoxyubiquinol 3-hydroxylase | 9.92e-08 | 3.96e-03 | NA | NA |
| 5. P | B0TZT4 | 3-demethoxyubiquinol 3-hydroxylase | 4.39e-08 | 1.37e-03 | NA | NA |
| 5. P | Q84VY3 | Stearoyl-[acyl-carrier-protein] 9-desaturase 6, chloroplastic | 1.04e-04 | 8.27e-06 | NA | NA |
| 5. P | C5CPL7 | 3-demethoxyubiquinol 3-hydroxylase | 9.10e-08 | 8.16e-04 | NA | NA |
| 5. P | Q01038 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.18e-24 | NA | NA |
| 5. P | B0KK40 | 3-demethoxyubiquinol 3-hydroxylase | 5.71e-08 | 2.74e-02 | NA | NA |
| 5. P | P9WKQ5 | Uncharacterized protein Rv0885 | 1.41e-06 | 5.24e-20 | NA | NA |
| 5. P | Q0K6L4 | 3-demethoxyubiquinol 3-hydroxylase | 5.33e-08 | 2.30e-02 | NA | NA |
| 5. P | Q118B4 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.76e-05 | 5.55e-21 | NA | NA |
| 5. P | P49723 | Ribonucleoside-diphosphate reductase small chain 2 | 2.32e-12 | 8.01e-35 | NA | NA |
| 5. P | Q768T3 | Propane 2-monooxygenase, hydroxylase component small subunit | 1.82e-08 | 1.85e-02 | NA | NA |
| 5. P | Q39JY0 | 3-demethoxyubiquinol 3-hydroxylase | 7.40e-08 | 2.81e-02 | NA | NA |
| 5. P | A7NC15 | 3-demethoxyubiquinol 3-hydroxylase | 4.36e-08 | 1.21e-03 | NA | NA |
| 5. P | A2S5V5 | 3-demethoxyubiquinol 3-hydroxylase | 1.06e-07 | 2.79e-03 | NA | NA |
| 5. P | A4XZC2 | 3-demethoxyubiquinol 3-hydroxylase | 5.46e-08 | 8.75e-03 | NA | NA |
| 5. P | Q9LD46 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1, chloroplastic | 4.00e-05 | 1.30e-03 | NA | NA |
| 5. P | P19730 | Phenol hydroxylase P1 protein | 7.13e-09 | 8.92e-06 | NA | NA |
| 5. P | Q6GZQ8 | Putative ribonucleoside-diphosphate reductase small subunit 067L | NA | 3.18e-11 | NA | NA |
| 5. P | Q88QR1 | 3-demethoxyubiquinol 3-hydroxylase | 5.00e-08 | 1.43e-02 | NA | NA |
| 5. P | Q8XLK2 | Cobalamin biosynthesis protein CobD | 1.09e-03 | 2.55e-02 | NA | NA |
| 5. P | P22243 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.43e-04 | 6.12e-05 | NA | NA |
| 5. P | P32062 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 2.37e-04 | 3.39e-03 | NA | NA |
| 5. P | Q55688 | Aldehyde decarbonylase | 3.70e-13 | 2.07e-03 | NA | NA |
| 5. P | A3CL57 | Cobalamin biosynthesis protein CobD | 8.58e-04 | 4.66e-02 | NA | NA |
| 5. P | Q1LIL6 | 3-demethoxyubiquinol 3-hydroxylase | 5.04e-08 | 3.22e-02 | NA | NA |
| 5. P | Q66662 | Ribonucleoside-diphosphate reductase small subunit | NA | 6.71e-20 | NA | NA |
| 5. P | B3Q7D4 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 3.19e-06 | 9.53e-14 | NA | NA |
| 5. P | Q9M591 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic | 3.79e-06 | 1.38e-04 | NA | NA |
| 5. P | E3PZS3 | Palmitoyl-[acyl-carrier-protein] 4-desaturase 2, chloroplastic | 1.30e-04 | 1.07e-07 | NA | NA |
| 5. P | P9WKQ4 | Uncharacterized protein MT0908 | 3.43e-06 | 8.19e-20 | NA | NA |
| 5. P | P9WNZ4 | Putative acyl-[acyl-carrier-protein] desaturase DesA2 | 1.45e-05 | 1.09e-12 | NA | NA |
| 5. P | Q9M879 | Stearoyl-[acyl-carrier-protein] 9-desaturase 5, chloroplastic | 1.65e-04 | 1.37e-03 | NA | NA |
| 5. P | Q01319 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.14e-24 | NA | NA |
| 5. P | A2CDU0 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 4.19e-07 | 5.53e-14 | NA | NA |
| 5. P | Q42807 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 4.12e-04 | 4.15e-06 | NA | NA |
| 5. P | Q0SJK7 | Propane 2-monooxygenase, hydroxylase component small subunit | 2.46e-08 | 3.47e-04 | NA | NA |
| 5. P | B1XT00 | 3-demethoxyubiquinol 3-hydroxylase | 4.97e-08 | 2.25e-03 | NA | NA |
| 5. P | P27354 | Methane monooxygenase component A beta chain | 2.65e-07 | 1.76e-05 | NA | NA |
| 5. P | Q8S059 | Stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic | 1.19e-04 | 1.89e-05 | NA | NA |
| 5. P | P10224 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.76e-24 | NA | NA |
| 5. P | P51277 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.71e-05 | 4.08e-19 | NA | NA |
| 5. P | O22832 | Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic | 1.44e-04 | 1.37e-03 | NA | NA |
| 5. P | P29883 | Ribonucleoside-diphosphate reductase small chain | NA | 1.96e-28 | NA | NA |
| 5. P | P46253 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.52e-04 | 7.00e-04 | NA | NA |
| 5. P | Q41510 | Acyl-[acyl-carrier-protein] 6-desaturase | 9.71e-05 | 1.56e-06 | NA | NA |
| 5. P | A4SV64 | 3-demethoxyubiquinol 3-hydroxylase | 1.81e-07 | 3.79e-03 | NA | NA |
| 5. P | A1WHG6 | 3-demethoxyubiquinol 3-hydroxylase | 1.85e-07 | 3.21e-03 | NA | NA |
| 5. P | Q6N9J7 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.50e-05 | 1.61e-13 | NA | NA |
| 5. P | B8A7A3 | Stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic | 1.12e-04 | 2.13e-05 | NA | NA |
| 5. P | Q7NFA1 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 7.60e-06 | 1.83e-17 | NA | NA |
| 5. P | Q7V6D4 | Aldehyde decarbonylase | 5.78e-13 | 2.04e-05 | NA | NA |
| 5. P | A4IY33 | 3-demethoxyubiquinol 3-hydroxylase | 4.47e-08 | 1.80e-03 | NA | NA |
| 5. P | P43935 | Uncharacterized protein HI_0077 | 2.57e-06 | 1.82e-05 | NA | NA |
| 5. P | C1D7C0 | 3-demethoxyubiquinol 3-hydroxylase | 9.27e-08 | 2.18e-02 | NA | NA |
| 5. P | A2YS71 | Acyl-[acyl-carrier-protein] desaturase 6, chloroplastic | 3.62e-04 | 1.90e-03 | NA | NA |
| 5. P | Q197B2 | Probable ribonucleoside-diphosphate reductase small subunit 048L | NA | 7.41e-20 | NA | NA |
| 5. P | P0A5D6 | Uncharacterized protein Mb0909 | 2.62e-07 | 5.24e-20 | NA | NA |
| 5. P | A2BWG6 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.67e-08 | 3.37e-08 | NA | NA |
| 5. P | A5GKR3 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.35e-05 | 4.40e-13 | NA | NA |
| 5. P | Q97LH9 | Cobalamin biosynthesis protein CobD | 1.40e-03 | 2.78e-02 | NA | NA |
| 5. P | P9WNZ6 | Putative acyl-[acyl-carrier-protein] desaturase DesA1 | 4.01e-04 | 7.11e-15 | NA | NA |
| 5. P | B9F058 | Acyl-[acyl-carrier-protein] desaturase 3, chloroplastic | 1.60e-04 | 3.45e-06 | NA | NA |
| 5. P | A4VHK4 | 3-demethoxyubiquinol 3-hydroxylase | 5.35e-08 | 1.08e-02 | NA | NA |
| 5. P | Q7T6Y9 | Ribonucleoside-diphosphate reductase small chain | NA | 6.02e-08 | NA | NA |
| 5. P | A1W3V1 | 3-demethoxyubiquinol 3-hydroxylase | 4.21e-08 | 5.46e-03 | NA | NA |
| 5. P | B2UCY7 | 3-demethoxyubiquinol 3-hydroxylase | 1.51e-06 | 1.24e-02 | NA | NA |
| 5. P | A9I769 | 3-demethoxyubiquinol 3-hydroxylase | 1.13e-06 | 3.28e-02 | NA | NA |
| 5. P | Q0J7E4 | Acyl-[acyl-carrier-protein] desaturase 6, chloroplastic | 4.24e-04 | 4.17e-02 | NA | NA |
| 5. P | C3K303 | 3-demethoxyubiquinol 3-hydroxylase | 6.40e-08 | 1.02e-02 | NA | NA |
| 5. P | Q8EXQ8 | Cobalamin biosynthesis protein CobD | 1.14e-03 | 1.38e-02 | NA | NA |
| 5. P | P0C8I2 | Ribonucleoside-diphosphate reductase small chain | NA | 2.12e-31 | NA | NA |
| 5. P | B2SH27 | 3-demethoxyubiquinol 3-hydroxylase | 4.14e-08 | 1.80e-03 | NA | NA |
| 5. P | Q6B8U1 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.94e-05 | 6.80e-15 | NA | NA |
| 5. P | Q63QI7 | 3-demethoxyubiquinol 3-hydroxylase | 1.00e-07 | 6.09e-03 | NA | NA |
| 5. P | Q132P2 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 5.28e-07 | 3.09e-13 | NA | NA |
| 5. P | Q96456 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 8.75e-05 | 9.58e-05 | NA | NA |
| 5. P | P26713 | Ribonucleoside-diphosphate reductase small chain | NA | 1.73e-29 | NA | NA |
| 5. P | Q48NP2 | 3-demethoxyubiquinol 3-hydroxylase | 6.14e-08 | 1.09e-03 | NA | NA |
| 5. P | A0Q6K1 | 3-demethoxyubiquinol 3-hydroxylase | 4.74e-08 | 2.47e-03 | NA | NA |
| 5. P | Q7VBV0 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.88e-07 | 2.22e-16 | NA | NA |
| 5. P | A9KB88 | 3-demethoxyubiquinol 3-hydroxylase | 1.04e-07 | 3.67e-02 | NA | NA |
| 5. P | Q31AS9 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.84e-08 | 1.17e-09 | NA | NA |
| 5. P | B4E6K2 | 3-demethoxyubiquinol 3-hydroxylase | 7.62e-08 | 4.81e-03 | NA | NA |
| 5. P | Q5MZZ2 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 4.40e-05 | 6.07e-18 | NA | NA |
| 5. P | Q1BZH3 | 3-demethoxyubiquinol 3-hydroxylase | 7.93e-08 | 9.31e-03 | NA | NA |
| 5. P | P11156 | Ribonucleoside-diphosphate reductase subunit beta | NA | 7.37e-25 | NA | NA |
| 5. P | Q54764 | Aldehyde decarbonylase | 3.20e-13 | 2.79e-04 | NA | NA |
| 5. P | P74134 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 2 | 6.58e-05 | 8.88e-14 | NA | NA |
| 5. P | Q14IS8 | 3-demethoxyubiquinol 3-hydroxylase | 4.25e-08 | 1.80e-03 | NA | NA |
| 5. P | A3PD22 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.77e-05 | 1.84e-07 | NA | NA |
| 5. P | P9WH69 | R2-like ligand binding oxidase | 8.55e-14 | 3.65e-23 | NA | NA |
| 5. P | B9MDA8 | 3-demethoxyubiquinol 3-hydroxylase | 4.77e-08 | 3.89e-03 | NA | NA |
| 5. P | Q8DJ05 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1 | 7.61e-06 | 6.00e-09 | NA | NA |
| 5. P | P0C8I0 | Ribonucleoside-diphosphate reductase small chain | NA | 2.29e-28 | NA | NA |
| 5. P | O24428 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.34e-04 | 7.59e-06 | NA | NA |
| 5. P | Q8YVU4 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 2 | 4.30e-06 | 6.58e-17 | NA | NA |
| 5. P | B1JE29 | 3-demethoxyubiquinol 3-hydroxylase | 4.90e-08 | 1.00e-02 | NA | NA |
| 5. P | A5EQ73 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 9.52e-06 | 1.08e-16 | NA | NA |
| 5. P | A5VXM0 | 3-demethoxyubiquinol 3-hydroxylase | 5.00e-08 | 1.65e-02 | NA | NA |
| 5. P | Q6Z1I5 | Acyl-[acyl-carrier-protein] desaturase 7, chloroplastic | 2.43e-04 | 1.17e-04 | NA | NA |
| 5. P | Q9AR22 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 2, chloroplastic | 2.58e-05 | 2.14e-02 | NA | NA |
| 5. P | Q9LF04 | Stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic | 1.89e-04 | 1.58e-02 | NA | NA |
| 5. P | F5HAW0 | Ribonucleoside-diphosphate reductase small subunit | NA | 3.34e-23 | NA | NA |
| 5. P | A8G4Z1 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.62e-08 | 1.49e-08 | NA | NA |
| 5. P | E3PZS0 | Palmitoyl-[acyl-carrier-protein] 4-desaturase 3, chloroplastic | 1.80e-04 | 1.07e-06 | NA | NA |
| 5. P | Q7N2S6 | Cobalamin biosynthesis protein CobD | 6.70e-04 | 2.09e-02 | NA | NA |
| 5. P | Q62GR7 | 3-demethoxyubiquinol 3-hydroxylase | 8.46e-08 | 2.79e-03 | NA | NA |
| 5. P | Q43593 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.23e-04 | 1.82e-05 | NA | NA |
| 5. P | P9WNZ5 | Putative acyl-[acyl-carrier-protein] desaturase DesA2 | 1.45e-05 | 1.09e-12 | NA | NA |
| 5. P | A3NDX4 | 3-demethoxyubiquinol 3-hydroxylase | 9.86e-08 | 1.16e-02 | NA | NA |
| 5. P | P42492 | Ribonucleoside-diphosphate reductase small chain | NA | 1.99e-35 | NA | NA |
| 5. P | P0DJN9 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.56e-06 | 4.97e-17 | NA | NA |
| 5. P | E3PZR9 | Palmitoyl-[acyl-carrier-protein] 4-desaturase 3, chloroplastic | 1.06e-04 | 1.07e-06 | NA | NA |
| 5. P | P69520 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.59e-22 | NA | NA |
| 5. P | A9BAI8 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 8.03e-09 | 2.76e-15 | NA | NA |
| 5. P | F2RB83 | Non-heme di-iron N-oxygenase | 1.28e-05 | 8.38e-14 | NA | NA |
| 5. P | Q8YX57 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1 | 1.92e-05 | 9.31e-18 | NA | NA |
| 5. P | Q47IC7 | 3-demethoxyubiquinol 3-hydroxylase | 8.54e-08 | 2.86e-02 | NA | NA |
| 5. P | Q9AIX7 | Benzoyl-CoA oxygenase component B | 2.65e-04 | 2.94e-05 | NA | NA |
| 5. P | P20493 | Ribonucleoside-diphosphate reductase small chain | NA | 3.17e-28 | NA | NA |
| 5. P | A0K476 | 3-demethoxyubiquinol 3-hydroxylase | 8.05e-08 | 9.31e-03 | NA | NA |
| 5. P | Q2RNK3 | 3-demethoxyubiquinol 3-hydroxylase | 9.39e-05 | 3.31e-02 | NA | NA |
| 5. P | P9WNZ7 | Putative acyl-[acyl-carrier-protein] desaturase DesA1 | 3.96e-04 | 7.11e-15 | NA | NA |
| 5. P | Q8YRZ2 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 3 | 1.65e-05 | 4.93e-21 | NA | NA |
| 5. P | P50645 | Ribonucleoside-diphosphate reductase small subunit | NA | 8.68e-24 | NA | NA |
| 5. P | Q40731 | Stearoyl-[acyl-carrier-protein] 9-desaturase 5, chloroplastic | 1.38e-04 | 5.62e-06 | NA | NA |
| 5. P | P18798 | Methane monooxygenase component A beta chain | 1.68e-07 | 1.01e-07 | NA | NA |
| 5. P | P69521 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.59e-22 | NA | NA |
| 5. P | A2BR98 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.68e-08 | 6.45e-09 | NA | NA |
| 5. P | Q9ZET3 | Alkene monooxygenase system, oxygenase component subunit beta | 1.34e-08 | 1.51e-07 | NA | NA |
| 5. P | B8AIC3 | Acyl-[acyl-carrier-protein] desaturase 3, chloroplastic | 1.72e-04 | 3.89e-06 | NA | NA |
| 5. P | A2YS76 | Acyl-[acyl-carrier-protein] desaturase 7, chloroplastic | 3.60e-04 | 1.17e-04 | NA | NA |
| 5. P | P50644 | Ribonucleoside-diphosphate reductase small subunit | NA | 5.27e-29 | NA | NA |
| 5. P | P29108 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.32e-04 | 1.87e-03 | NA | NA |
| 5. P | Q9TLR8 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.26e-05 | 2.08e-17 | NA | NA |
| 5. P | Q31LY2 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 4.64e-05 | 6.07e-18 | NA | NA |
| 5. P | I7FA35 | Propane 2-monooxygenase, hydroxylase component small subunit | 1.79e-08 | 7.51e-06 | NA | NA |
| 5. P | Q2A3K5 | 3-demethoxyubiquinol 3-hydroxylase | 5.53e-08 | 1.21e-03 | NA | NA |
| 5. P | A2WYF4 | Stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic | 1.42e-04 | 1.89e-05 | NA | NA |
| 5. P | E9RFT1 | Propane 2-monooxygenase, hydroxylase component small subunit | 1.39e-08 | 2.86e-06 | NA | NA |
| 5. P | Q1IFZ3 | 3-demethoxyubiquinol 3-hydroxylase | 5.59e-08 | 2.83e-02 | NA | NA |
| 5. P | Q0IAL0 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.43e-05 | 3.65e-12 | NA | NA |
| 5. P | O57175 | Ribonucleoside-diphosphate reductase small chain | NA | 3.36e-28 | NA | NA |
| 5. P | Q1XDK9 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.75e-05 | 1.72e-19 | NA | NA |
| 5. P | I0HUK7 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.98e-06 | 2.04e-15 | NA | NA |
| 5. P | A2SKI7 | 3-demethoxyubiquinol 3-hydroxylase | 1.15e-07 | 4.39e-02 | NA | NA |
| 5. P | Q12FJ1 | 3-demethoxyubiquinol 3-hydroxylase | 6.82e-08 | 7.13e-04 | NA | NA |
| 5. P | A4G1T0 | 3-demethoxyubiquinol 3-hydroxylase | 5.93e-08 | 8.75e-03 | NA | NA |
| 5. P | P11158 | Ribonucleoside-diphosphate reductase small chain | NA | 3.11e-28 | NA | NA |
| 5. P | Q945B7 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic | 5.43e-05 | 3.19e-06 | NA | NA |
| 5. P | C1DHY3 | 3-demethoxyubiquinol 3-hydroxylase | 5.35e-08 | 1.30e-02 | NA | NA |
| 5. P | Q0BM15 | 3-demethoxyubiquinol 3-hydroxylase | 5.36e-08 | 1.21e-03 | NA | NA |
| 5. P | A1VJY7 | 3-demethoxyubiquinol 3-hydroxylase | 9.50e-08 | 6.73e-04 | NA | NA |
| 5. P | Q7V3Y9 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 3.68e-07 | 3.64e-14 | NA | NA |
| 5. P | P06474 | Ribonucleoside-diphosphate reductase small subunit | NA | 1.08e-24 | NA | NA |
| 5. P | Q42770 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 2.63e-04 | 2.61e-04 | NA | NA |
| 5. P | Q2ISZ6 | Aerobic magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 4.65e-07 | 9.67e-14 | NA | NA |
| 5. P | Q08015 | tRNA-(ms[2]io[6]A)-hydroxylase | 1.17e-04 | 3.03e-02 | NA | NA |
| 5. P | Q0BIL1 | 3-demethoxyubiquinol 3-hydroxylase | 7.93e-08 | 3.31e-02 | NA | NA |
| 5. P | B1YSR4 | 3-demethoxyubiquinol 3-hydroxylase | 7.50e-08 | 4.51e-02 | NA | NA |
| 5. P | Q6SJV8 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic | 4.06e-05 | 1.30e-04 | NA | NA |
| 5. P | A5GU20 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase | 1.18e-05 | 2.71e-15 | NA | NA |
| 5. P | P22337 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 1.37e-04 | 1.20e-04 | NA | NA |
| 5. P | Q5NHC6 | 3-demethoxyubiquinol 3-hydroxylase | 4.34e-08 | 1.80e-03 | NA | NA |
| 5. P | P28847 | Ribonucleoside-diphosphate reductase small subunit | NA | 2.32e-29 | NA | NA |
| 5. P | P72584 | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1 | 1.91e-05 | 4.43e-23 | NA | NA |
| 5. P | P0C8I1 | Ribonucleoside-diphosphate reductase small chain | NA | 1.01e-31 | NA | NA |
| 5. P | Q41319 | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic | 8.68e-05 | 8.36e-06 | NA | NA |
| 5. P | Q9DHU2 | Ribonucleoside-diphosphate reductase small chain | NA | 3.84e-23 | NA | NA |