Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54952.1

JCVISYN3A_0775

Ribonuclease R.
M. mycoides homolog: Q6MSC2.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 67
Unique PROST Go: 5
Unique BLAST Go: 13
Unique Foldseek Go: 0

Total Homologs: 362
Unique PROST Homologs: 65
Unique BLAST Homologs: 151
Unique Foldseek Homologs: 2

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rnr; Ribonuclease R
Zhang et al. [4]: GO:0000175|3'-5'-exoribonuclease activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q1C7L1 (Exoribonuclease 2) with a FATCAT P-Value: 0 and RMSD of 3.19 angstrom. The sequence alignment identity is 25.6%.
Structural alignment shown in left. Query protein AVX54952.1 colored as red in alignment, homolog Q1C7L1 colored as blue. Query protein AVX54952.1 is also shown in right top, homolog Q1C7L1 showed in right bottom. They are colored based on secondary structures.

  AVX54952.1 MESKIIEILKKNHHKISLNKLLTYFKALDYSLVKNYLDQLEKNNNIAISLENNIYLLDEIYKKGTIKLNPKGFGFINDVNDLTTEDHFIAGVDLNNSIHQ 100
      Q1C7L1 -----------------------MFQ--DNPL----LAQL-KQQ-----LHTQTPRVEGVV-KGT----EKGFGFL-EV-D-GQKSYFIPPPQMKKVMHG 57

  AVX54952.1 DEVVYILKQEEDNRL--KAIVID-LIKRNKVYLIGEINRSFDKRFLDFIPNDKSF--DSFRFVIVNK--NEFKYEEFNIIKAKIISCKERKIFIRLIKII 193
      Q1C7L1 DRIIATLHTDKDREIAEPETLVEPFLSR----FVGRVQRK-DDR-LSIVP-DHPLLRDAIQCRPVRELTHSFQNGDWAV--AEM--CR------HPLK-- 138

  AVX54952.1 GNSKKASDRILAIAEEFDIKTSFDKQTLDNAKQ--INLSTDKLEKEF------------LKRQNNSLVNKTIVTIDGIDSKDLDDAICVEKLEN--NNYK 277
      Q1C7L1 G------DR----AFQADL-TAFITNGEDHFVPWWVTLARHNLEREAPAMVESALNDAELEREDLTALN--FVTIDSASTEDMDDALFVQ--DNGDGSWL 223

  AVX54952.1 LFVAIAD-VSYFVRYKTSLDKEALLRGNSTYL--ANKVIPMLPNILSDDLCSLNPNTKKLVFVCEMEFDNNANMLNKKV-YESVII-SKARLNYDEVNNY 372
      Q1C7L1 LTIAIADPTAYVVE-NSELDLTARKRAFTNYLPGFN--IPMLPRDLSDNLCSLRPNERRPVLVCRVTI-TEEGTLSNDIRFSAAWVESKAKLVYDDVSDW 319

  AVX54952.1 FK-TKTWTHDDKTKKMLDIAYE--LYKKLEDLKA---KKGTISF-DVREP--KIIL-DKNLNVIDIKTKTADQ---AEKLIEQFMVSCNEAVAELIYQKD 459
      Q1C7L1 LEGNNRWQPQD-TA----IAEQITLLKRICDARSNWRQQHALVFKD-R-PDYRFLLGEKG-EVLDI---IVEHRRIANRIVEECMIAAN-VCAALALREH 407

  AVX54952.1 LPF-LYRNHNKPDEDELINWYKS-LKTFGI--NPK--LTNKQVLDPIFINHTLSQIKEQIKDETEVELLNISLLRYMDKAKYGLENI-G-HFGLASDCYT 551
      Q1C7L1 LGFGIYNVHTGFD-PALVEQAASVLKANGVGADPQALLT----L-PGF-----CELRRHL-DALPTQFLDSRIRRFQTFAE--ISTVPGPHFGLGLEAYA 493

  AVX54952.1 HFTSPIRRYSDLLVHRYLKQYLIT-KDLEKTSLENNTNYVNKVSNIINDTETKSVE--CEREVIKACMCEYMLNKVNNT---YTATISAVLKFGIFIQ-L 644
      Q1C7L1 TWTSPIRKYGDMVNHRLLKA-MITGQQAEKPQ-EEIT--VQ-LA------ERRRLNRMAERDVGDWLYARY-LQPQAGTDTRFTAEIIDITRGGLRVRLL 581

  AVX54952.1 DNLVEGLV------HISNMNSDLV-YDETNRILIKPDNTYYRMGQKVKVKLINVDIKKRTIDFVLIE---- 704
      Q1C7L1 DN---GAVAFIPAPFIHAVRDEVVCSQETGTVQIKGE-TVYSQSDKIEVRI--AEVRMETRN--VIARPVA 644

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0034427	nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'
1. PBF	GO:0003723	RNA binding
1. PBF	GO:0000932	P-body
1. PBF	GO:0016075	rRNA catabolic process
1. PBF	GO:0000964	mitochondrial RNA 5'-end processing
1. PBF	GO:0000291	nuclear-transcribed mRNA catabolic process, exonucleolytic
1. PBF	GO:0004532	exoribonuclease activity
1. PBF	GO:0008997	ribonuclease R activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0000963	mitochondrial RNA processing
1. PBF	GO:0000178	exosome (RNase complex)
1. PBF	GO:0000177	cytoplasmic exosome (RNase complex)
1. PBF	GO:0045025	mitochondrial degradosome
1. PBF	GO:1990074	polyuridylation-dependent mRNA catabolic process
1. PBF	GO:0000175	3'-5'-exoribonuclease activity
1. PBF	GO:0008859	exoribonuclease II activity
1. PBF	GO:0010587	miRNA catabolic process
1. PBF	GO:0006402	mRNA catabolic process
2. PF	GO:0080156	mitochondrial mRNA modification
2. PF	GO:0005829	cytosol
4. PB	GO:0004540	ribonuclease activity
4. PB	GO:0008266	poly(U) RNA binding
4. PB	GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process
4. PB	GO:0005886	plasma membrane
4. PB	GO:0070651	nonfunctional rRNA decay
4. PB	GO:0033621	nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts
4. PB	GO:0070481	nuclear-transcribed mRNA catabolic process, non-stop decay
4. PB	GO:0071027	nuclear RNA surveillance
4. PB	GO:0000467	exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
4. PB	GO:0034458	3'-5' RNA helicase activity
4. PB	GO:0071031	nuclear mRNA surveillance of mRNA 3'-end processing
4. PB	GO:1990251	nuclear exosome focus
4. PB	GO:0005524	ATP binding
4. PB	GO:0019827	stem cell population maintenance
4. PB	GO:0034470	ncRNA processing
4. PB	GO:0070478	nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay
4. PB	GO:0071038	nuclear polyadenylation-dependent tRNA catabolic process
4. PB	GO:0030847	termination of RNA polymerase II transcription, exosome-dependent
4. PB	GO:0036450	polyuridylation-dependent decapping of nuclear-transcribed mRNA
4. PB	GO:0071039	nuclear polyadenylation-dependent CUT catabolic process
4. PB	GO:0000957	mitochondrial RNA catabolic process
4. PB	GO:0000176	nuclear exosome (RNase complex)
4. PB	GO:0043628	ncRNA 3'-end processing
4. PB	GO:0071034	CUT catabolic process
4. PB	GO:0000465	exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
4. PB	GO:0071042	nuclear polyadenylation-dependent mRNA catabolic process
4. PB	GO:0004519	endonuclease activity
4. PB	GO:0000965	mitochondrial RNA 3'-end processing
4. PB	GO:0051306	mitotic sister chromatid separation
5. P	GO:0042659	regulation of cell fate specification
5. P	GO:0006426	glycyl-tRNA aminoacylation
5. P	GO:0006420	arginyl-tRNA aminoacylation
5. P	GO:0004820	glycine-tRNA ligase activity
5. P	GO:0004814	arginine-tRNA ligase activity
7. B	GO:0043253	chloroplast ribosome
7. B	GO:0003677	DNA binding
7. B	GO:0006396	RNA processing
7. B	GO:0060237	regulation of fungal-type cell wall organization
7. B	GO:1903450	regulation of G1 to G0 transition
7. B	GO:1905538	polysome binding
7. B	GO:0005634	nucleus
7. B	GO:0006401	RNA catabolic process
7. B	GO:0046872	metal ion binding
7. B	GO:0000287	magnesium ion binding
7. B	GO:0004654	polyribonucleotide nucleotidyltransferase activity
7. B	GO:0061770	translation elongation factor binding
7. B	GO:0003729	mRNA binding

Uniprot GO Annotations

GO	Description
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic
GO:0003723	RNA binding
GO:0090305	nucleic acid phosphodiester bond hydrolysis
GO:0004527	exonuclease activity
GO:0004540	ribonuclease activity
GO:0005737	cytoplasm
GO:0004518	nuclease activity
GO:0090501	RNA phosphodiester bond hydrolysis
GO:0003676	nucleic acid binding
GO:0016070	RNA metabolic process
GO:0016787	hydrolase activity
GO:0008859	exoribonuclease II activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q1C7L1	Exoribonuclease 2	0.00e+00	5.49e-46	9.99e-33	0.8247
1. PBF	C6DK05	Exoribonuclease 2	0.00e+00	1.94e-45	9.80e-36	0.8062
1. PBF	Q8ZED8	Exoribonuclease 2	0.00e+00	5.49e-46	9.99e-33	0.8282
1. PBF	Q0V9R3	DIS3-like exonuclease 2	0.00e+00	4.03e-21	1.95e-35	0.748
1. PBF	P30851	Ribonuclease R	0.00e+00	4.63e-36	4.35e-95	0.8516
1. PBF	P56123	Ribonuclease R	0.00e+00	7.75e-53	1.35e-39	0.8013
1. PBF	B8D7G3	Exoribonuclease 2	0.00e+00	3.31e-49	1.71e-30	0.8252
1. PBF	B7NVR1	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8183
1. PBF	Q8K9Q5	Exoribonuclease 2	0.00e+00	1.57e-49	1.61e-33	0.8327
1. PBF	Q98QL0	Ribonuclease R	0.00e+00	7.34e-67	1.43e-97	0.8283
1. PBF	C0Q3R1	Exoribonuclease 2	0.00e+00	1.08e-44	7.73e-37	0.8144
1. PBF	Q4QJL5	Exoribonuclease 2	0.00e+00	3.02e-46	1.94e-38	0.7801
1. PBF	B5XS03	Exoribonuclease 2	0.00e+00	9.63e-47	2.59e-37	0.8151
1. PBF	A1JM34	Exoribonuclease 2	0.00e+00	2.95e-46	8.68e-31	0.8215
1. PBF	Q8FHT6	Exoribonuclease 2	0.00e+00	3.43e-48	1.79e-37	0.8097
1. PBF	A7MMD8	Exoribonuclease 2	0.00e+00	1.94e-45	1.28e-34	0.8149
1. PBF	Q0T5B1	Exoribonuclease 2	0.00e+00	2.57e-48	1.00e-37	0.8102
1. PBF	Q86MA2	Mitochondrial exoribonuclease DSS-1	2.68e-09	5.79e-16	1.73e-06	0.6023
1. PBF	O32231	Ribonuclease R	0.00e+00	3.02e-37	3.08e-111	0.8627
1. PBF	B1LGE7	Exoribonuclease 2	0.00e+00	1.04e-47	1.96e-37	0.8098
1. PBF	A5F0G1	Exoribonuclease 2	0.00e+00	6.67e-40	1.22e-33	0.7671
1. PBF	A9MQ20	Exoribonuclease 2	0.00e+00	8.17e-45	4.20e-37	0.819
1. PBF	O67834	Ribonuclease R	0.00e+00	1.09e-78	6.93e-92	0.8386
1. PBF	P59107	Exoribonuclease 2	0.00e+00	2.25e-48	1.96e-37	0.8151
1. PBF	A5UFG3	Exoribonuclease 2	0.00e+00	1.25e-46	4.05e-39	0.7733
1. PBF	Q8Z7C9	Exoribonuclease 2	0.00e+00	1.75e-45	1.53e-36	0.8121
1. PBF	B1XBN7	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8201
1. PBF	Q9KLE1	Exoribonuclease 2	0.00e+00	4.53e-40	2.52e-34	0.7668
1. PBF	A9MWU8	Exoribonuclease 2	0.00e+00	3.69e-45	2.62e-37	0.8117
1. PBF	B7UR96	Exoribonuclease 2	0.00e+00	4.47e-48	3.27e-37	0.816
1. PBF	B7LY47	Exoribonuclease 2	0.00e+00	4.02e-48	7.26e-38	0.8159
1. PBF	C3LW69	Exoribonuclease 2	0.00e+00	4.53e-40	2.52e-34	0.7646
1. PBF	Q02146	Ribonuclease R 2	0.00e+00	3.87e-63	5.65e-84	0.8831
1. PBF	A4TJ37	Exoribonuclease 2	0.00e+00	5.49e-46	9.99e-33	0.8286
1. PBF	P57354	Exoribonuclease 2	0.00e+00	2.75e-49	5.39e-31	0.8234
1. PBF	B2K4J2	Exoribonuclease 2	0.00e+00	2.89e-47	2.77e-33	0.8232
1. PBF	P75529	Ribonuclease R	0.00e+00	5.68e-84	6.69e-79	0.8413
1. PBF	B4T6U4	Exoribonuclease 2	0.00e+00	2.58e-45	1.19e-36	0.818
1. PBF	Q9PR88	Ribonuclease R	0.00e+00	1.49e-95	3.63e-100	0.8586
1. PBF	B5R9Y0	Exoribonuclease 2	0.00e+00	2.21e-45	1.66e-37	0.8179
1. PBF	A7ZLA9	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8193
1. PBF	B4TX11	Exoribonuclease 2	0.00e+00	1.94e-45	2.28e-37	0.8181
1. PBF	B7L4C3	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8124
1. PBF	A1AAQ4	Exoribonuclease 2	0.00e+00	4.84e-48	3.20e-38	0.8088
1. PBF	Q1CIZ7	Exoribonuclease 2	0.00e+00	5.49e-46	9.99e-33	0.8251
1. PBF	B7LRZ1	Exoribonuclease 2	0.00e+00	2.75e-47	3.36e-36	0.8115
1. PBF	O84402	Ribonuclease R	0.00e+00	5.96e-31	2.25e-64	0.7836
1. PBF	A7ZZM6	Exoribonuclease 2	0.00e+00	2.31e-48	4.01e-37	0.8097
1. PBF	Q0P4R5	DIS3-like exonuclease 1	6.66e-15	2.61e-11	1.21e-24	0.7306
1. PBF	B1ITG7	Exoribonuclease 2	0.00e+00	2.31e-48	4.01e-37	0.8088
1. PBF	B5YZR8	Exoribonuclease 2	0.00e+00	5.10e-48	1.27e-37	0.8081
1. PBF	B5BIE3	Exoribonuclease 2	0.00e+00	1.19e-45	1.65e-36	0.8184
1. PBF	B8D959	Exoribonuclease 2	0.00e+00	3.31e-49	1.71e-30	0.8253
1. PBF	Q9Z848	Ribonuclease R	0.00e+00	4.83e-43	1.51e-65	0.764
1. PBF	B4EW02	Exoribonuclease 2	0.00e+00	2.97e-47	8.18e-38	0.825
1. PBF	P47350	Ribonuclease R	0.00e+00	8.26e-82	2.19e-76	0.832
1. PBF	Q9ZJX9	Ribonuclease R	0.00e+00	6.58e-54	2.19e-41	0.7923
1. PBF	Q7N4F5	Exoribonuclease 2	0.00e+00	2.34e-49	4.58e-36	0.8216
1. PBF	A0KFR1	Exoribonuclease 2	0.00e+00	9.28e-38	4.44e-32	0.7734
1. PBF	Q057Q9	Exoribonuclease 2	0.00e+00	4.47e-48	1.90e-29	0.8186
1. PBF	Q57NV9	Exoribonuclease 2	0.00e+00	1.08e-44	7.73e-37	0.8182
1. PBF	Q46363	Acetazolamide conferring resistance protein zam	0.00e+00	2.75e-49	4.51e-27	0.7445
1. PBF	Q7VLX8	Exoribonuclease 2	0.00e+00	5.21e-43	1.04e-34	0.7856
1. PBF	Q5R5N8	DIS3-like exonuclease 1	1.17e-14	2.32e-08	1.07e-27	0.7307
1. PBF	Q32GP4	Exoribonuclease 2	0.00e+00	3.81e-48	9.59e-38	0.8092
1. PBF	B3GXJ4	Exoribonuclease 2	0.00e+00	2.85e-48	6.57e-35	0.7967
1. PBF	B5F571	Exoribonuclease 2	0.00e+00	1.94e-45	2.28e-37	0.8177
1. PBF	Q89AM0	Exoribonuclease 2	0.00e+00	5.93e-46	2.73e-30	0.8212
1. PBF	B2U0I4	Exoribonuclease 2	0.00e+00	7.00e-48	1.04e-37	0.8103
1. PBF	Q9PK00	Ribonuclease R	0.00e+00	1.99e-33	7.98e-62	0.7752
1. PBF	A6VN85	Exoribonuclease 2	0.00e+00	2.10e-44	7.56e-33	0.7803
1. PBF	A3N0B9	Exoribonuclease 2	0.00e+00	2.31e-48	9.39e-35	0.792
1. PBF	A7FI01	Exoribonuclease 2	0.00e+00	2.73e-46	1.66e-32	0.8247
1. PBF	A8AG96	Exoribonuclease 2	0.00e+00	5.16e-45	1.74e-34	0.8191
1. PBF	Q8ZP54	Exoribonuclease 2	0.00e+00	3.69e-45	2.62e-37	0.8136
1. PBF	B5R490	Exoribonuclease 2	0.00e+00	4.42e-45	2.71e-37	0.8204
1. PBF	Q8D7K6	Exoribonuclease 2	0.00e+00	8.97e-46	1.08e-30	0.7763
1. PBF	B7MLW3	Exoribonuclease 2	0.00e+00	4.84e-48	3.20e-38	0.8056
1. PBF	D0Z8E6	Exoribonuclease 2	0.00e+00	7.48e-44	2.02e-36	0.8229
1. PBF	P0DM58	DIS3-like exonuclease 2	2.46e-13	3.10e-12	6.56e-38	0.7416
1. PBF	P57628	Ribonuclease R	0.00e+00	2.68e-75	1.09e-75	0.8151
1. PBF	Q65SI5	Exoribonuclease 2	0.00e+00	2.71e-45	7.84e-33	0.7803
1. PBF	Q3Z135	Exoribonuclease 2	0.00e+00	4.35e-48	4.78e-37	0.8099
1. PBF	A1SWZ6	Exoribonuclease 2	0.00e+00	3.30e-47	1.13e-33	0.7989
1. PBF	B5FU93	Exoribonuclease 2	0.00e+00	2.71e-45	1.72e-37	0.8117
1. PBF	B2VKS8	Exoribonuclease 2	0.00e+00	4.95e-46	7.98e-32	0.8124
1. PBF	Q87IJ9	Exoribonuclease 2	0.00e+00	1.14e-44	1.92e-33	0.7674
1. PBF	A4WAX5	Exoribonuclease 2	0.00e+00	1.43e-45	1.42e-35	0.8197
1. PBF	Q31ZY2	Exoribonuclease 2	0.00e+00	7.00e-48	1.04e-37	0.8097
1. PBF	Q9CP74	Exoribonuclease 2	0.00e+00	9.27e-43	5.23e-33	0.7772
1. PBF	Q6GN11	DIS3-like exonuclease 1	1.30e-14	2.75e-12	6.52e-26	0.723
1. PBF	Q8X7D6	Exoribonuclease 2	0.00e+00	5.10e-48	1.27e-37	0.8157
1. PBF	Q66AH3	Exoribonuclease 2	0.00e+00	2.89e-47	2.77e-33	0.8265
1. PBF	Q1LTG8	Exoribonuclease 2	0.00e+00	2.37e-48	5.29e-32	0.8063
1. PBF	B4TJI0	Exoribonuclease 2	0.00e+00	2.71e-45	1.72e-37	0.8207
1. PBF	Q8K917	Ribonuclease R	0.00e+00	3.99e-78	5.02e-86	0.8157
1. PBF	Q9KNY1	Ribonuclease R	0.00e+00	2.36e-36	7.29e-86	0.8403
1. PBF	B7VSB8	Exoribonuclease 2	0.00e+00	3.66e-43	3.86e-30	0.7826
1. PBF	C4ZTY2	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8189
1. PBF	A8GF49	Exoribonuclease 2	0.00e+00	1.12e-47	1.57e-31	0.8192
1. PBF	Q1RC77	Exoribonuclease 2	0.00e+00	2.93e-48	4.39e-38	0.8099
1. PBF	Q7MEL4	Exoribonuclease 2	0.00e+00	4.24e-46	9.15e-31	0.779
1. PBF	B6IA03	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	0.8197
1. PBF	P40611	Ribonuclease R	0.00e+00	3.11e-31	3.97e-90	0.8333
1. PBF	Q9CH00	Ribonuclease R 1	0.00e+00	1.15e-29	9.22e-101	0.8343
1. PBF	A9R8T9	Exoribonuclease 2	0.00e+00	5.49e-46	9.99e-33	0.8291
1. PBF	Q5PCZ6	Exoribonuclease 2	0.00e+00	1.19e-45	1.65e-36	0.8192
1. PBF	A6T7Z4	Exoribonuclease 2	0.00e+00	3.27e-46	4.16e-36	0.8221
1. PBF	Q6D5S7	Exoribonuclease 2	0.00e+00	3.01e-45	4.89e-34	0.814
1. PBF	Q9WZI1	Ribonuclease R	0.00e+00	7.91e-83	8.14e-100	0.783
1. PBF	Q0TI78	Exoribonuclease 2	0.00e+00	3.43e-48	1.79e-37	0.8096
1. PBF	D3V184	Exoribonuclease 2	0.00e+00	5.82e-48	2.25e-37	0.8211
1. PBF	Q2NST6	Exoribonuclease 2	0.00e+00	1.26e-44	4.63e-32	0.8183
1. PBF	B7N4A3	Exoribonuclease 2	0.00e+00	3.52e-48	2.19e-37	0.8094
1. PBF	P73177	Uncharacterized ribonuclease sll1290	1.57e-11	4.33e-21	7.60e-19	0.751
1. PBF	B8F4C5	Exoribonuclease 2	0.00e+00	3.06e-49	1.20e-38	0.8005
1. PBF	B0BP37	Exoribonuclease 2	0.00e+00	1.68e-48	1.41e-35	0.792
1. PBF	P44440	Exoribonuclease 2	0.00e+00	2.46e-46	2.35e-38	0.7827
1. PBF	A0JN80	DIS3-like exonuclease 1	1.09e-14	5.69e-09	1.56e-28	0.7139
1. PBF	B1JKP2	Exoribonuclease 2	0.00e+00	3.44e-46	1.05e-32	0.815
3. BF	P54084	Ribonuclease R (Fragment)	7.44e-15	NA	4.05e-40	0.7618
4. PB	P44907	Ribonuclease R	NA	5.54e-51	1.85e-93	NA
4. PB	Q9Y2L1	Exosome complex exonuclease RRP44	0.00e+00	1.21e-11	1.05e-41	NA
4. PB	P30850	Exoribonuclease 2	0.00e+00	5.98e-48	2.25e-37	NA
4. PB	Q8CI75	DIS3-like exonuclease 2	2.55e-15	2.69e-21	4.84e-34	NA
4. PB	Q08162	Exosome complex exonuclease DIS3	9.84e-13	4.46e-10	4.03e-40	NA
4. PB	Q5AK62	Virulence protein SSD1	5.24e-09	2.25e-04	1.56e-13	NA
4. PB	A2RV18	DIS3-like exonuclease 1	1.09e-14	6.08e-11	7.25e-25	NA
4. PB	P37202	Exosome complex exonuclease dis3	1.94e-14	2.82e-10	3.44e-41	NA
4. PB	Q8C0S1	DIS3-like exonuclease 1	8.66e-15	1.57e-09	4.03e-28	NA
4. PB	O14040	DIS3-like exonuclease 2	0.00e+00	8.91e-17	3.54e-42	NA
4. PB	Q6NQJ6	Ribonuclease II, chloroplastic/mitochondrial	3.74e-10	5.79e-14	7.30e-13	NA
4. PB	Q09568	DIS3-like exonuclease 2	0.00e+00	1.21e-26	2.38e-35	NA
4. PB	Q0WPN0	Inactive exonuclease DIS3L2	2.22e-13	2.34e-12	9.90e-38	NA
4. PB	Q9CSH3	Exosome complex exonuclease RRP44	0.00e+00	9.90e-12	1.22e-40	NA
4. PB	Q5U2P0	DIS3-like exonuclease 1	1.48e-14	6.74e-10	1.35e-29	NA
4. PB	P21499	Ribonuclease R	0.00e+00	9.27e-36	4.35e-95	NA
4. PB	P39112	Exoribonuclease II, mitochondrial	8.64e-09	1.33e-04	0.003	NA
4. PB	Q1MTN7	Exoribonuclease II, mitochondrial	3.18e-07	1.87e-03	1.20e-06	NA
4. PB	Q8IYB7	DIS3-like exonuclease 2	0.00e+00	4.93e-21	1.66e-35	NA
4. PB	Q17632	Probable exosome complex exonuclease RRP44	4.66e-15	5.51e-11	9.19e-34	NA
4. PB	Q9SHL7	Exosome complex exonuclease RRP44 homolog A	1.33e-15	9.85e-11	1.85e-35	NA
4. PB	O94525	Uncharacterized ribonuclease C609.01	4.78e-10	8.12e-04	9.45e-07	NA
4. PB	Q8TF46	DIS3-like exonuclease 1	1.39e-14	3.74e-08	4.13e-27	NA
5. P	A1AHA0	Glycine--tRNA ligase beta subunit	4.67e-01	1.50e-02	NA	NA
5. P	B1X8H5	Glycine--tRNA ligase beta subunit	4.39e-01	1.55e-02	NA	NA
5. P	Q3YVU0	Glycine--tRNA ligase beta subunit	4.25e-01	1.61e-02	NA	NA
5. P	B0V7W2	Glycine--tRNA ligase beta subunit	2.00e-01	3.76e-02	NA	NA
5. P	P67031	Glycine--tRNA ligase beta subunit	4.25e-01	1.50e-02	NA	NA
5. P	A8LS45	Glycine--tRNA ligase beta subunit	2.68e-01	2.69e-02	NA	NA
5. P	B0VQA1	Glycine--tRNA ligase beta subunit	1.96e-01	2.98e-02	NA	NA
5. P	B2HZR3	Glycine--tRNA ligase beta subunit	2.05e-01	2.74e-02	NA	NA
5. P	Q57IG6	Glycine--tRNA ligase beta subunit	4.69e-01	1.43e-02	NA	NA
5. P	B2U566	Glycine--tRNA ligase beta subunit	4.34e-01	2.35e-02	NA	NA
5. P	Q0SY78	Glycine--tRNA ligase beta subunit	4.28e-01	1.58e-02	NA	NA
5. P	C4ZXE9	Glycine--tRNA ligase beta subunit	4.29e-01	1.55e-02	NA	NA
5. P	B8IBI6	Glycine--tRNA ligase beta subunit	2.47e-01	4.92e-02	NA	NA
5. P	P67030	Glycine--tRNA ligase beta subunit	4.22e-01	1.50e-02	NA	NA
5. P	B4TZ49	Glycine--tRNA ligase beta subunit	5.24e-01	2.00e-02	NA	NA
5. P	Q2NJZ2	Phenylalanine--tRNA ligase beta subunit	6.52e-01	3.43e-02	NA	NA
5. P	B7N1L1	Glycine--tRNA ligase beta subunit	4.18e-01	1.50e-02	NA	NA
5. P	A9MLF8	Glycine--tRNA ligase beta subunit	4.75e-01	2.04e-02	NA	NA
5. P	Q8YPT0	Glycine--tRNA ligase beta subunit	2.30e-01	3.98e-02	NA	NA
5. P	Q31V62	Glycine--tRNA ligase beta subunit	4.44e-01	2.40e-02	NA	NA
5. P	B5FLC9	Glycine--tRNA ligase beta subunit	4.66e-01	1.74e-02	NA	NA
5. P	B7KUK7	Glycine--tRNA ligase beta subunit	3.26e-01	2.29e-02	NA	NA
5. P	B7GVW2	Glycine--tRNA ligase beta subunit	2.46e-01	3.76e-02	NA	NA
5. P	B5YVL1	Glycine--tRNA ligase beta subunit	4.05e-01	1.50e-02	NA	NA
5. P	B4T945	Glycine--tRNA ligase beta subunit	4.75e-01	1.75e-02	NA	NA
5. P	C0Q1B6	Glycine--tRNA ligase beta subunit	4.72e-01	1.86e-02	NA	NA
5. P	Q6F7L8	Glycine--tRNA ligase beta subunit	2.75e-01	2.54e-02	NA	NA
5. P	Q8Z2B3	Glycine--tRNA ligase beta subunit	4.24e-01	2.56e-02	NA	NA
5. P	B1IZN4	Glycine--tRNA ligase beta subunit	4.59e-01	1.55e-02	NA	NA
5. P	B7LTH3	Glycine--tRNA ligase beta subunit	2.57e-01	1.45e-02	NA	NA
5. P	A7ZTA5	Glycine--tRNA ligase beta subunit	4.44e-01	1.61e-02	NA	NA
5. P	A4W573	Glycine--tRNA ligase beta subunit	3.93e-01	2.08e-02	NA	NA
5. P	B6INH0	Glycine--tRNA ligase beta subunit	2.01e-01	3.98e-02	NA	NA
5. P	P51346	Phenylalanine--tRNA ligase beta subunit, chloroplastic	7.61e-01	2.12e-02	NA	NA
5. P	B5R4P2	Glycine--tRNA ligase beta subunit	2.48e-01	1.74e-02	NA	NA
5. P	Q0TBP4	Glycine--tRNA ligase beta subunit	2.65e-01	1.50e-02	NA	NA
5. P	B5EX65	Glycine--tRNA ligase beta subunit	3.00e-01	1.61e-02	NA	NA
5. P	B1LJC0	Glycine--tRNA ligase beta subunit	4.75e-01	1.55e-02	NA	NA
5. P	Q328L9	Glycine--tRNA ligase beta subunit	2.76e-01	1.84e-02	NA	NA
5. P	B7L6X3	Glycine--tRNA ligase beta subunit	4.00e-01	1.61e-02	NA	NA
5. P	Q83J38	Glycine--tRNA ligase beta subunit	4.75e-01	1.58e-02	NA	NA
5. P	A7N1D8	Glycine--tRNA ligase beta subunit	3.12e-01	3.80e-02	NA	NA
5. P	P00961	Glycine--tRNA ligase beta subunit	4.32e-01	1.55e-02	NA	NA
5. P	A9MUU1	Glycine--tRNA ligase beta subunit	4.00e-01	1.75e-02	NA	NA
5. P	Q5PLN2	Glycine--tRNA ligase beta subunit	5.34e-01	1.82e-02	NA	NA
5. P	B5BHU1	Glycine--tRNA ligase beta subunit	4.47e-01	1.82e-02	NA	NA
5. P	B8JDD8	Glycine--tRNA ligase beta subunit	4.72e-01	4.53e-02	NA	NA
5. P	B7M3I1	Glycine--tRNA ligase beta subunit	4.74e-01	1.38e-02	NA	NA
5. P	B7NEL0	Glycine--tRNA ligase beta subunit	4.78e-01	1.45e-02	NA	NA
5. P	B4SWK1	Glycine--tRNA ligase beta subunit	2.62e-01	1.75e-02	NA	NA
5. P	Q2IQJ5	Glycine--tRNA ligase beta subunit	3.24e-01	3.15e-02	NA	NA
5. P	B7MER4	Glycine--tRNA ligase beta subunit	4.28e-01	1.50e-02	NA	NA
5. P	B4S277	Glycine--tRNA ligase beta subunit	2.23e-01	2.84e-02	NA	NA
5. P	A6TFH4	Glycine--tRNA ligase beta subunit	2.63e-01	4.53e-02	NA	NA
5. P	Q1R537	Glycine--tRNA ligase beta subunit	4.06e-01	1.50e-02	NA	NA
5. P	B6I3C9	Glycine--tRNA ligase beta subunit	4.10e-01	1.58e-02	NA	NA
5. P	Q5WHD5	Glycine--tRNA ligase beta subunit	1.44e-01	2.59e-02	NA	NA
5. P	B7ULB9	Glycine--tRNA ligase beta subunit	2.36e-01	1.50e-02	NA	NA
5. P	A8A616	Glycine--tRNA ligase beta subunit	4.85e-01	1.55e-02	NA	NA
5. P	B5RGM2	Glycine--tRNA ligase beta subunit	4.29e-01	1.74e-02	NA	NA
5. P	B7IA77	Glycine--tRNA ligase beta subunit	2.03e-01	3.76e-02	NA	NA
5. P	A3M9C2	Glycine--tRNA ligase beta subunit	2.06e-01	3.24e-02	NA	NA
5. P	A8ARE4	Glycine--tRNA ligase beta subunit	2.93e-01	2.71e-02	NA	NA
5. P	B7NP55	Glycine--tRNA ligase beta subunit	4.04e-01	1.55e-02	NA	NA
5. P	Q8ZL96	Glycine--tRNA ligase beta subunit	3.99e-01	1.75e-02	NA	NA
6. F	Q4L695	Conserved virulence factor B	3.39e-01	NA	NA	0.2385
6. F	Q8CSN0	Conserved virulence factor B	2.82e-01	NA	NA	0.2408
7. B	B6J0K5	Polyribonucleotide nucleotidyltransferase	2.50e-01	NA	0.016	NA
7. B	Q7VQM0	Polyribonucleotide nucleotidyltransferase	1.91e-01	NA	0.012	NA
7. B	B7LH99	Polyribonucleotide nucleotidyltransferase	2.16e-01	NA	2.89e-04	NA
7. B	B3GXC1	Polyribonucleotide nucleotidyltransferase	2.32e-01	NA	0.025	NA
7. B	B2K2Q9	Polyribonucleotide nucleotidyltransferase	1.91e-01	NA	0.002	NA
7. B	Q8DQT0	Polyribonucleotide nucleotidyltransferase	2.39e-01	NA	0.014	NA
7. B	C4ZSQ5	Polyribonucleotide nucleotidyltransferase	1.89e-01	NA	2.87e-04	NA
7. B	A1V2L2	Polyribonucleotide nucleotidyltransferase	2.31e-01	NA	0.045	NA
7. B	Q7VL91	Polyribonucleotide nucleotidyltransferase	3.65e-01	NA	0.004	NA
7. B	C5BFC1	Polyribonucleotide nucleotidyltransferase	1.99e-01	NA	0.002	NA
7. B	B2U211	Polyribonucleotide nucleotidyltransferase	2.08e-01	NA	2.89e-04	NA
7. B	Q1QS60	Polyribonucleotide nucleotidyltransferase	2.40e-01	NA	0.014	NA
7. B	A9N728	Polyribonucleotide nucleotidyltransferase	1.41e-01	NA	0.002	NA
7. B	C1CCW4	Polyribonucleotide nucleotidyltransferase	2.15e-01	NA	0.013	NA
7. B	Q32BG9	Polyribonucleotide nucleotidyltransferase	2.05e-01	NA	8.65e-04	NA
7. B	Q2J2J4	Polyribonucleotide nucleotidyltransferase	2.77e-01	NA	0.003	NA
7. B	B6J6S7	Polyribonucleotide nucleotidyltransferase	2.39e-01	NA	0.016	NA
7. B	P37985	30S ribosomal protein S1	6.74e-02	NA	0.041	NA
7. B	A9ND62	Polyribonucleotide nucleotidyltransferase	2.09e-01	NA	0.016	NA
7. B	Q0WBF9	Polyribonucleotide nucleotidyltransferase	1.94e-01	NA	0.003	NA
7. B	C1L2N7	Polyribonucleotide nucleotidyltransferase	3.30e-01	NA	0.018	NA
7. B	P80870	General stress protein 13	3.12e-02	NA	0.004	NA
7. B	B7UJ59	Polyribonucleotide nucleotidyltransferase	2.07e-01	NA	0.002	NA
7. B	E9QAM5	Helicase with zinc finger domain 2	NA	NA	1.21e-06	NA
7. B	Q83JG0	Polyribonucleotide nucleotidyltransferase	2.12e-01	NA	2.87e-04	NA
7. B	P37560	Uncharacterized protein YabR	2.13e-02	NA	0.012	NA
7. B	Q8X9M3	Polyribonucleotide nucleotidyltransferase	1.79e-01	NA	2.89e-04	NA
7. B	P24276	Protein SSD1	9.72e-09	NA	2.47e-14	NA
7. B	B7MB85	Polyribonucleotide nucleotidyltransferase	1.88e-01	NA	0.002	NA
7. B	A8A4Y0	Polyribonucleotide nucleotidyltransferase	2.04e-01	NA	2.87e-04	NA
7. B	Q8YEB7	Polyribonucleotide nucleotidyltransferase	2.57e-01	NA	0.009	NA
7. B	Q3JUB3	Polyribonucleotide nucleotidyltransferase	2.10e-01	NA	0.044	NA
7. B	B4RC48	Polyribonucleotide nucleotidyltransferase	1.81e-01	NA	0.008	NA
7. B	O06000	30S ribosomal protein S1 homolog	3.61e-01	NA	0.013	NA
7. B	B3QAB0	Polyribonucleotide nucleotidyltransferase	2.51e-01	NA	0.009	NA
7. B	B7NDF0	Polyribonucleotide nucleotidyltransferase	2.05e-01	NA	0.002	NA
7. B	B7N0U9	Polyribonucleotide nucleotidyltransferase	2.19e-01	NA	0.002	NA
7. B	Q1C3L8	Polyribonucleotide nucleotidyltransferase	2.27e-01	NA	0.003	NA
7. B	B2S9G0	Polyribonucleotide nucleotidyltransferase	2.47e-01	NA	0.009	NA
7. B	Q9HZ71	30S ribosomal protein S1	8.34e-02	NA	0.014	NA
7. B	A3MI97	Polyribonucleotide nucleotidyltransferase	2.36e-01	NA	0.045	NA
7. B	P0AG70	30S ribosomal protein S1	1.28e-01	NA	0.039	NA
7. B	A6WWW1	Polyribonucleotide nucleotidyltransferase	2.60e-01	NA	0.005	NA
7. B	C0PZ50	Polyribonucleotide nucleotidyltransferase	2.09e-01	NA	0.002	NA
7. B	Q6G0P7	Polyribonucleotide nucleotidyltransferase	2.71e-01	NA	0.035	NA
7. B	P0AG69	30S ribosomal protein S1	6.08e-02	NA	0.039	NA
7. B	B6JCR8	Polyribonucleotide nucleotidyltransferase	2.17e-01	NA	0.050	NA
7. B	Q7MYZ0	Polyribonucleotide nucleotidyltransferase	1.70e-01	NA	0.020	NA
7. B	Q13EM2	Polyribonucleotide nucleotidyltransferase	2.54e-01	NA	0.005	NA
7. B	A0QYY6	30S ribosomal protein S1	2.88e-01	NA	0.014	NA
7. B	Q57JI3	Polyribonucleotide nucleotidyltransferase	1.59e-01	NA	0.002	NA
7. B	B1XGX6	Polyribonucleotide nucleotidyltransferase	2.19e-01	NA	2.87e-04	NA
7. B	B5XSX9	Polyribonucleotide nucleotidyltransferase	1.95e-01	NA	0.002	NA
7. B	A9R5A9	Polyribonucleotide nucleotidyltransferase	2.01e-01	NA	0.003	NA
7. B	B5YS54	Polyribonucleotide nucleotidyltransferase	2.06e-01	NA	2.89e-04	NA
7. B	Q5PL97	Polyribonucleotide nucleotidyltransferase	2.06e-01	NA	0.002	NA
7. B	Q57A96	Polyribonucleotide nucleotidyltransferase	2.46e-01	NA	0.009	NA
7. B	Q31GJ9	Polyribonucleotide nucleotidyltransferase	2.26e-01	NA	0.021	NA
7. B	A6UF34	Polyribonucleotide nucleotidyltransferase	2.84e-01	NA	0.013	NA
7. B	B1IQV7	Polyribonucleotide nucleotidyltransferase	1.93e-01	NA	2.82e-04	NA
7. B	Q83D87	Polyribonucleotide nucleotidyltransferase	2.61e-01	NA	0.016	NA
7. B	Q3YX77	Polyribonucleotide nucleotidyltransferase	1.97e-01	NA	2.89e-04	NA
7. B	Q07V82	Polyribonucleotide nucleotidyltransferase	3.57e-01	NA	0.007	NA
7. B	Q1R6H4	Polyribonucleotide nucleotidyltransferase	1.54e-01	NA	0.002	NA
7. B	Q8D2Y0	Polyribonucleotide nucleotidyltransferase	2.26e-01	NA	0.005	NA
7. B	B5BGJ1	Polyribonucleotide nucleotidyltransferase	1.52e-01	NA	0.002	NA
7. B	Q89WB3	Polyribonucleotide nucleotidyltransferase	1.97e-01	NA	0.008	NA
7. B	P56008	30S ribosomal protein S1	6.62e-02	NA	0.033	NA
7. B	A3NTA2	Polyribonucleotide nucleotidyltransferase	2.36e-01	NA	0.044	NA
7. B	A5VTB6	Polyribonucleotide nucleotidyltransferase	2.13e-01	NA	0.009	NA
7. B	Q493T3	Polyribonucleotide nucleotidyltransferase	2.39e-01	NA	0.004	NA
7. B	Q63VN7	Polyribonucleotide nucleotidyltransferase	2.22e-01	NA	0.044	NA
7. B	A4YJF3	Polyribonucleotide nucleotidyltransferase	2.52e-01	NA	0.009	NA
7. B	Q8Y7F1	Polyribonucleotide nucleotidyltransferase	2.68e-01	NA	0.018	NA
7. B	A0AID2	Polyribonucleotide nucleotidyltransferase	2.65e-01	NA	0.023	NA
7. B	A8LKE7	Polyribonucleotide nucleotidyltransferase	3.49e-01	NA	0.035	NA
7. B	P0AG68	30S ribosomal protein S1	9.01e-02	NA	0.039	NA
7. B	Q0TCU5	Polyribonucleotide nucleotidyltransferase	2.01e-01	NA	0.002	NA
7. B	B1JLX6	Polyribonucleotide nucleotidyltransferase	1.68e-01	NA	0.003	NA
7. B	B8ZMC0	Polyribonucleotide nucleotidyltransferase	2.17e-01	NA	0.014	NA
7. B	B5REN2	Polyribonucleotide nucleotidyltransferase	1.63e-01	NA	0.002	NA
7. B	Q71ZZ1	Polyribonucleotide nucleotidyltransferase	2.76e-01	NA	0.018	NA
7. B	B8DFZ6	Polyribonucleotide nucleotidyltransferase	2.81e-01	NA	0.019	NA
7. B	A3MZU3	Polyribonucleotide nucleotidyltransferase	2.39e-01	NA	0.025	NA
7. B	A1JIX3	Polyribonucleotide nucleotidyltransferase	2.05e-01	NA	3.09e-04	NA
7. B	B7M072	Polyribonucleotide nucleotidyltransferase	2.09e-01	NA	2.82e-04	NA
7. B	A9M9Z8	Polyribonucleotide nucleotidyltransferase	2.49e-01	NA	0.009	NA
7. B	C6DKK7	Polyribonucleotide nucleotidyltransferase	2.13e-01	NA	0.001	NA
7. B	Q8FXS9	Polyribonucleotide nucleotidyltransferase	2.59e-01	NA	0.009	NA
7. B	Q2KE00	Polyribonucleotide nucleotidyltransferase	2.89e-01	NA	0.014	NA
7. B	P05055	Polyribonucleotide nucleotidyltransferase	1.80e-01	NA	2.87e-04	NA
7. B	A4TQU4	Polyribonucleotide nucleotidyltransferase	1.71e-01	NA	0.003	NA
7. B	Q31W43	Polyribonucleotide nucleotidyltransferase	2.13e-01	NA	2.84e-04	NA
7. B	C0RG51	Polyribonucleotide nucleotidyltransferase	2.49e-01	NA	0.009	NA
7. B	Q66F56	Polyribonucleotide nucleotidyltransferase	1.96e-01	NA	0.002	NA
7. B	Q92SW0	Polyribonucleotide nucleotidyltransferase	3.08e-01	NA	0.011	NA
7. B	A2ZLC1	Polyprotein of EF-Ts, chloroplastic	7.21e-01	NA	0.015	NA
7. B	A7FMR8	Polyribonucleotide nucleotidyltransferase	1.92e-01	NA	0.003	NA
7. B	Q0T0B7	Polyribonucleotide nucleotidyltransferase	2.17e-01	NA	2.87e-04	NA
7. B	B6I1N9	Polyribonucleotide nucleotidyltransferase	2.15e-01	NA	2.89e-04	NA
7. B	P0AG67	30S ribosomal protein S1	8.39e-02	NA	0.039	NA
7. B	A7ZS61	Polyribonucleotide nucleotidyltransferase	1.80e-01	NA	2.89e-04	NA
7. B	B7LR33	Polyribonucleotide nucleotidyltransferase	2.19e-01	NA	0.002	NA
7. B	Q2QP54	Polyprotein of EF-Ts, chloroplastic	6.59e-01	NA	0.015	NA
7. B	Q8FD87	Polyribonucleotide nucleotidyltransferase	1.65e-01	NA	0.002	NA
7. B	B0BUD5	Polyribonucleotide nucleotidyltransferase	2.30e-01	NA	0.025	NA
7. B	B2IMQ9	Polyribonucleotide nucleotidyltransferase	2.17e-01	NA	0.014	NA
7. B	Q895G2	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	4.05e-01	NA	0.010	NA
7. B	Q8Z3I0	Polyribonucleotide nucleotidyltransferase	2.15e-01	NA	0.003	NA
7. B	A3N7L3	Polyribonucleotide nucleotidyltransferase	2.29e-01	NA	0.044	NA
7. B	A2S463	Polyribonucleotide nucleotidyltransferase	2.38e-01	NA	0.045	NA
7. B	A9KFK6	Polyribonucleotide nucleotidyltransferase	1.63e-01	NA	0.016	NA
7. B	Q6NCN8	Polyribonucleotide nucleotidyltransferase	2.49e-01	NA	0.006	NA
7. B	A1AG69	Polyribonucleotide nucleotidyltransferase	1.98e-01	NA	0.002	NA
7. B	A7MIN6	Polyribonucleotide nucleotidyltransferase	1.68e-01	NA	0.002	NA
7. B	A5E870	Polyribonucleotide nucleotidyltransferase	2.14e-01	NA	0.018	NA
7. B	O34275	Polyribonucleotide nucleotidyltransferase	2.47e-01	NA	3.20e-04	NA
7. B	B0CK15	Polyribonucleotide nucleotidyltransferase	2.47e-01	NA	0.009	NA
7. B	C1C5V9	Polyribonucleotide nucleotidyltransferase	2.14e-01	NA	0.014	NA
7. B	B4F2C3	Polyribonucleotide nucleotidyltransferase	2.33e-01	NA	0.019	NA
7. B	C3MC71	Polyribonucleotide nucleotidyltransferase	2.60e-01	NA	0.014	NA
7. B	B2GKI3	Polyribonucleotide nucleotidyltransferase	2.03e-01	NA	0.002	NA
7. B	Q92C23	Polyribonucleotide nucleotidyltransferase	2.58e-01	NA	0.021	NA
7. B	A9MP39	Polyribonucleotide nucleotidyltransferase	1.83e-01	NA	0.002	NA
7. B	B1LFR6	Polyribonucleotide nucleotidyltransferase	2.13e-01	NA	0.002	NA
7. B	A6TEI3	Polyribonucleotide nucleotidyltransferase	1.95e-01	NA	0.002	NA
7. B	A7IC03	Polyribonucleotide nucleotidyltransferase	1.80e-01	NA	0.016	NA
7. B	A8AQ53	Polyribonucleotide nucleotidyltransferase	2.09e-01	NA	0.002	NA
7. B	Q62IN1	Polyribonucleotide nucleotidyltransferase	2.35e-01	NA	0.045	NA
7. B	A4WEX9	Polyribonucleotide nucleotidyltransferase	1.97e-01	NA	0.002	NA
7. B	Q04LT4	Polyribonucleotide nucleotidyltransferase	2.24e-01	NA	0.014	NA
7. B	B5QZV4	Polyribonucleotide nucleotidyltransferase	1.68e-01	NA	0.002	NA
7. B	Q97S28	Polyribonucleotide nucleotidyltransferase	2.51e-01	NA	0.014	NA
7. B	Q3SWP5	Polyribonucleotide nucleotidyltransferase	3.92e-01	NA	0.004	NA
7. B	Q6LUI8	Polyribonucleotide nucleotidyltransferase	2.19e-01	NA	0.007	NA
7. B	Q9SZD6	Polyprotein of EF-Ts, chloroplastic	4.09e-01	NA	1.38e-05	NA
7. B	Q21C27	Polyribonucleotide nucleotidyltransferase	2.76e-01	NA	0.008	NA
7. B	P47950	Mitochondrial protein cyt-4	3.55e-06	NA	1.42e-08	NA
7. B	Q8ZLT3	Polyribonucleotide nucleotidyltransferase	2.07e-01	NA	0.002	NA
7. B	Q2YQR3	Polyribonucleotide nucleotidyltransferase	2.54e-01	NA	0.009	NA
7. B	B5E2A0	Polyribonucleotide nucleotidyltransferase	2.12e-01	NA	0.014	NA
7. B	B2VGN7	Polyribonucleotide nucleotidyltransferase	1.83e-01	NA	0.002	NA
7. B	A8G911	Polyribonucleotide nucleotidyltransferase	2.36e-01	NA	0.002	NA
7. B	Q6D9A1	Polyribonucleotide nucleotidyltransferase	1.76e-01	NA	0.002	NA
7. B	A8J637	Polyprotein of EF-Ts, chloroplastic	5.89e-01	NA	0.002	NA
7. B	A0A0H3NM73	Polyribonucleotide nucleotidyltransferase	2.05e-01	NA	0.002	NA
7. B	C1CQ76	Polyribonucleotide nucleotidyltransferase	2.88e-01	NA	0.014	NA
7. B	Q1CM51	Polyribonucleotide nucleotidyltransferase	1.91e-01	NA	0.003	NA
7. B	Q65VB0	Polyribonucleotide nucleotidyltransferase	2.00e-01	NA	0.048	NA
7. B	B7NKN3	Polyribonucleotide nucleotidyltransferase	2.07e-01	NA	2.89e-04	NA
7. B	Q8U1R5	Translation initiation factor 2 subunit alpha	1.29e-01	NA	0.007	NA