Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54956.1
JCVISYN3A_0779
PTS sugar transporter.
M. mycoides homolog: Q6MSB8.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 32
Unique PROST Go: 3
Unique BLAST Go: 13
Unique Foldseek Go: 0
Total Homologs: 134
Unique PROST Homologs: 33
Unique BLAST Homologs: 45
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q8K9J0
(PTS system glucose-specific EIICB component) with a FATCAT P-Value: 0 and RMSD of 3.02 angstrom. The sequence alignment identity is 27.3%.
Structural alignment shown in left. Query protein AVX54956.1 colored as red in alignment, homolog Q8K9J0 colored as blue.
Query protein AVX54956.1 is also shown in right top, homolog Q8K9J0 showed in right bottom. They are colored based on secondary structures.
AVX54956.1 MLTQTNKSSFKDKLKAFGANIMPTLSKLSKAFLLPIALLPIAGVFLGVGAAIAANTPEQSALWFIGKVMGNMGDVCFGNLPVLFCISVALAYTKDSGVAA 100 Q8K9J0 ---------------MF-KNVFSSLQKVGKSLMLPVSVLPIAGILLGIGSAHFTLIPE-----IISQIMAQTGGSIFSNMPLIFAIGVALGFSNNDGVAA 79 AVX54956.1 ITAVVGF-LVFNGVQA-PLFTQGQVQSDKVSEYSLLWYKHVSNSLTGSNMGILSLNTGVLGGIFVGAIAAKCYNKFHQTQLPTAISFFSGTKLVPIIT-- 196 Q8K9J0 LAAVVAYSILIQTLSAVEL---NILNTD-------------ANTIKNKNFS----DIGILGGIIAGAISAYMFNKFYKIQLPEYLGFFAGKRFVPIISGL 159 AVX54956.1 ---FVAVIPLSFIFMMAWPVIGLGLNKFGQV-SGTLPYGTDSLIFE---IVERSLVPFGLHHVFYAPLWWTSAGGSIAEGFNNLSKQSEAIQKVFVDSYN 289 Q8K9J0 FAIFVGLI-LSLI----WPSIG---NKI-QIFSEWAAYQNPIIAFSLYGLVERALVPFGLHHIWNVP-FQMQIG----E-YKN------SIGQIF----- 233 AVX54956.1 SLHGTHHTKLQEIIDIVQKNKELWGAVGDQIISQRVIGHLNILNFTDVEKLGINLGRFQSGKFGFMLLGLPAAALAMWLAAPKENRQQVFG-IYFSAAFT 388 Q8K9J0 --HG----------DIAR-----YMA-GD----------------T---TAG-NL----SGGFIFKMYGLPGAALAIWHTAKKENRKKI-GSIMISAALT 290 AVX54956.1 CFLTGITEPIEYTFLFVAPWLFYGVHMPLASIAFWATGALQTHITQTVSGGIIDYIVFGIIPFISGAMKPISAFGVLGVAVVLAPIYFCAFYFLIKLFNV 488 Q8K9J0 AFLTGITEPIEFSFILVAP-ILYIIHAILAGLSFPLCIFLNMRAGTSFSHGFIDFIV------LSGHSHKIFLFPIVGICYGL--LYYSIFYFLITTFNL 381 AVX54956.1 KTPGRDGNAEAKLYTKADFKASKGLNVDGSKMSSSTDDKEQARLAKAAAIIEYLGGEENIVDVDSCASRLRLTVVDAKKADIDGIKSLGGTTGALVKGNN 588 Q8K9J0 KTPGREEN---K-NT-VFFRN----NIE---------------I--APYIVEALGGKNNIKNLDACITRLRITVSEISKVNEENLKNL-GAAGVVISGSG 454 AVX54956.1 IQIVYGGEQEAIKPRMQKLLEQQRQEKMMGHSEMKSEEMKSENMSMTCESNQACDKKDEACGCEKDCMCEEPNKDEEQPVSEMKVEEKVVDEMKVEKPKQ 688 Q8K9J0 VQAVFGTRSENIKTAIDEYINNI----------------------------------------------------------------------------- 477 AVX54956.1 TRTKSTKAKSTTSKSTKSTSKSSSKSTKSTSSKAKSTSSKPKTTKAKSTSSKTKTTK 745 Q8K9J0 --------------------------------------------------------- 477
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0090587 | protein-phosphocysteine-glucosamine phosphotransferase system transporter activity |
| 1. PBF | GO:0015572 | N-acetylglucosamine transmembrane transporter activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0090564 | protein-phosphocysteine-glucose phosphotransferase system transporter activity |
| 1. PBF | GO:0008982 | protein-N(PI)-phosphohistidine-sugar phosphotransferase activity |
| 1. PBF | GO:0090563 | protein-phosphocysteine-sugar phosphotransferase activity |
| 1. PBF | GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system |
| 1. PBF | GO:0005355 | glucose transmembrane transporter activity |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0005887 | integral component of plasma membrane |
| 1. PBF | GO:0019866 | organelle inner membrane |
| 1. PBF | GO:1904659 | glucose transmembrane transport |
| 1. PBF | GO:0015764 | N-acetylglucosamine transport |
| 1. PBF | GO:0016301 | kinase activity |
| 4. PB | GO:0009758 | carbohydrate utilization |
| 4. PB | GO:0090586 | protein-phosphocysteine-N-acetylglucosamine phosphotransferase system transporter activity |
| 5. P | GO:0022869 | protein-N(PI)-phosphohistidine-lactose phosphotransferase system transporter activity |
| 5. P | GO:0046835 | carbohydrate phosphorylation |
| 5. P | GO:0022872 | protein-N(PI)-phosphohistidine-mannitol phosphotransferase system transmembrane transporter activity |
| 7. B | GO:0015574 | trehalose transmembrane transporter activity |
| 7. B | GO:0090588 | protein-phosphocysteine-N-acetylmuramate phosphotransferase system transporter activity |
| 7. B | GO:0008088 | axo-dendritic transport |
| 7. B | GO:0090589 | protein-phosphocysteine-trehalose phosphotransferase system transporter activity |
| 7. B | GO:0008515 | sucrose transmembrane transporter activity |
| 7. B | GO:0015771 | trehalose transport |
| 7. B | GO:0034219 | carbohydrate transmembrane transport |
| 7. B | GO:0060052 | neurofilament cytoskeleton organization |
| 7. B | GO:0008355 | olfactory learning |
| 7. B | GO:0031114 | regulation of microtubule depolymerization |
| 7. B | GO:0015770 | sucrose transport |
| 7. B | GO:0009254 | peptidoglycan turnover |
| 7. B | GO:0008582 | regulation of synaptic assembly at neuromuscular junction |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0103111 | D-glucosamine PTS permease activity |
| GO:0016310 | phosphorylation |
| GO:0016021 | integral component of membrane |
| GO:0008982 | protein-N(PI)-phosphohistidine-sugar phosphotransferase activity |
| GO:0005886 | plasma membrane |
| GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system |
| GO:0016020 | membrane |
| GO:0008643 | carbohydrate transport |
| GO:0016301 | kinase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A6QDH3 | PTS system glucose-specific EIICBA component | 2.29e-13 | 4.48e-18 | 3.93e-94 | 0.4268 |
| 1. PBF | Q57071 | PTS system glucose-specific EIICBA component | 8.08e-14 | 6.07e-14 | 4.67e-80 | 0.4237 |
| 1. PBF | O34521 | PTS system N-acetylglucosamine-specific EIICB component | 9.99e-16 | 3.98e-06 | 1.57e-28 | 0.4721 |
| 1. PBF | A7X6P1 | PTS system glucoside-specific EIICBA component | 8.77e-12 | 7.75e-17 | 5.01e-95 | 0.422 |
| 1. PBF | A7WXI2 | PTS system glucose-specific EIICBA component | 5.52e-12 | 4.33e-18 | 2.18e-97 | 0.4306 |
| 1. PBF | Q8VRH0 | PTS system glucose-specific EIICBA component | 0.00e+00 | 8.32e-18 | 1.03e-93 | 0.7725 |
| 1. PBF | A8Z0F5 | PTS system glucose-specific EIICBA component | 2.11e-12 | 4.48e-18 | 3.93e-94 | 0.401 |
| 1. PBF | Q7A807 | PTS system glucose-specific EIICBA component | 3.03e-12 | 4.33e-18 | 2.18e-97 | 0.4383 |
| 1. PBF | A8Z3D6 | PTS system glucoside-specific EIICBA component | 1.22e-12 | 9.41e-18 | 4.96e-95 | 0.4205 |
| 1. PBF | Q2FDW8 | PTS system glucoside-specific EIICBA component | 1.32e-11 | 9.41e-18 | 4.96e-95 | 0.4086 |
| 1. PBF | A6U4R9 | PTS system glucoside-specific EIICBA component | 1.23e-12 | 8.47e-18 | 4.96e-95 | 0.4133 |
| 1. PBF | Q4L945 | PTS system glucose-specific EIICBA component | 6.33e-15 | 5.98e-17 | 2.07e-92 | 0.4306 |
| 1. PBF | A5IP58 | PTS system glucose-specific EIICBA component | 0.00e+00 | 4.33e-18 | 2.18e-97 | 0.7461 |
| 1. PBF | Q6GDR0 | PTS system glucoside-specific EIICBA component | 8.12e-12 | 8.47e-18 | 4.24e-95 | 0.4227 |
| 1. PBF | Q9AGA7 | PTS system alpha-glucoside-specific EIICB component | 7.32e-12 | 2.23e-12 | 9.49e-57 | 0.432 |
| 1. PBF | Q2YUZ1 | PTS system glucose-specific EIICBA component | 1.18e-14 | 4.73e-18 | 6.70e-94 | 0.4266 |
| 1. PBF | P35595 | PTS system glucose-specific EIICBA component | 2.11e-12 | 3.09e-18 | 4.23e-50 | 0.4761 |
| 1. PBF | Q5HL73 | PTS system glucose-specific EIICBA component | 0.00e+00 | 8.32e-18 | 1.03e-93 | 0.7674 |
| 1. PBF | A5IVW5 | PTS system glucoside-specific EIICBA component | 5.60e-12 | 8.47e-18 | 4.96e-95 | 0.4204 |
| 1. PBF | Q7CCJ4 | PTS system glucose-specific EIICBA component | 1.03e-13 | 8.32e-18 | 1.03e-93 | 0.417 |
| 1. PBF | Q7A3G4 | PTS system glucoside-specific EIICBA component | 3.91e-13 | 7.75e-17 | 5.01e-95 | 0.4298 |
| 1. PBF | P20166 | PTS system glucose-specific EIICBA component | 2.21e-11 | 2.87e-18 | 2.12e-100 | 0.4337 |
| 1. PBF | Q99R97 | PTS system glucoside-specific EIICBA component | 5.52e-13 | 7.75e-17 | 5.01e-95 | 0.4151 |
| 1. PBF | Q8NUS2 | PTS system glucoside-specific EIICBA component | 1.41e-11 | 9.41e-18 | 4.96e-95 | 0.4104 |
| 1. PBF | P39816 | Putative PTS system glucosamine-specific EIICBA component | 2.22e-16 | 2.49e-15 | 2.02e-32 | 0.4053 |
| 1. PBF | Q2YWC1 | PTS system glucoside-specific EIICBA component | 8.99e-13 | 6.19e-17 | 4.71e-95 | 0.4124 |
| 1. PBF | Q53922 | PTS system glucoside-specific EIICBA component | 3.96e-13 | 1.14e-17 | 4.15e-91 | 0.411 |
| 1. PBF | Q6GKB7 | PTS system glucose-specific EIICBA component | 1.31e-13 | 5.45e-18 | 2.99e-94 | 0.4066 |
| 1. PBF | P69788 | PTS system glucose-specific EIICB component | 0.00e+00 | 1.97e-07 | 4.88e-39 | 0.7633 |
| 1. PBF | P47315 | PTS system glucose-specific EIICBA component | 3.11e-10 | 2.39e-08 | 1.41e-55 | 0.4898 |
| 1. PBF | Q4A0C4 | PTS system glucose-specific EIICBA component | 1.19e-13 | 6.41e-17 | 2.59e-90 | 0.4193 |
| 1. PBF | P45604 | PTS system N-acetylglucosamine-specific EIICBA component | 2.22e-16 | 1.04e-08 | 1.33e-43 | 0.695 |
| 1. PBF | O06900 | PTS system alpha-glucoside-specific EIICB component | 2.45e-12 | 1.68e-07 | 1.20e-52 | 0.4434 |
| 1. PBF | C7NB69 | PTS system alpha-glucoside-specific EIICB component | 8.50e-12 | 2.29e-07 | 7.06e-57 | 0.474 |
| 1. PBF | Q2FK73 | PTS system glucose-specific EIICBA component | 1.03e-13 | 4.48e-18 | 3.93e-94 | 0.4026 |
| 1. PBF | P57437 | PTS system glucose-specific EIICB component | 0.00e+00 | 2.71e-07 | 6.11e-35 | 0.7738 |
| 1. PBF | Q6G6D6 | PTS system glucoside-specific EIICBA component | 6.83e-12 | 9.41e-18 | 4.96e-95 | 0.4196 |
| 1. PBF | A6TXX3 | PTS system glucose-specific EIICBA component | 2.14e-11 | 4.33e-18 | 2.18e-97 | 0.4189 |
| 1. PBF | A6QK27 | PTS system glucoside-specific EIICBA component | 7.01e-13 | 9.41e-18 | 4.96e-95 | 0.4161 |
| 1. PBF | Q5HD13 | PTS system glucoside-specific EIICBA component | 1.67e-12 | 9.41e-18 | 4.96e-95 | 0.4114 |
| 1. PBF | Q5HJI3 | PTS system glucose-specific EIICBA component | 6.26e-12 | 4.48e-18 | 3.93e-94 | 0.4161 |
| 1. PBF | Q6GCT7 | PTS system glucose-specific EIICBA component | 1.14e-13 | 4.48e-18 | 3.93e-94 | 0.4283 |
| 1. PBF | P37439 | PTS system glucose-specific EIICB component | 0.00e+00 | 1.51e-06 | 1.09e-38 | 0.7624 |
| 1. PBF | P69787 | PTS system glucose-specific EIICB component | 0.00e+00 | 1.97e-07 | 4.88e-39 | 0.7802 |
| 1. PBF | Q89AG6 | PTS system glucose-specific EIICB component | 0.00e+00 | 1.06e-07 | 9.01e-75 | 0.7433 |
| 1. PBF | Q8NYM1 | PTS system glucose-specific EIICBA component | 2.17e-12 | 4.48e-18 | 3.93e-94 | 0.411 |
| 1. PBF | P54715 | PTS system maltose-specific EIICB component | 1.29e-12 | 5.86e-06 | 8.59e-50 | 0.4463 |
| 1. PBF | Q8K9J0 | PTS system glucose-specific EIICB component | 0.00e+00 | 2.29e-07 | 3.43e-39 | 0.8384 |
| 1. PBF | P75569 | PTS system glucose-specific EIICBA component | 8.45e-07 | 8.19e-10 | 4.38e-63 | 0.488 |
| 1. PBF | Q99X32 | PTS system glucose-specific EIICBA component | 9.81e-09 | 4.33e-18 | 2.18e-97 | 0.4154 |
| 3. BF | Q9S2H4 | PTS system N-acetylglucosamine-specific EIIC component | 0.00e+00 | NA | 4.83e-43 | 0.8616 |
| 4. PB | P69786 | PTS system glucose-specific EIICB component | 0.00e+00 | 1.97e-07 | 4.88e-39 | NA |
| 4. PB | Q2FV87 | PTS system glucoside-specific EIICBA component | 6.37e-12 | 9.41e-18 | 4.96e-95 | NA |
| 4. PB | P09323 | PTS system N-acetylglucosamine-specific EIICBA component | 8.97e-12 | 1.20e-09 | 2.78e-46 | NA |
| 4. PB | P19642 | PTS system maltose-specific EIICB component | 2.99e-13 | 9.09e-05 | 3.10e-32 | NA |
| 4. PB | Q2G1G8 | PTS system glucose-specific EIICBA component | 2.94e-09 | 4.48e-18 | 3.93e-94 | NA |
| 5. P | P75146 | PTS system mannitol-specific EIICB component | NA | 1.32e-05 | NA | NA |
| 5. P | Q7A092 | PTS system lactose-specific EIICB component | 1.14e-04 | 1.65e-05 | NA | NA |
| 5. P | Q4L869 | PTS system lactose-specific EIICB component | 9.62e-05 | 2.29e-07 | NA | NA |
| 5. P | P57635 | PTS system mannitol-specific EIICBA component | 6.85e-05 | 3.80e-02 | NA | NA |
| 5. P | P69826 | PTS system mannitol-specific cryptic EIICB component | 3.45e-05 | 4.28e-06 | NA | NA |
| 5. P | Q7A4B3 | PTS system mannitol-specific EIICB component | 9.25e-06 | 1.53e-06 | NA | NA |
| 5. P | Q99S77 | PTS system lactose-specific EIICB component | 1.42e-04 | 1.32e-05 | NA | NA |
| 5. P | Q6GEN9 | PTS system lactose-specific EIICB component | 1.12e-04 | 1.65e-05 | NA | NA |
| 5. P | Q9K678 | PTS system mannitol-specific EIICB component | 1.95e-05 | 2.35e-04 | NA | NA |
| 5. P | Q9KJ75 | PTS system mannitol-specific EIICB component | 1.63e-04 | 1.17e-05 | NA | NA |
| 5. P | Q6G7F6 | PTS system mannitol-specific EIICB component | 1.32e-05 | 1.53e-06 | NA | NA |
| 5. P | P11162 | PTS system lactose-specific EIICB component | 1.17e-04 | 1.55e-05 | NA | NA |
| 5. P | Q5HE15 | PTS system lactose-specific EIICB component | 1.20e-04 | 1.65e-05 | NA | NA |
| 5. P | Q6G7C4 | PTS system lactose-specific EIICB component | 1.12e-04 | 1.65e-05 | NA | NA |
| 5. P | Q8DR34 | PTS system mannitol-specific EIICB component | 4.14e-05 | 1.03e-04 | NA | NA |
| 5. P | P23531 | PTS system lactose-specific EIICB component | 1.32e-04 | 1.54e-05 | NA | NA |
| 5. P | P50852 | PTS system mannitol-specific EIICB component | 1.85e-05 | 8.02e-05 | NA | NA |
| 5. P | P28008 | PTS system mannitol-specific EIICB component | 1.72e-05 | 8.02e-05 | NA | NA |
| 5. P | Q5HE48 | PTS system mannitol-specific EIICB component | 1.79e-04 | 1.87e-06 | NA | NA |
| 5. P | Q7A0A4 | PTS system mannitol-specific EIICB component | 9.22e-05 | 1.53e-06 | NA | NA |
| 5. P | Q97SH4 | PTS system mannitol-specific EIICB component | 4.61e-05 | 7.58e-05 | NA | NA |
| 5. P | Q4L9Y1 | PTS system mannitol-specific EIICB component | 3.00e-05 | 4.38e-05 | NA | NA |
| 5. P | Q931G6 | PTS system lactose-specific EIICB component | 1.09e-04 | 1.65e-05 | NA | NA |
| 5. P | Q8CNF7 | PTS system lactose-specific EIICB component | 8.06e-05 | 8.04e-08 | NA | NA |
| 5. P | O65989 | PTS system mannitol-specific EIICB component | 4.62e-05 | 5.26e-05 | NA | NA |
| 5. P | P50976 | PTS system lactose-specific EIICB component | 1.07e-04 | 2.74e-04 | NA | NA |
| 5. P | Q49ZA3 | PTS system mannitol-specific EIICB component | 1.34e-05 | 4.04e-05 | NA | NA |
| 5. P | P42956 | PTS system mannitol-specific EIICB component | 8.82e-06 | 5.83e-05 | NA | NA |
| 5. P | Q5HM40 | PTS system lactose-specific EIICB component | 1.05e-04 | 8.04e-08 | NA | NA |
| 5. P | P69827 | PTS system mannitol-specific cryptic EIICB component | 1.10e-05 | 4.28e-06 | NA | NA |
| 5. P | Q6GES1 | PTS system mannitol-specific EIICB component | 6.55e-05 | 1.89e-06 | NA | NA |
| 5. P | Q99SA3 | PTS system mannitol-specific EIICB component | 4.71e-05 | 1.53e-06 | NA | NA |
| 5. P | P24400 | PTS system lactose-specific EIICB component | 2.00e-04 | 1.32e-06 | NA | NA |
| 7. B | P08470 | PTS system sucrose-specific EIIBC component | 1.46e-04 | NA | 3.19e-04 | NA |
| 7. B | Q5E5T6 | PTS system N-acetylmuramic acid-specific EIIBC component | 1.86e-05 | NA | 7.20e-04 | NA |
| 7. B | P77272 | PTS system N-acetylmuramic acid-specific EIIBC component | 7.70e-06 | NA | 8.75e-04 | NA |
| 7. B | Q2FK70 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.70e-05 | NA | 0.026 | NA |
| 7. B | Q31Y50 | PTS system N-acetylmuramic acid-specific EIIBC component | 5.57e-06 | NA | 0.006 | NA |
| 7. B | Q45298 | PTS system glucose-specific EIIBCA component | 3.67e-04 | NA | 0.033 | NA |
| 7. B | P69789 | Phosphotransferase enzyme IIB component GlvB | 4.17e-05 | NA | 1.04e-16 | NA |
| 7. B | Q9S2H6 | PTS system N-acetylglucosamine-specific EIIB component | 2.87e-04 | NA | 0.001 | NA |
| 7. B | P27219 | PTS system sucrose-specific EIIBC component | 1.32e-04 | NA | 1.68e-04 | NA |
| 7. B | Q2YV12 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.45e-05 | NA | 0.020 | NA |
| 7. B | P51184 | PTS system sucrose-specific EIIBC component | 4.70e-07 | NA | 0.035 | NA |
| 7. B | Q9KVD9 | PTS system N-acetylmuramic acid-specific EIIBC component | 1.19e-05 | NA | 0.020 | NA |
| 7. B | P26207 | PTS system beta-glucoside-specific EIIBCA component | 1.14e-04 | NA | 0.002 | NA |
| 7. B | Q9KF90 | PTS system beta-glucoside-specific EIIBCA component | 7.62e-05 | NA | 1.05e-04 | NA |
| 7. B | Q32DC5 | PTS system N-acetylmuramic acid-specific EIIBC component | 3.79e-05 | NA | 0.001 | NA |
| 7. B | P69790 | Phosphotransferase enzyme IIB component GlvB | 4.30e-05 | NA | 1.04e-16 | NA |
| 7. B | Q49ZN7 | PTS system MurNAc-GlcNAc-specific EIIBC component | 7.57e-06 | NA | 0.001 | NA |
| 7. B | Q2G1G5 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.70e-05 | NA | 0.026 | NA |
| 7. B | Q8CNB2 | PTS system MurNAc-GlcNAc-specific EIIBC component | 2.87e-05 | NA | 0.002 | NA |
| 7. B | Q83QN3 | PTS system N-acetylmuramic acid-specific EIIBC component | 4.78e-06 | NA | 0.001 | NA |
| 7. B | Q46072 | PTS system mannose-specific EIIBCA component | 1.80e-04 | NA | 0.044 | NA |
| 7. B | Q9W596 | Microtubule-associated protein futsch | NA | NA | 0.012 | NA |
| 7. B | P40739 | PTS system beta-glucoside-specific EIIBCA component | 1.54e-04 | NA | 2.96e-04 | NA |
| 7. B | Q5HLT2 | PTS system MurNAc-GlcNAc-specific EIIBC component | 1.02e-05 | NA | 0.002 | NA |
| 7. B | Q7N9D9 | PTS system N-acetylmuramic acid-specific EIIBC component | 1.56e-06 | NA | 0.017 | NA |
| 7. B | Q6GCT4 | PTS system MurNAc-GlcNAc-specific EIIBC component | 8.76e-06 | NA | 0.026 | NA |
| 7. B | P15400 | Negative regulator of SacY activity | 4.09e-05 | NA | 2.69e-04 | NA |
| 7. B | P05306 | PTS system sucrose-specific EIIBC component | 8.23e-05 | NA | 1.33e-06 | NA |
| 7. B | P42015 | PTS system glucose-specific EIICBA component (Fragment) | 2.58e-03 | NA | 5.15e-17 | NA |
| 7. B | Q8XBJ1 | PTS system N-acetylmuramic acid-specific EIIBC component | 1.74e-05 | NA | 2.35e-04 | NA |
| 7. B | Q7A1Y1 | PTS system MurNAc-GlcNAc-specific EIIBC component | 9.03e-06 | NA | 0.026 | NA |
| 7. B | Q9CJZ2 | PTS system sucrose-specific EIIBC component | 2.94e-07 | NA | 0.004 | NA |
| 7. B | Q1R8U3 | PTS system N-acetylmuramic acid-specific EIIBC component | 3.49e-05 | NA | 2.63e-04 | NA |
| 7. B | Q8FFA9 | PTS system N-acetylmuramic acid-specific EIIBC component | 1.19e-06 | NA | 2.33e-04 | NA |
| 7. B | Q9CKN5 | PTS system N-acetylmuramic acid-specific EIIBC component | 7.77e-06 | NA | 3.57e-04 | NA |
| 7. B | Q7A804 | PTS system MurNAc-GlcNAc-specific EIIBC component | 8.04e-06 | NA | 0.026 | NA |
| 7. B | P22825 | PTS system sucrose-specific EIIBC component | 5.10e-07 | NA | 5.40e-05 | NA |
| 7. B | Q06RB0 | 30S ribosomal protein S18, chloroplastic | 3.45e-01 | NA | 0.007 | NA |
| 7. B | Q99X29 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.61e-05 | NA | 0.026 | NA |
| 7. B | Q797S1 | Putative PTS system EIIBC component YbbF | 1.52e-05 | NA | 0.002 | NA |
| 7. B | P24241 | PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component | 1.51e-04 | NA | 0.010 | NA |
| 7. B | Q6GKB4 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.64e-05 | NA | 0.020 | NA |
| 7. B | P31452 | Phosphotransferase IIC component GlvC | 1.53e-09 | NA | 1.65e-22 | NA |
| 7. B | Q5HJI0 | PTS system MurNAc-GlcNAc-specific EIIBC component | 4.85e-05 | NA | 0.026 | NA |
| 7. B | P39794 | PTS system trehalose-specific EIIBC component | 1.56e-05 | NA | 0.034 | NA |