Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54958.1
JCVISYN3A_0789

F0F1 ATP synthase subunit delta/epsilon.
M. mycoides homolog: Q6MS95.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 16
Unique PROST Go: 1
Unique BLAST Go: 3
Unique Foldseek Go: 1

Total Homologs: 740
Unique PROST Homologs: 4
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 47

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: atpC; ATP synthase epsilon chain
Zhang et al. [4]: GO:0046933|proton-transporting ATP synthase activity, rotational mechanism
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P42009 (ATP synthase epsilon chain) with a FATCAT P-Value: 0 and RMSD of 0.85 angstrom. The sequence alignment identity is 19.6%.
Structural alignment shown in left. Query protein AVX54958.1 colored as red in alignment, homolog P42009 colored as blue. Query protein AVX54958.1 is also shown in right top, homolog P42009 showed in right bottom. They are colored based on secondary structures.

  AVX54958.1 M-GIKLKILTPNGTFVENKEVDIINLKTIDGDIGVLANMAPFVTALRNDTLNFKEKNTYT-YIHVDQGLVVISKNQCKII------TENLYLV----DKQ 88
      P42009 MKTIHVSVVTPDGPVYED-DVEMVSVKAKSGELGILPGHIPLVAPLEISAARLK-KGGKTQYIAFSGGFLEVRPDNVTILAQAAERAEDIDVLRAKARKS 98

  AVX54958.1 DRELPTPLKLA--------------------------- 99
      P42009 GR---TPLQ-SQQDDIDFKRAELALKRAMNRLSVAEMK 132

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0015986 ATP synthesis coupled proton transport
1. PBF GO:0005756 mitochondrial proton-transporting ATP synthase, central stalk
1. PBF GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
1. PBF GO:0005886 plasma membrane
1. PBF GO:0009535 chloroplast thylakoid membrane
1. PBF GO:0005524 ATP binding
1. PBF GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)
1. PBF GO:0000275 mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)
1. PBF GO:0045260 plasma membrane proton-transporting ATP synthase complex
1. PBF GO:0031676 plasma membrane-derived thylakoid membrane
2. PF GO:0045262 plasma membrane proton-transporting ATP synthase complex, catalytic core F(1)
5. P GO:0009536 plastid
6. F GO:0045259 proton-transporting ATP synthase complex
7. B GO:0033115 cyanelle thylakoid membrane
7. B GO:0055035 plastid thylakoid membrane
7. B GO:0009941 chloroplast envelope

Uniprot GO Annotations

GO Description
GO:0015986 ATP synthesis coupled proton transport
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
GO:0006811 ion transport
GO:0016020 membrane
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)
GO:0016787 hydrolase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9K6H6 ATP synthase epsilon chain 5.55e-16 2.40e-07 3.71e-07 0.9358
1. PBF A7Z9P9 ATP synthase epsilon chain 2.22e-16 1.48e-05 0.001 0.87
1. PBF P05039 ATP synthase epsilon chain, chloroplastic 6.99e-15 1.40e-03 1.01e-04 0.9451
1. PBF C1CF92 ATP synthase epsilon chain 3.72e-13 1.23e-02 0.018 0.8305
1. PBF Q2J6N4 ATP synthase epsilon chain 8.10e-15 1.05e-21 7.40e-04 0.9054
1. PBF A0A341 ATP synthase epsilon chain, chloroplastic 6.88e-15 1.50e-07 0.004 0.8744
1. PBF Q02XA6 ATP synthase epsilon chain 3.52e-13 2.37e-06 0.008 0.8349
1. PBF B1ICS8 ATP synthase epsilon chain 3.64e-13 1.23e-02 0.018 0.8308
1. PBF Q88UU4 ATP synthase epsilon chain 2.83e-12 1.94e-07 1.42e-04 0.8418
1. PBF Q927W5 ATP synthase epsilon chain 6.06e-14 6.82e-06 0.046 0.8638
1. PBF Q70XZ7 ATP synthase epsilon chain, chloroplastic 4.66e-15 2.14e-06 0.001 0.8771
1. PBF Q39ZU2 ATP synthase epsilon chain 2 2.46e-09 5.72e-04 0.002 0.9471
1. PBF Q831A6 ATP synthase epsilon chain 6.69e-13 3.01e-05 3.89e-05 0.8422
1. PBF A0Q2Z3 ATP synthase epsilon chain 1.62e-12 1.56e-09 0.005 0.8351
1. PBF Q32RY9 ATP synthase epsilon chain, chloroplastic 4.88e-15 2.98e-04 7.64e-05 0.9456
1. PBF A8MJV8 ATP synthase epsilon chain 8.88e-16 4.68e-08 2.32e-05 0.8715
1. PBF P63668 ATP synthase epsilon chain 3.33e-13 1.23e-02 0.018 0.8456
1. PBF A6QIU6 ATP synthase epsilon chain 7.69e-14 2.53e-06 2.20e-07 0.9286
1. PBF Q30QQ2 ATP synthase epsilon chain 2.21e-12 3.58e-08 0.004 0.9103
1. PBF Q31793 ATP synthase epsilon chain, chloroplastic 2.10e-09 3.36e-04 3.80e-05 0.8759
1. PBF B1I6J6 ATP synthase epsilon chain 1.55e-15 5.17e-06 0.003 0.9378
1. PBF Q33C28 ATP synthase epsilon chain, chloroplastic 1.29e-09 9.66e-07 2.83e-04 0.8756
1. PBF P26534 ATP synthase epsilon chain, chloroplastic 1.13e-09 1.51e-07 1.82e-04 0.9084
1. PBF Q8F2J6 ATP synthase epsilon chain 3.42e-13 1.11e-13 0.011 0.8647
1. PBF A6QB58 ATP synthase epsilon chain 7.77e-16 1.16e-10 0.041 0.8848
1. PBF Q8Y4C2 ATP synthase epsilon chain 6.24e-14 8.97e-06 0.046 0.8636
1. PBF Q03EL5 ATP synthase epsilon chain 2.62e-13 3.81e-08 1.67e-05 0.8693
1. PBF Q04N64 ATP synthase epsilon chain 3.55e-13 1.23e-02 0.018 0.8307
1. PBF P22480 ATP synthase epsilon chain 9.99e-16 1.54e-04 1.04e-06 0.9329
1. PBF B5EFI6 ATP synthase epsilon chain 2.32e-09 2.59e-04 0.003 0.945
1. PBF C1KYU5 ATP synthase epsilon chain 6.22e-14 8.97e-06 0.046 0.857
1. PBF A5ILX3 ATP synthase epsilon chain 1.55e-15 8.00e-24 5.91e-07 0.8466
1. PBF Q9TM40 ATP synthase epsilon chain, chloroplastic 1.77e-09 2.02e-06 6.92e-04 0.8761
1. PBF Q72E05 ATP synthase epsilon chain 1.55e-15 4.48e-06 4.85e-06 0.9286
1. PBF B8FGT3 ATP synthase epsilon chain 1.39e-14 1.78e-03 0.031 0.9096
1. PBF P50010 ATP synthase epsilon chain 2.55e-15 7.87e-06 3.03e-05 0.879
1. PBF Q9PR16 ATP synthase epsilon chain 4.65e-12 5.12e-04 0.015 0.8734
1. PBF B5Z8C9 ATP synthase epsilon chain 2.10e-11 3.32e-12 0.008 0.9202
1. PBF Q2JJK2 ATP synthase epsilon chain 5.58e-14 1.09e-05 8.21e-04 0.8997
1. PBF Q1QPU2 ATP synthase epsilon chain 2 9.74e-14 6.71e-05 0.001 0.9181
1. PBF P63667 ATP synthase epsilon chain 3.77e-13 1.23e-02 0.018 0.8306
1. PBF Q49Z49 ATP synthase epsilon chain 2.35e-09 3.11e-07 7.86e-06 0.9511
1. PBF Q2VZN3 ATP synthase epsilon chain 1.34e-12 1.36e-04 0.026 0.9308
1. PBF P63664 ATP synthase epsilon chain 7.90e-14 2.53e-06 2.20e-07 0.9282
1. PBF Q8EM84 ATP synthase epsilon chain 0.00e+00 7.22e-08 0.006 0.9483
1. PBF Q3SVJ0 ATP synthase epsilon chain 3.12e-13 3.89e-03 3.15e-05 0.9242
1. PBF A5E951 ATP synthase epsilon chain 4.43e-09 1.22e-05 1.93e-04 0.9144
1. PBF Q6HAY1 ATP synthase epsilon chain 4.44e-16 1.01e-06 2.03e-04 0.9342
1. PBF P33255 ATP synthase epsilon chain 1.54e-12 6.76e-04 0.030 0.8807
1. PBF B9LZ83 ATP synthase epsilon chain 2.35e-09 2.41e-04 2.05e-04 0.9462
1. PBF Q7NHG9 ATP synthase epsilon chain 2.05e-09 5.14e-09 5.84e-08 0.9305
1. PBF B9DME2 ATP synthase epsilon chain 2.02e-12 1.58e-03 3.23e-06 0.8707
1. PBF B4UKE9 ATP synthase epsilon chain 1.54e-14 3.00e-07 0.004 0.9402
1. PBF Q3ZJ67 ATP synthase epsilon chain, chloroplastic 1.85e-09 5.33e-09 4.85e-07 0.9461
1. PBF Q27S44 ATP synthase epsilon chain, chloroplastic 1.09e-09 1.05e-06 3.11e-04 0.9407
1. PBF B8CZ09 ATP synthase epsilon chain 6.99e-15 3.41e-07 3.45e-05 0.948
1. PBF B7KGV3 ATP synthase epsilon chain 4.33e-15 1.32e-02 0.002 0.8777
1. PBF C1C898 ATP synthase epsilon chain 3.37e-13 1.23e-02 0.018 0.8312
1. PBF A4ITI8 ATP synthase epsilon chain 2.22e-16 1.83e-06 8.81e-05 0.8827
1. PBF Q24MP2 ATP synthase epsilon chain 2.87e-09 2.17e-09 0.002 0.9313
1. PBF Q0AKW2 ATP synthase epsilon chain 3.99e-13 7.05e-06 0.048 0.8337
1. PBF B6JD10 ATP synthase epsilon chain 1.64e-13 6.86e-05 0.039 0.9292
1. PBF B8FZ33 ATP synthase epsilon chain 2.25e-09 1.12e-09 0.004 0.9265
1. PBF Q9CES1 ATP synthase epsilon chain 2.27e-13 2.88e-05 0.008 0.8374
1. PBF A2BYG4 ATP synthase epsilon chain 9.77e-10 4.68e-08 0.014 0.8762
1. PBF A6U3I7 ATP synthase epsilon chain 7.82e-14 2.53e-06 2.20e-07 0.9282
1. PBF Q05375 ATP synthase epsilon chain 4.44e-15 6.37e-05 0.001 0.9404
1. PBF Q32RI1 ATP synthase epsilon chain, chloroplastic 1.34e-09 2.32e-07 4.75e-05 0.9399
1. PBF Q2YUK2 ATP synthase epsilon chain 7.89e-14 2.53e-06 2.20e-07 0.9285
1. PBF B0JFM8 ATP synthase epsilon chain 4.44e-15 1.38e-03 1.43e-04 0.8771
1. PBF P07678 ATP synthase epsilon chain 1.11e-16 3.20e-10 5.55e-04 0.9407
1. PBF Q5SD05 ATP synthase epsilon chain, chloroplastic 1.68e-09 1.09e-04 3.96e-06 0.8752
1. PBF O50143 ATP synthase epsilon chain 1.38e-12 8.68e-06 3.08e-04 0.9147
1. PBF A8Z500 ATP synthase epsilon chain 7.28e-14 2.53e-06 2.20e-07 0.9285
1. PBF Q06RC3 ATP synthase epsilon chain, chloroplastic 1.61e-09 2.45e-06 0.003 0.8716
1. PBF Q1QQS9 ATP synthase epsilon chain 1 2.08e-13 1.15e-02 6.87e-04 0.8831
1. PBF Q6MGM8 ATP synthase epsilon chain 3.04e-12 3.31e-03 3.27e-05 0.9058
1. PBF C3P1F3 ATP synthase epsilon chain 5.55e-16 1.08e-06 2.07e-04 0.9333
1. PBF Q2MI94 ATP synthase epsilon chain, chloroplastic 1.11e-09 1.05e-06 3.11e-04 0.9413
1. PBF Q2JUB3 ATP synthase epsilon chain 3.28e-14 1.34e-07 4.01e-05 0.8731
1. PBF A0ZZ41 ATP synthase epsilon chain, chloroplastic 7.66e-15 1.65e-06 0.001 0.8752
1. PBF C1CSC7 ATP synthase epsilon chain 3.69e-13 1.23e-02 0.018 0.8305
1. PBF Q85FT3 ATP synthase epsilon chain, chloroplastic 6.48e-13 1.11e-04 6.62e-06 0.8474
1. PBF P37812 ATP synthase epsilon chain 1.11e-16 1.27e-06 5.91e-04 0.8725
1. PBF Q1KVW5 ATP synthase epsilon chain, chloroplastic 2.13e-09 4.46e-04 2.82e-05 0.9417
1. PBF B1AIB7 ATP synthase epsilon chain 5.58e-09 5.12e-04 0.015 0.8752
1. PBF Q06SF3 ATP synthase epsilon chain, chloroplastic 2.95e-09 1.91e-04 0.001 0.9197
1. PBF Q74GX9 ATP synthase epsilon chain 0.00e+00 2.16e-04 0.004 0.9476
1. PBF A1VFJ6 ATP synthase epsilon chain 1.78e-15 4.48e-06 4.85e-06 0.9283
1. PBF Q67TB6 ATP synthase epsilon chain 3.23e-09 2.56e-05 3.65e-06 0.9437
1. PBF Q8M9X7 ATP synthase epsilon chain, chloroplastic 2.05e-09 1.81e-04 6.36e-05 0.8717
1. PBF B9IRT6 ATP synthase epsilon chain 4.44e-16 1.01e-06 2.03e-04 0.9348
1. PBF P07138 ATP synthase epsilon chain, chloroplastic 7.66e-15 4.89e-07 3.38e-04 0.9408
1. PBF A4J998 ATP synthase epsilon chain 7.77e-16 4.18e-05 1.00e-05 0.9295
1. PBF B1WU98 ATP synthase epsilon chain 4.88e-15 1.04e-04 7.17e-04 0.8767
1. PBF Q08808 ATP synthase epsilon chain, chloroplastic 6.55e-15 2.81e-04 0.001 0.9428
1. PBF Q6EW73 ATP synthase epsilon chain, chloroplastic 2.00e-15 8.49e-06 0.001 0.8815
1. PBF Q5HE98 ATP synthase epsilon chain 7.23e-14 2.53e-06 2.20e-07 0.9287
1. PBF Q0ZJ14 ATP synthase epsilon chain, chloroplastic 6.77e-15 4.41e-07 0.005 0.942
1. PBF Q89X75 ATP synthase epsilon chain 1.48e-12 1.46e-04 3.35e-05 0.8905
1. PBF Q9X1U5 ATP synthase epsilon chain 7.77e-16 8.00e-24 5.91e-07 0.8365
1. PBF B2IQW9 ATP synthase epsilon chain 4.00e-13 1.23e-02 0.018 0.8301
1. PBF Q1WUC5 ATP synthase epsilon chain 6.20e-13 8.75e-08 0.004 0.8937
1. PBF Q3C1J6 ATP synthase epsilon chain, chloroplastic 1.30e-09 1.27e-06 2.63e-04 0.8749
1. PBF Q8WI12 ATP synthase epsilon chain, chloroplastic 2.29e-09 3.97e-05 3.38e-04 0.8746
1. PBF Q2L911 ATP synthase epsilon chain, chloroplastic 7.44e-15 1.65e-06 0.001 0.8755
1. PBF Q2FF25 ATP synthase epsilon chain 8.00e-14 2.53e-06 2.20e-07 0.9286
1. PBF Q6GEX3 ATP synthase epsilon chain 7.33e-14 2.53e-06 2.20e-07 0.9284
1. PBF Q73IG2 ATP synthase epsilon chain 7.05e-12 2.10e-20 0.030 0.8716
1. PBF A5UQN2 ATP synthase epsilon chain 3.33e-16 1.69e-02 8.94e-04 0.9417
1. PBF B8HP54 ATP synthase epsilon chain 3.22e-15 1.16e-04 0.002 0.9266
1. PBF P29709 ATP synthase epsilon chain, sodium ion specific 8.48e-09 4.45e-05 7.08e-07 0.8858
1. PBF A6TK66 ATP synthase epsilon chain 6.66e-16 5.20e-09 0.006 0.9389
1. PBF Q8S8W9 ATP synthase epsilon chain, chloroplastic 6.00e-15 9.33e-07 1.36e-04 0.8761
1. PBF Q0BQE9 ATP synthase epsilon chain 2.45e-12 1.20e-04 0.001 0.9007
1. PBF Q85X21 ATP synthase epsilon chain, chloroplastic 2.66e-09 3.64e-05 0.035 0.8777
1. PBF P42009 ATP synthase epsilon chain 0.00e+00 4.00e-10 0.003 0.8861
1. PBF B8ZLA8 ATP synthase epsilon chain 3.99e-13 1.23e-02 0.018 0.8304
1. PBF Q1MRB7 ATP synthase epsilon chain 1.89e-15 3.88e-06 7.62e-07 0.9419
1. PBF Q9BBT9 ATP synthase epsilon chain, chloroplastic 5.11e-15 1.23e-06 0.024 0.8769
1. PBF P26533 ATP synthase epsilon chain 3.00e-15 2.56e-06 3.62e-04 0.9411
1. PBF Q7YJW6 ATP synthase epsilon chain, chloroplastic 1.24e-09 6.17e-07 4.70e-04 0.8743
1. PBF Q14FF1 ATP synthase epsilon chain, chloroplastic 7.99e-15 1.75e-07 0.004 0.8756
1. PBF Q313W1 ATP synthase epsilon chain 3.11e-15 9.84e-09 3.40e-07 0.8759
1. PBF A8FIB1 ATP synthase epsilon chain 1.11e-16 2.96e-06 7.13e-06 0.9401
1. PBF Q1CSD6 ATP synthase epsilon chain 1.83e-11 5.05e-12 0.010 0.9213
1. PBF P0A2Z9 ATP synthase epsilon chain 6.33e-15 3.95e-04 0.010 0.9246
1. PBF Q72XE9 ATP synthase epsilon chain 4.44e-16 1.01e-06 2.03e-04 0.9347
1. PBF Q5WB79 ATP synthase epsilon chain 1.04e-09 6.76e-04 9.37e-05 0.9284
1. PBF Q85FL4 ATP synthase epsilon chain, chloroplastic 1.07e-09 1.66e-07 1.75e-04 0.8805
1. PBF Q2MII1 ATP synthase epsilon chain, chloroplastic 1.10e-09 1.05e-06 3.11e-04 0.9409
1. PBF B7IQV7 ATP synthase epsilon chain 6.66e-16 1.08e-06 2.07e-04 0.9327
1. PBF Q2IHQ3 ATP synthase epsilon chain 2.61e-09 1.85e-07 0.004 0.9388
1. PBF Q09X11 ATP synthase epsilon chain, chloroplastic 9.21e-15 2.51e-06 0.003 0.8743
1. PBF B2UUN9 ATP synthase epsilon chain 9.06e-10 3.69e-13 0.017 0.9205
1. PBF Q3A947 ATP synthase epsilon chain 1.89e-15 1.11e-07 0.001 0.9318
1. PBF Q03A17 ATP synthase epsilon chain 4.52e-13 4.01e-06 0.026 0.8406
1. PBF B8I580 ATP synthase epsilon chain 2.12e-14 1.80e-03 1.44e-04 0.9238
1. PBF A5IUP7 ATP synthase epsilon chain 7.49e-14 2.53e-06 2.20e-07 0.9285
1. PBF Q9S5B5 ATP synthase epsilon chain 1.11e-15 1.44e-06 9.67e-07 0.9304
1. PBF Q9A2W1 ATP synthase epsilon chain 1.11e-16 8.94e-25 1.55e-06 0.9282
1. PBF B9E8E5 ATP synthase epsilon chain 1.90e-13 1.46e-02 6.43e-06 0.8797
1. PBF Q8RGE3 ATP synthase epsilon chain 7.99e-13 2.03e-04 1.51e-05 0.8999
1. PBF B7HFK0 ATP synthase epsilon chain 4.44e-16 1.01e-06 2.03e-04 0.9349
1. PBF C1F0M7 ATP synthase epsilon chain 3.33e-16 1.01e-06 2.03e-04 0.9352
1. PBF A7GV55 ATP synthase epsilon chain 4.44e-16 4.53e-06 4.52e-04 0.934
1. PBF Q39Q57 ATP synthase epsilon chain 0.00e+00 1.57e-04 4.80e-04 0.9464
1. PBF B7GMF2 ATP synthase epsilon chain 1.11e-16 2.51e-05 2.96e-04 0.8838
1. PBF Q8CNJ8 ATP synthase epsilon chain 4.93e-14 1.16e-06 5.53e-07 0.9492
1. PBF Q50332 ATP synthase epsilon chain 7.82e-13 3.42e-05 0.001 0.8454
1. PBF B3WDL9 ATP synthase epsilon chain 4.59e-13 4.01e-06 0.026 0.8441
1. PBF Q5KUJ4 ATP synthase epsilon chain 1.11e-16 6.04e-06 2.92e-04 0.8831
1. PBF A7X4U2 ATP synthase epsilon chain 8.08e-14 2.53e-06 2.20e-07 0.9282
1. PBF A8ZUA2 ATP synthase epsilon chain 1.55e-15 6.16e-10 0.003 0.8664
1. PBF Q72SX8 ATP synthase epsilon chain 3.02e-13 1.11e-13 0.011 0.8657
1. PBF Q4L7Y3 ATP synthase epsilon chain 8.73e-14 1.11e-07 2.91e-08 0.9481
1. PBF P30400 ATP synthase epsilon chain, plastid 6.55e-15 1.35e-04 0.015 0.8776
1. PBF B7HY63 ATP synthase epsilon chain 3.33e-16 1.01e-06 2.03e-04 0.9353
1. PBF C4KYS2 ATP synthase epsilon chain 1.44e-15 1.39e-06 0.001 0.9004
1. PBF P32979 ATP synthase epsilon chain, chloroplastic 1.95e-09 5.01e-07 4.53e-04 0.9434
1. PBF P78700 ATP synthase subunit delta, mitochondrial 2.79e-08 4.33e-02 0.039 0.9473
1. PBF A4XKW9 ATP synthase epsilon chain 3.00e-15 1.04e-02 1.13e-06 0.8676
1. PBF B8DBI2 ATP synthase epsilon chain 6.15e-14 6.60e-06 0.046 0.8574
1. PBF B8JCU9 ATP synthase epsilon chain 1.43e-14 2.29e-07 0.004 0.9413
1. PBF A4YKE1 ATP synthase epsilon chain 1.82e-13 6.74e-06 2.76e-04 0.9293
1. PBF Q332X2 ATP synthase epsilon chain, chloroplastic 1.52e-09 3.47e-06 0.005 0.8749
1. PBF P48083 ATP synthase epsilon chain, cyanelle 6.63e-14 8.86e-08 6.62e-04 0.9184
1. PBF Q71WQ0 ATP synthase epsilon chain 6.55e-14 8.97e-06 0.046 0.8567
1. PBF Q09MH2 ATP synthase epsilon chain, chloroplastic 1.78e-09 6.17e-07 0.001 0.8731
1. PBF Q10Z37 ATP synthase epsilon chain 3.33e-15 9.87e-05 0.002 0.8795
1. PBF B1LBB8 ATP synthase epsilon chain 9.99e-16 8.00e-24 5.91e-07 0.8404
1. PBF Q7UFB4 ATP synthase epsilon chain 3.01e-09 6.80e-08 0.005 0.8965
1. PBF B9MS67 ATP synthase epsilon chain 1.33e-15 6.71e-05 2.71e-07 0.8712
1. PBF B4U9G2 ATP synthase epsilon chain 2.30e-07 4.47e-03 0.013 0.8818
1. PBF Q81JZ6 ATP synthase epsilon chain 7.77e-16 1.08e-06 2.07e-04 0.9322
1. PBF Q06GQ4 ATP synthase epsilon chain, chloroplastic 5.66e-15 1.17e-06 0.002 0.8776
1. PBF P00833 ATP synthase epsilon chain, chloroplastic 1.19e-09 4.80e-05 6.93e-04 0.8769
1. PBF B5E669 ATP synthase epsilon chain 4.08e-13 1.23e-02 0.018 0.8302
1. PBF A0RL94 ATP synthase epsilon chain 4.44e-16 1.01e-06 2.03e-04 0.9343
1. PBF Q6AQ09 ATP synthase epsilon chain 2.89e-15 3.88e-05 1.65e-08 0.9043
1. PBF Q9TJR8 ATP synthase epsilon chain, plastid 8.77e-15 2.40e-07 1.02e-04 0.9391
1. PBF C6E9F0 ATP synthase epsilon chain 2.26e-09 2.21e-05 0.003 0.9448
1. PBF P00834 ATP synthase epsilon chain, chloroplastic 1.27e-09 1.27e-06 2.63e-04 0.875
1. PBF Q98QU6 ATP synthase epsilon chain 9.66e-09 8.19e-03 8.71e-05 0.9118
1. PBF B2Y1W6 ATP synthase epsilon chain, chloroplastic 1.80e-14 2.67e-04 0.019 0.8747
1. PBF Q6G7K8 ATP synthase epsilon chain 6.63e-14 2.53e-06 2.20e-07 0.9289
1. PBF Q9MTP6 ATP synthase epsilon chain, chloroplastic 1.01e-14 1.00e-06 1.97e-04 0.8744
1. PBF P63666 ATP synthase epsilon chain 7.64e-14 2.53e-06 2.20e-07 0.9286
1. PBF Q814W3 ATP synthase epsilon chain 3.33e-16 1.01e-06 2.03e-04 0.9352
1. PBF Q49KZ2 ATP synthase epsilon chain, chloroplastic 7.55e-15 1.73e-06 0.002 0.8753
1. PBF A5G9D9 ATP synthase epsilon chain 0.00e+00 9.08e-05 3.17e-04 0.9472
1. PBF A7H016 ATP synthase epsilon chain 3.70e-09 5.90e-09 0.002 0.9083
1. PBF Q3A604 ATP synthase epsilon chain 1 2.56e-09 4.15e-04 0.009 0.9461
1. PBF Q06J28 ATP synthase epsilon chain, chloroplastic 6.39e-12 1.42e-02 1.92e-05 0.8532
1. PBF A9VSA2 ATP synthase epsilon chain 5.55e-16 3.88e-07 1.95e-04 0.9333
1. PBF Q74K14 ATP synthase epsilon chain 1.78e-13 5.49e-04 0.024 0.8888
1. PBF P12699 ATP synthase epsilon chain 1.07e-14 2.05e-06 0.002 0.9365
1. PBF Q20EW9 ATP synthase epsilon chain, chloroplastic 7.99e-15 8.48e-09 2.61e-08 0.8779
1. PBF Q06GZ1 ATP synthase epsilon chain, chloroplastic 4.33e-15 1.54e-06 0.001 0.8779
1. PBF P0A2Z8 ATP synthase epsilon chain 5.88e-15 3.95e-04 0.010 0.9249
1. PBF Q3BAN6 ATP synthase epsilon chain, chloroplastic 1.63e-09 1.23e-05 3.11e-05 0.8713
1. PBF Q6KI83 ATP synthase epsilon chain 1.02e-08 1.88e-05 8.86e-04 0.9
1. PBF A0T0R7 ATP synthase epsilon chain, chloroplastic 3.33e-16 1.41e-06 0.024 0.9392
1. PBF Q9TL33 ATP synthase epsilon chain, chloroplastic 1.25e-09 1.52e-08 1.87e-05 0.9417
1. PBF P47638 ATP synthase epsilon chain 4.17e-13 1.11e-04 4.81e-04 0.8964
1. PBF C1CLK5 ATP synthase epsilon chain 3.67e-13 1.23e-02 0.018 0.8305
1. PBF Q0G9L3 ATP synthase epsilon chain, chloroplastic 4.88e-15 4.28e-06 0.002 0.877
1. PBF P63665 ATP synthase epsilon chain 8.50e-14 2.53e-06 2.20e-07 0.9281
1. PBF C6BSP5 ATP synthase epsilon chain 9.99e-16 1.11e-03 1.47e-09 0.9405
1. PBF Q8DLG7 ATP synthase epsilon chain 1.37e-14 2.46e-04 0.002 0.9408
1. PBF Q1KXV3 ATP synthase epsilon chain, chloroplastic 1.52e-09 4.14e-06 0.002 0.875
1. PBF Q4A605 ATP synthase epsilon chain 1.53e-11 4.59e-04 0.003 0.8774
1. PBF Q5HMC0 ATP synthase epsilon chain 7.58e-14 1.01e-06 5.19e-07 0.9476
1. PBF Q1ACK2 ATP synthase epsilon chain, chloroplastic 3.66e-15 2.96e-06 1.58e-04 0.9452
1. PBF Q630U4 ATP synthase epsilon chain 3.33e-16 1.01e-06 2.03e-04 0.9353
1. PBF Q9TKI6 ATP synthase epsilon chain, chloroplastic 3.22e-09 6.69e-03 0.001 0.8598
1. PBF P43453 ATP synthase epsilon chain 4.31e-14 2.90e-06 0.024 0.8398
1. PBF B7JGM9 ATP synthase epsilon chain 5.55e-16 1.08e-06 2.07e-04 0.9334
1. PBF Q0G9V6 ATP synthase epsilon chain, chloroplastic 1.25e-09 1.68e-07 0.004 0.8759
1. PBF C3LFH8 ATP synthase epsilon chain 5.55e-16 1.08e-06 2.07e-04 0.9337
1. PBF Q9RAT9 ATP synthase epsilon chain 4.27e-14 1.12e-04 0.005 0.8395
1. PBF P07891 ATP synthase epsilon chain, chloroplastic 6.84e-09 1.36e-03 8.41e-04 0.8596
1. PBF Q07UZ6 ATP synthase epsilon chain 1.43e-13 1.76e-02 0.020 0.8848
1. PBF A0LLF7 ATP synthase epsilon chain 0.00e+00 1.36e-05 0.021 0.9516
1. PBF B1XI04 ATP synthase epsilon chain 7.16e-14 6.24e-06 5.24e-05 0.8791
1. PBF Q65DX5 ATP synthase epsilon chain 1.11e-16 1.34e-08 0.002 0.8734
2. PF Q0TAX8 ATP synthase epsilon chain 8.33e-09 1.87e-04 NA 0.9092
2. PF A8GPZ3 ATP synthase epsilon chain 3.98e-13 9.59e-33 NA 0.8782
2. PF B0BRX1 ATP synthase epsilon chain 1.99e-13 9.67e-05 NA 0.8483
2. PF Q12HQ2 ATP synthase epsilon chain 2.11e-15 5.92e-03 NA 0.9028
2. PF Q2A1I3 ATP synthase epsilon chain 2.32e-14 2.21e-02 NA 0.9407
2. PF Q5X0P4 ATP synthase epsilon chain 1.03e-13 3.31e-03 NA 0.9211
2. PF Q5NIK2 ATP synthase epsilon chain 2.32e-14 2.96e-02 NA 0.9401
2. PF Q4ZL25 ATP synthase epsilon chain 1.55e-09 7.75e-03 NA 0.9221
2. PF B5RFW4 ATP synthase epsilon chain 6.98e-13 1.74e-04 NA 0.8453
2. PF Q1BRB1 ATP synthase epsilon chain 1 9.33e-09 1.55e-02 NA 0.9071
2. PF B8D6S8 ATP synthase epsilon chain 7.77e-15 4.35e-03 NA 0.8314
2. PF P69445 ATP synthase epsilon chain, chloroplastic 1.03e-14 1.34e-05 NA 0.9201
2. PF A0ALL2 ATP synthase epsilon chain 7.94e-14 2.18e-05 NA 0.8564
2. PF P49648 ATP synthase epsilon chain, chloroplastic 5.55e-16 1.06e-06 NA 0.938
2. PF B3PIS6 ATP synthase epsilon chain 1.72e-08 8.16e-04 NA 0.8522
2. PF B1YQL5 ATP synthase epsilon chain 8.80e-09 1.55e-02 NA 0.9116
2. PF Q5XCX9 ATP synthase epsilon chain 7.41e-14 1.51e-05 NA 0.8316
2. PF B2UZK1 ATP synthase epsilon chain 1.65e-14 7.38e-10 NA 0.8882
2. PF A0Q8D8 ATP synthase epsilon chain 2.35e-14 2.96e-02 NA 0.9402
2. PF Q2P7Q3 ATP synthase epsilon chain 6.24e-13 1.29e-03 NA 0.9182
2. PF B9JBZ4 ATP synthase epsilon chain 8.30e-14 1.29e-03 NA 0.8472
2. PF Q1MAZ3 ATP synthase epsilon chain 4.10e-12 5.22e-05 NA 0.8976
2. PF A5WBA2 ATP synthase epsilon chain 2.79e-14 3.92e-03 NA 0.9201
2. PF Q8XID5 ATP synthase epsilon chain 3.51e-14 5.01e-06 NA 0.9048
2. PF Q60CR3 ATP synthase epsilon chain 1 1.18e-08 9.18e-05 NA 0.9158
2. PF Q1GEU9 ATP synthase epsilon chain 1.00e-11 1.33e-02 NA 0.872
2. PF A6VL56 ATP synthase epsilon chain 7.24e-09 1.05e-04 NA 0.8504
2. PF Q6NHS8 ATP synthase epsilon chain 1.10e-08 3.73e-14 NA 0.8688
2. PF P0CZ97 ATP synthase epsilon chain 5.94e-14 1.51e-05 NA 0.8308
2. PF Q2J3I5 ATP synthase epsilon chain 5.43e-13 1.34e-02 NA 0.8508
2. PF B6JMX1 ATP synthase epsilon chain 4.44e-16 6.16e-14 NA 0.9197
2. PF A4IW25 ATP synthase epsilon chain 2.36e-14 2.96e-02 NA 0.9399
2. PF Q1JMI8 ATP synthase epsilon chain 6.07e-14 1.51e-05 NA 0.8322
2. PF Q8UC77 ATP synthase epsilon chain 4.89e-09 2.82e-05 NA 0.9164
2. PF Q1GAW4 ATP synthase epsilon chain 1.22e-12 2.18e-03 NA 0.8749
2. PF Q11DD4 ATP synthase epsilon chain 2.41e-12 2.02e-05 NA 0.8507
2. PF Q1JHN4 ATP synthase epsilon chain 7.83e-14 7.20e-06 NA 0.8228
2. PF Q87KA9 ATP synthase epsilon chain 9.63e-13 5.33e-05 NA 0.9058
2. PF A0R1Z9 ATP synthase epsilon chain 1.43e-13 1.64e-16 NA 0.8938
2. PF Q0SGQ0 ATP synthase epsilon chain 4.90e-09 2.24e-16 NA 0.8339
2. PF Q0C101 ATP synthase epsilon chain 2.56e-09 2.83e-04 NA 0.9089
2. PF Q7MGI1 ATP synthase epsilon chain 5.36e-13 1.69e-06 NA 0.9072
2. PF Q2NQ85 ATP synthase epsilon chain 5.64e-13 6.01e-04 NA 0.8446
2. PF A7MMW8 ATP synthase epsilon chain 6.70e-13 3.99e-04 NA 0.9056
2. PF A9WWS1 ATP synthase epsilon chain 9.25e-12 1.31e-02 NA 0.8952
2. PF Q48UD2 ATP synthase epsilon chain 5.75e-14 1.51e-05 NA 0.8305
2. PF Q8E5U7 ATP synthase epsilon chain 4.60e-13 3.30e-04 NA 0.8334
2. PF Q7TUS2 ATP synthase epsilon chain 3.77e-15 3.35e-05 NA 0.9428
2. PF Q477Z0 ATP synthase epsilon chain 1.46e-13 3.47e-03 NA 0.8982
2. PF A3P0Y9 ATP synthase epsilon chain 1.12e-08 1.50e-02 NA 0.8455
2. PF C3PFR6 ATP synthase epsilon chain 3.03e-11 3.61e-12 NA 0.8202
2. PF C3K1E5 ATP synthase epsilon chain 3.29e-14 2.38e-05 NA 0.9233
2. PF B8EDU9 ATP synthase epsilon chain 6.22e-15 3.13e-03 NA 0.851
2. PF B7I1W5 ATP synthase epsilon chain 2.13e-14 1.42e-05 NA 0.8936
2. PF Q3K442 ATP synthase epsilon chain 6.78e-09 2.31e-02 NA 0.9234
2. PF Q8PGG8 ATP synthase epsilon chain 3.05e-14 8.57e-04 NA 0.9014
2. PF C4LJL3 ATP synthase epsilon chain 1.39e-12 1.15e-09 NA 0.8806
2. PF B3Q744 ATP synthase epsilon chain 1.05e-08 1.11e-03 NA 0.8511
2. PF A3MQK0 ATP synthase epsilon chain 1.21e-08 1.50e-02 NA 0.8453
2. PF B5QUS3 ATP synthase epsilon chain 6.69e-13 1.74e-04 NA 0.845
2. PF B2S7M2 ATP synthase epsilon chain 8.74e-12 9.85e-03 NA 0.8956
2. PF Q65Q08 ATP synthase epsilon chain 7.86e-09 1.22e-03 NA 0.9148
2. PF B0CAT4 ATP synthase epsilon chain 7.66e-15 1.03e-04 NA 0.8772
2. PF Q1XDM7 ATP synthase epsilon chain, chloroplastic 1.04e-14 4.92e-04 NA 0.9411
2. PF Q5LNP2 ATP synthase epsilon chain 3.84e-12 4.03e-03 NA 0.857
2. PF A8G6T9 ATP synthase epsilon chain 1.18e-09 2.14e-08 NA 0.9384
2. PF P95790 ATP synthase epsilon chain 5.18e-14 1.80e-05 NA 0.8416
2. PF B7N2H0 ATP synthase epsilon chain 8.44e-09 1.87e-04 NA 0.9105
2. PF A6Q4B9 ATP synthase epsilon chain 1.13e-13 3.00e-06 NA 0.9216
2. PF A1VIV3 ATP synthase epsilon chain 7.29e-09 3.50e-02 NA 0.8461
2. PF B0BVB5 ATP synthase epsilon chain 1.51e-13 4.26e-30 NA 0.8903
2. PF A8FJR3 ATP synthase epsilon chain 2.24e-14 2.06e-07 NA 0.858
2. PF Q0I7U0 ATP synthase epsilon chain 3.22e-15 2.62e-05 NA 0.9434
2. PF Q0VKX5 ATP synthase epsilon chain 4.47e-13 2.87e-03 NA 0.9081
2. PF B3CN18 ATP synthase epsilon chain 3.12e-12 8.61e-24 NA 0.8475
2. PF A5N3H6 ATP synthase epsilon chain 2.66e-15 2.56e-09 NA 0.9136
2. PF P45822 ATP synthase epsilon chain 4.31e-09 3.04e-15 NA 0.8226
2. PF P41012 ATP synthase epsilon chain 1.11e-16 1.97e-08 NA 0.8848
2. PF Q62FR4 ATP synthase epsilon chain 1.18e-08 1.50e-02 NA 0.8444
2. PF A8HAG2 ATP synthase epsilon chain 5.55e-15 9.45e-04 NA 0.8483
2. PF C3KYJ4 ATP synthase epsilon chain 5.11e-15 3.53e-07 NA 0.8667
2. PF Q04BA2 ATP synthase epsilon chain 1.45e-12 2.18e-03 NA 0.8739
2. PF B8ZR43 ATP synthase epsilon chain 3.39e-09 3.04e-15 NA 0.8226
2. PF B2I103 ATP synthase epsilon chain 2.02e-14 1.42e-05 NA 0.8937
2. PF B9DRT7 ATP synthase epsilon chain 3.61e-13 3.84e-05 NA 0.8473
2. PF Q46VY1 ATP synthase epsilon chain 1.27e-08 4.35e-03 NA 0.8432
2. PF A9M124 ATP synthase epsilon chain 1.41e-11 2.23e-05 NA 0.8392
2. PF Q5Z0Y0 ATP synthase epsilon chain 2.70e-08 1.40e-15 NA 0.8667
2. PF Q48BG6 ATP synthase epsilon chain 5.63e-09 2.11e-02 NA 0.9229
2. PF Q1Q8A0 ATP synthase epsilon chain 1.11e-15 5.62e-05 NA 0.918
2. PF B5BIN5 ATP synthase epsilon chain 6.03e-13 1.74e-04 NA 0.8458
2. PF P0A2Z7 ATP synthase epsilon chain 4.49e-09 2.46e-11 NA 0.8952
2. PF P50009 ATP synthase epsilon chain, sodium ion specific 1.11e-16 6.92e-07 NA 0.9236
2. PF B3PQ67 ATP synthase epsilon chain 4.03e-12 5.11e-05 NA 0.8993
2. PF A6WXX2 ATP synthase epsilon chain 8.96e-12 2.35e-03 NA 0.8388
2. PF Q8FQ19 ATP synthase epsilon chain 1.03e-08 2.51e-12 NA 0.8805
2. PF C1A1X7 ATP synthase epsilon chain 8.87e-09 1.75e-14 NA 0.8342
2. PF B2SQA9 ATP synthase epsilon chain 5.90e-13 2.92e-04 NA 0.8713
2. PF Q2K3H1 ATP synthase epsilon chain 4.21e-12 7.22e-05 NA 0.8977
2. PF A4SUT5 ATP synthase epsilon chain 1.18e-08 1.41e-03 NA 0.8465
2. PF A3N2U3 ATP synthase epsilon chain 5.63e-12 1.48e-04 NA 0.8489
2. PF Q1CCH6 ATP synthase epsilon chain 4.81e-13 1.07e-03 NA 0.9038
2. PF Q68VU9 ATP synthase epsilon chain 9.10e-10 2.37e-37 NA 0.8788
2. PF B2JJ94 ATP synthase epsilon chain 1.39e-08 3.96e-02 NA 0.9059
2. PF A5CVI5 ATP synthase epsilon chain 4.80e-13 2.36e-04 NA 0.8702
2. PF B2K848 ATP synthase epsilon chain 5.42e-13 2.54e-04 NA 0.9064
2. PF P0A1B7 ATP synthase epsilon chain 6.23e-13 1.74e-04 NA 0.8458
2. PF A5III2 ATP synthase epsilon chain 1.01e-13 3.31e-03 NA 0.9208
2. PF A9M836 ATP synthase epsilon chain 8.62e-12 9.85e-03 NA 0.8951
2. PF Q39KX5 ATP synthase epsilon chain 1.28e-08 1.55e-02 NA 0.9038
2. PF P9WPV0 ATP synthase epsilon chain 5.13e-09 8.53e-16 NA 0.8782
2. PF Q9JW69 ATP synthase epsilon chain 9.40e-09 6.11e-05 NA 0.8635
2. PF A9KX05 ATP synthase epsilon chain 4.53e-13 3.13e-03 NA 0.8509
2. PF A1K1S3 ATP synthase epsilon chain 1.58e-08 3.67e-03 NA 0.8913
2. PF A1VXJ1 ATP synthase epsilon chain 2.51e-14 3.49e-07 NA 0.8584
2. PF Q4UK19 ATP synthase epsilon chain 3.81e-13 5.76e-29 NA 0.8797
2. PF Q1LTV5 ATP synthase epsilon chain 7.99e-13 1.98e-03 NA 0.8443
2. PF P06542 ATP synthase epsilon chain 4.56e-14 1.06e-07 NA 0.9027
2. PF B2VCA3 ATP synthase epsilon chain 1.62e-14 9.48e-06 NA 0.906
2. PF A1U7H3 ATP synthase epsilon chain 3.88e-13 1.09e-03 NA 0.8506
2. PF A5UGY8 ATP synthase epsilon chain 6.78e-12 2.46e-03 NA 0.912
2. PF Q9ETA7 ATP synthase epsilon chain 2.22e-11 1.87e-12 NA 0.8859
2. PF A8AYG0 ATP synthase epsilon chain 4.32e-13 1.64e-02 NA 0.8426
2. PF Q15MU5 ATP synthase epsilon chain 1.58e-14 3.57e-07 NA 0.8455
2. PF Q3AHM1 ATP synthase epsilon chain 8.77e-15 7.00e-05 NA 0.9394
2. PF B1H0B4 ATP synthase epsilon chain 1.71e-12 2.61e-02 NA 0.8504
2. PF C1D5G1 ATP synthase epsilon chain 1.38e-11 2.88e-02 NA 0.8836
2. PF Q6CYJ6 ATP synthase epsilon chain 5.56e-13 4.83e-04 NA 0.8453
2. PF O05434 ATP synthase epsilon chain 8.35e-09 2.37e-06 NA 0.9112
2. PF B0RWC1 ATP synthase epsilon chain 1.88e-11 2.90e-03 NA 0.864
2. PF B4U2E2 ATP synthase epsilon chain 1.39e-12 4.32e-04 NA 0.823
2. PF Q7VPN9 ATP synthase epsilon chain 4.33e-15 2.70e-05 NA 0.85
2. PF Q48AV9 ATP synthase epsilon chain 7.61e-13 1.19e-04 NA 0.8473
2. PF P05441 ATP synthase epsilon chain 7.16e-12 1.39e-06 NA 0.9071
2. PF Q0AJA9 ATP synthase epsilon chain 3.17e-11 4.29e-02 NA 0.904
2. PF A5WBW2 ATP synthase epsilon chain 4.57e-12 2.59e-05 NA 0.9171
2. PF Q2YCA2 ATP synthase epsilon chain 2.00e-08 3.07e-02 NA 0.8288
2. PF B0VBP2 ATP synthase epsilon chain 2.04e-14 1.42e-05 NA 0.8936
2. PF A1UJY3 ATP synthase epsilon chain 5.74e-09 4.05e-16 NA 0.8933
2. PF Q4JUK1 ATP synthase epsilon chain 6.29e-13 1.23e-13 NA 0.8785
2. PF A1KW10 ATP synthase epsilon chain 9.17e-09 1.69e-05 NA 0.8383
2. PF C6DJH3 ATP synthase epsilon chain 6.01e-13 1.85e-03 NA 0.8453
2. PF P0C2Z1 ATP synthase epsilon chain, chloroplastic 7.77e-15 8.40e-06 NA 0.9211
2. PF Q1QSD1 ATP synthase epsilon chain 4.37e-13 4.78e-04 NA 0.9066
2. PF C0Z775 ATP synthase epsilon chain 2.89e-15 5.68e-09 NA 0.9168
2. PF A5EXL3 ATP synthase epsilon chain 8.83e-13 2.92e-03 NA 0.845
2. PF P31477 ATP synthase epsilon chain, chloroplastic 1.90e-14 5.41e-06 NA 0.9203
2. PF Q06FV4 ATP synthase epsilon chain, chloroplastic 2.61e-09 1.18e-04 NA 0.8531
2. PF A0LD99 ATP synthase epsilon chain 1.69e-08 1.87e-04 NA 0.8844
2. PF Q02BU0 ATP synthase epsilon chain 5.92e-09 2.56e-06 NA 0.8658
2. PF Q9ZK82 ATP synthase epsilon chain 3.33e-16 6.16e-14 NA 0.9202
2. PF Q1CX38 ATP synthase epsilon chain 6.20e-13 2.36e-08 NA 0.9388
2. PF A1WF59 ATP synthase epsilon chain 7.89e-12 7.33e-03 NA 0.8464
2. PF Q6G1X0 ATP synthase epsilon chain 3.28e-12 2.24e-07 NA 0.9267
2. PF P69444 ATP synthase epsilon chain, chloroplastic 1.03e-14 1.34e-05 NA 0.92
2. PF Q8RC14 ATP synthase epsilon chain 1.50e-13 7.22e-05 NA 0.9018
2. PF C1AMV5 ATP synthase epsilon chain 5.63e-09 8.53e-16 NA 0.8773
2. PF Q38WK6 ATP synthase epsilon chain 1.02e-08 5.43e-07 NA 0.8285
2. PF Q5H4Y3 ATP synthase epsilon chain 6.05e-13 2.92e-04 NA 0.8716
2. PF Q663Q9 ATP synthase epsilon chain 5.68e-13 1.07e-03 NA 0.9049
2. PF A0RR25 ATP synthase epsilon chain 9.05e-10 1.96e-09 NA 0.9108
2. PF P43718 ATP synthase epsilon chain 6.80e-12 2.46e-03 NA 0.9117
2. PF Q8KAC8 ATP synthase epsilon chain 2.22e-16 6.01e-11 NA 0.9147
2. PF B5EYZ5 ATP synthase epsilon chain 6.77e-13 1.74e-04 NA 0.845
2. PF C3M9S0 ATP synthase epsilon chain 8.42e-14 8.68e-06 NA 0.8694
2. PF P41171 ATP synthase epsilon chain 2.22e-16 1.71e-03 NA 0.918
2. PF C0Q2N1 ATP synthase epsilon chain 6.56e-13 1.74e-04 NA 0.8449
2. PF Q82J85 ATP synthase epsilon chain 3.60e-09 5.13e-13 NA 0.8336
2. PF A7G9R0 ATP synthase epsilon chain 8.44e-15 1.19e-06 NA 0.8646
2. PF Q7VA75 ATP synthase epsilon chain 1.28e-14 7.95e-07 NA 0.861
2. PF P0C2Z2 ATP synthase epsilon chain, chloroplastic 5.66e-15 8.40e-06 NA 0.9222
2. PF A9MJS1 ATP synthase epsilon chain 6.57e-13 2.51e-04 NA 0.8452
2. PF C1FQP6 ATP synthase epsilon chain 6.00e-15 3.53e-07 NA 0.8661
2. PF Q4FQ38 ATP synthase epsilon chain 3.86e-12 3.95e-04 NA 0.9154
2. PF Q6ENV7 ATP synthase epsilon chain, chloroplastic 7.33e-15 6.31e-06 NA 0.9212
2. PF A7HT53 ATP synthase epsilon chain 2.48e-12 1.61e-05 NA 0.9133
2. PF Q57HY0 ATP synthase epsilon chain 6.45e-13 1.74e-04 NA 0.8453
2. PF Q5P4E1 ATP synthase epsilon chain 1.66e-08 1.07e-03 NA 0.8947
2. PF Q9Z686 ATP synthase epsilon chain 6.66e-16 1.53e-12 NA 0.8529
2. PF Q88BX5 ATP synthase epsilon chain 3.35e-14 6.69e-03 NA 0.9197
2. PF A7NEH3 ATP synthase epsilon chain 2.33e-14 2.21e-02 NA 0.9407
2. PF Q1R4K3 ATP synthase epsilon chain 8.14e-09 1.87e-04 NA 0.9108
2. PF A0T0D1 ATP synthase epsilon chain, chloroplastic 4.44e-16 2.42e-06 NA 0.9187
2. PF B8D8H4 ATP synthase epsilon chain 8.10e-15 4.35e-03 NA 0.8313
2. PF B4F0E8 ATP synthase epsilon chain 4.29e-13 9.27e-06 NA 0.9056
2. PF A7FQI0 ATP synthase epsilon chain 5.44e-15 1.09e-07 NA 0.8662
2. PF C5BKJ4 ATP synthase epsilon chain 1.63e-08 4.95e-06 NA 0.878
2. PF A8EV69 ATP synthase epsilon chain 5.58e-14 4.51e-13 NA 0.937
2. PF Q3SF67 ATP synthase epsilon chain 2 1.16e-08 8.02e-05 NA 0.9023
2. PF A7ZTU3 ATP synthase epsilon chain 6.22e-15 1.87e-04 NA 0.91
2. PF A4VVJ8 ATP synthase epsilon chain 8.93e-09 9.58e-03 NA 0.8504
2. PF Q17Y77 ATP synthase epsilon chain 9.33e-10 7.33e-13 NA 0.9198
2. PF A1KI99 ATP synthase epsilon chain 5.10e-09 8.53e-16 NA 0.8785
2. PF B7M587 ATP synthase epsilon chain 5.22e-15 1.87e-04 NA 0.9109
2. PF Q73X60 ATP synthase epsilon chain 3.99e-09 5.16e-17 NA 0.8434
2. PF A2RFC1 ATP synthase epsilon chain 6.11e-14 7.20e-06 NA 0.8231
2. PF A2S6J7 ATP synthase epsilon chain 1.17e-08 1.50e-02 NA 0.8456
2. PF B5XKQ2 ATP synthase epsilon chain 6.62e-14 1.51e-05 NA 0.8348
2. PF Q7VJ20 ATP synthase epsilon chain 5.94e-09 4.87e-10 NA 0.897
2. PF Q98EV9 ATP synthase epsilon chain 6.83e-14 7.78e-06 NA 0.8526
2. PF A3PES7 ATP synthase epsilon chain 1.23e-09 3.06e-08 NA 0.9386
2. PF Q329S0 ATP synthase epsilon chain 8.49e-09 1.87e-04 NA 0.9095
2. PF Q0TNC5 ATP synthase epsilon chain 2.99e-14 5.01e-06 NA 0.9054
2. PF P63670 ATP synthase epsilon chain 5.78e-14 1.51e-05 NA 0.8374
2. PF B1IE35 ATP synthase epsilon chain 5.44e-15 3.53e-07 NA 0.8662
2. PF A7HIX6 ATP synthase epsilon chain 5.04e-14 1.65e-05 NA 0.9359
2. PF Q2YLE7 ATP synthase epsilon chain 9.40e-12 9.85e-03 NA 0.8931
2. PF Q5ZRA2 ATP synthase epsilon chain 9.19e-14 3.31e-03 NA 0.9206
2. PF A3Q3B0 ATP synthase epsilon chain 5.43e-09 4.05e-16 NA 0.8939
2. PF B7K2R7 ATP synthase epsilon chain 3.00e-15 9.67e-05 NA 0.8712
2. PF B2HQK1 ATP synthase epsilon chain 5.62e-09 1.24e-13 NA 0.8777
2. PF B8EQQ2 ATP synthase epsilon chain 2.09e-13 4.80e-05 NA 0.9145
2. PF Q04ZU6 ATP synthase epsilon chain 5.70e-10 1.24e-13 NA 0.8606
2. PF O78492 ATP synthase epsilon chain, chloroplastic 2.89e-15 4.90e-06 NA 0.8802
2. PF A8GTS5 ATP synthase epsilon chain 9.50e-14 4.26e-30 NA 0.8919
2. PF A4FN26 ATP synthase epsilon chain 1.50e-08 1.33e-16 NA 0.8264
2. PF A6LQH7 ATP synthase epsilon chain 4.85e-14 1.75e-07 NA 0.8529
2. PF B3EA00 ATP synthase epsilon chain 0.00e+00 7.93e-05 NA 0.9455
2. PF Q1B554 ATP synthase epsilon chain 5.48e-09 4.05e-16 NA 0.8937
2. PF P12988 ATP synthase epsilon chain 1.09e-12 9.58e-06 NA 0.9033
2. PF A4WUM6 ATP synthase epsilon chain 1.02e-11 1.39e-05 NA 0.9059
2. PF Q92G89 ATP synthase epsilon chain 1.48e-13 4.34e-30 NA 0.8894
2. PF Q8XU77 ATP synthase epsilon chain 1 9.11e-09 1.88e-02 NA 0.9211
2. PF Q31UN1 ATP synthase epsilon chain 6.92e-13 1.67e-04 NA 0.8456
2. PF Q1AVI0 ATP synthase epsilon chain 1.28e-11 9.36e-04 NA 0.9154
2. PF Q5M5J0 ATP synthase epsilon chain 6.62e-13 2.88e-02 NA 0.8443
2. PF A4GAG8 ATP synthase epsilon chain 1.03e-08 4.97e-04 NA 0.8915
2. PF Q4G3C9 ATP synthase epsilon chain, chloroplastic 1.22e-15 1.76e-08 NA 0.8982
2. PF A3DIN0 ATP synthase epsilon chain 3.44e-15 9.69e-06 NA 0.932
2. PF Q7TU42 ATP synthase epsilon chain 1.14e-09 1.22e-07 NA 0.9391
2. PF A5GV56 ATP synthase epsilon chain 1.67e-09 4.80e-05 NA 0.9434
2. PF Q042L6 ATP synthase epsilon chain 2.06e-13 3.47e-04 NA 0.8882
2. PF Q9A0I6 ATP synthase epsilon chain 7.31e-14 1.32e-04 NA 0.8281
2. PF Q6NDD3 ATP synthase epsilon chain 6.15e-13 1.11e-03 NA 0.8506
2. PF Q9CKW0 ATP synthase epsilon chain 5.53e-09 8.57e-04 NA 0.9108
2. PF C1AVZ8 ATP synthase epsilon chain 5.90e-09 1.60e-15 NA 0.8335
2. PF B0TWS8 ATP synthase epsilon chain 1.69e-14 1.42e-03 NA 0.9422
2. PF Q5WSG9 ATP synthase epsilon chain 1.03e-13 2.66e-03 NA 0.9203
2. PF Q5E1N8 ATP synthase epsilon chain 5.36e-13 3.88e-07 NA 0.906
2. PF A1AXU1 ATP synthase epsilon chain 8.17e-12 6.70e-04 NA 0.8985
2. PF Q8VV76 ATP synthase epsilon chain 4.66e-13 3.13e-03 NA 0.8487
2. PF Q0SQZ6 ATP synthase epsilon chain 3.36e-14 2.56e-05 NA 0.9093
2. PF P41623 ATP synthase epsilon chain, chloroplastic 1.94e-09 6.44e-05 NA 0.9415
2. PF Q46J67 ATP synthase epsilon chain 4.11e-15 5.91e-06 NA 0.9416
2. PF P58647 ATP synthase epsilon chain 5.20e-13 2.54e-04 NA 0.9046
2. PF B7UMJ6 ATP synthase epsilon chain 6.44e-15 1.87e-04 NA 0.9111
2. PF Q757N0 ATP synthase subunit delta, mitochondrial 4.56e-13 2.43e-02 NA 0.9283
2. PF A5U210 ATP synthase epsilon chain 5.83e-09 8.53e-16 NA 0.8763
2. PF Q47M83 ATP synthase epsilon chain 1.19e-07 1.82e-09 NA 0.8548
2. PF Q5HX58 ATP synthase epsilon chain 2.78e-14 3.49e-07 NA 0.8577
2. PF B9JTR1 ATP synthase epsilon chain 1.07e-14 5.59e-06 NA 0.903
2. PF Q7U8U8 ATP synthase epsilon chain 6.22e-15 1.03e-03 NA 0.9393
2. PF Q1JCL2 ATP synthase epsilon chain 8.00e-14 1.51e-05 NA 0.83
2. PF Q3J6N2 ATP synthase epsilon chain 5.44e-15 1.24e-03 NA 0.9132
2. PF Q4UQF5 ATP synthase epsilon chain 6.98e-13 2.90e-03 NA 0.8639
2. PF A2C6Z3 ATP synthase epsilon chain 3.77e-15 1.86e-05 NA 0.9402
2. PF Q8E071 ATP synthase epsilon chain 3.90e-13 6.44e-04 NA 0.8339
2. PF A4WGF6 ATP synthase epsilon chain 7.21e-13 5.17e-04 NA 0.9056
2. PF B5ZSN5 ATP synthase epsilon chain 3.62e-12 4.27e-05 NA 0.9001
2. PF B1X9V9 ATP synthase epsilon chain 8.40e-09 1.87e-04 NA 0.9101
2. PF B3H2P2 ATP synthase epsilon chain 6.21e-12 9.67e-05 NA 0.8483
2. PF Q4QN65 ATP synthase epsilon chain 6.67e-12 2.46e-03 NA 0.9127
2. PF Q92LK9 ATP synthase epsilon chain 1.82e-14 3.14e-06 NA 0.9057
2. PF B1JFU0 ATP synthase epsilon chain 3.21e-14 3.31e-03 NA 0.9195
2. PF B9MBA4 ATP synthase epsilon chain 9.99e-15 1.26e-02 NA 0.8478
2. PF A7I178 ATP synthase epsilon chain 1.89e-08 8.51e-10 NA 0.9015
2. PF Q0AUD4 ATP synthase epsilon chain 3.71e-09 8.04e-07 NA 0.913
2. PF Q21CY8 ATP synthase epsilon chain 6.81e-09 5.76e-03 NA 0.9285
2. PF P80286 ATP synthase epsilon chain 3.95e-13 6.01e-32 NA 0.8595
2. PF A5CYE1 ATP synthase epsilon chain 2.00e-15 2.24e-07 NA 0.9296
2. PF C0M721 ATP synthase epsilon chain 1.46e-12 4.47e-03 NA 0.8249
2. PF A4YCH7 ATP synthase epsilon chain 2.78e-15 2.16e-03 NA 0.8516
2. PF Q5F4Y9 ATP synthase epsilon chain 1.21e-08 1.48e-05 NA 0.8358
2. PF P58646 ATP synthase epsilon chain 7.05e-13 1.85e-04 NA 0.9062
2. PF Q8D3J2 ATP synthase epsilon chain 1.79e-12 1.60e-04 NA 0.8932
2. PF A5HY53 ATP synthase epsilon chain 5.44e-15 1.09e-07 NA 0.8665
2. PF Q7NA95 ATP synthase epsilon chain 5.33e-14 3.35e-05 NA 0.9
2. PF A2C4I5 ATP synthase epsilon chain 4.11e-15 1.16e-06 NA 0.9416
2. PF P56084 ATP synthase epsilon chain 8.43e-10 8.51e-14 NA 0.9214
2. PF Q3MAS1 ATP synthase epsilon chain 2.38e-09 1.79e-07 NA 0.9147
2. PF B6I3W8 ATP synthase epsilon chain 8.25e-09 1.87e-04 NA 0.9104
2. PF A9BCC7 ATP synthase epsilon chain 7.77e-16 3.38e-05 NA 0.9396
2. PF Q2G5N4 ATP synthase epsilon chain 4.22e-15 5.50e-17 NA 0.8862
2. PF A2BT13 ATP synthase epsilon chain 1.19e-09 5.27e-09 NA 0.9389
2. PF Q6B8S5 ATP synthase epsilon chain, chloroplastic 4.77e-15 8.49e-06 NA 0.9291
2. PF C0Q977 ATP synthase epsilon chain 2.78e-15 2.03e-04 NA 0.9318
2. PF A3DAR3 ATP synthase epsilon chain 6.77e-15 2.22e-03 NA 0.8505
2. PF Q9KNH6 ATP synthase epsilon chain 7.95e-13 1.72e-05 NA 0.9068
2. PF A8GY39 ATP synthase epsilon chain 7.65e-12 1.16e-42 NA 0.8976
2. PF Q1C096 ATP synthase epsilon chain 4.81e-13 1.07e-03 NA 0.9053
2. PF B2A3G1 ATP synthase epsilon chain 1.43e-08 1.36e-05 NA 0.8998
2. PF Q8PCZ4 ATP synthase epsilon chain 7.00e-13 2.90e-03 NA 0.8702
2. PF Q7VQV5 ATP synthase epsilon chain 5.09e-13 1.12e-03 NA 0.9268
2. PF Q9RGY0 ATP synthase epsilon chain 2.13e-13 1.02e-05 NA 0.8746
2. PF Q3BP16 ATP synthase epsilon chain 3.00e-14 8.57e-04 NA 0.8642
2. PF B5ZAW0 ATP synthase epsilon chain 4.61e-12 8.32e-04 NA 0.8731
2. PF Q2RV17 ATP synthase epsilon chain 1.67e-12 3.04e-04 NA 0.8443
2. PF A0QCX9 ATP synthase epsilon chain 4.27e-09 5.16e-17 NA 0.8426
2. PF B1IX07 ATP synthase epsilon chain 3.32e-13 1.87e-04 NA 0.9117
2. PF Q7VU43 ATP synthase epsilon chain 5.12e-09 2.96e-02 NA 0.9076
2. PF A6W3S7 ATP synthase epsilon chain 9.75e-13 7.15e-05 NA 0.8422
2. PF A1WZT0 ATP synthase epsilon chain 1.67e-11 4.35e-03 NA 0.8958
2. PF Q8DDG7 ATP synthase epsilon chain 2.02e-14 1.69e-06 NA 0.9069
2. PF A0L2S7 ATP synthase epsilon chain 4.44e-15 1.15e-04 NA 0.8521
2. PF P69443 ATP synthase epsilon chain, chloroplastic 7.66e-15 1.34e-05 NA 0.9213
2. PF Q0HD80 ATP synthase epsilon chain 5.78e-12 1.15e-04 NA 0.8529
2. PF Q9ZJ00 ATP synthase epsilon chain 3.46e-13 4.31e-03 NA 0.8451
2. PF C4K226 ATP synthase epsilon chain 1.19e-13 4.73e-31 NA 0.8897
2. PF B2IUL1 ATP synthase epsilon chain 3.22e-14 3.64e-05 NA 0.8898
2. PF P06285 ATP synthase epsilon chain, chloroplastic 2.62e-09 2.16e-04 NA 0.872
2. PF Q2S6P2 ATP synthase epsilon chain 1.85e-13 5.60e-04 NA 0.8527
2. PF Q3SI38 ATP synthase epsilon chain 1 2.20e-14 1.68e-03 NA 0.9057
2. PF Q3AZK6 ATP synthase epsilon chain 4.55e-15 4.55e-05 NA 0.94
2. PF A1E9T0 ATP synthase epsilon chain, chloroplastic 2.03e-14 6.31e-06 NA 0.9159
2. PF Q28TJ5 ATP synthase epsilon chain 6.96e-12 1.18e-05 NA 0.9116
2. PF B2TK01 ATP synthase epsilon chain 1.55e-14 3.25e-10 NA 0.8885
2. PF Q57B89 ATP synthase epsilon chain 9.34e-12 9.85e-03 NA 0.8958
2. PF Q5QZH3 ATP synthase epsilon chain 9.17e-09 8.08e-04 NA 0.8776
2. PF B4SYD0 ATP synthase epsilon chain 6.06e-13 1.74e-04 NA 0.8453
2. PF Q2LR04 ATP synthase epsilon chain 3.58e-09 2.54e-03 NA 0.8784
2. PF Q1I2I8 ATP synthase epsilon chain 3.40e-14 1.40e-03 NA 0.9193
2. PF A3M145 ATP synthase epsilon chain 2.36e-14 1.42e-05 NA 0.893
2. PF B0UWG4 ATP synthase epsilon chain 7.31e-09 2.33e-03 NA 0.8479
2. PF Q0I5X4 ATP synthase epsilon chain 7.42e-09 1.48e-03 NA 0.8487
2. PF Q7P094 ATP synthase epsilon chain 5.77e-09 5.50e-03 NA 0.8371
2. PF A6UDM0 ATP synthase epsilon chain 1.30e-14 3.28e-06 NA 0.9078
2. PF Q7MSF4 ATP synthase epsilon chain 4.72e-09 4.84e-11 NA 0.9042
2. PF B7L881 ATP synthase epsilon chain 3.27e-13 1.87e-04 NA 0.9105
2. PF A4QDH4 ATP synthase epsilon chain 1.12e-08 1.60e-12 NA 0.8804
2. PF Q318V3 ATP synthase epsilon chain 1.32e-09 2.51e-08 NA 0.8729
2. PF P0CZ96 ATP synthase epsilon chain 6.27e-14 1.51e-05 NA 0.8372
2. PF C4ZZ09 ATP synthase epsilon chain 8.67e-09 1.87e-04 NA 0.9092
2. PF Q3IK29 ATP synthase epsilon chain 4.86e-13 7.90e-03 NA 0.8444
2. PF Q7WEN0 ATP synthase epsilon chain 5.18e-09 2.96e-02 NA 0.9069
2. PF A5GNB2 ATP synthase epsilon chain 1.10e-14 2.63e-03 NA 0.9423
2. PF Q3YVN5 ATP synthase epsilon chain 9.04e-09 1.87e-04 NA 0.9083
2. PF B7MGF1 ATP synthase epsilon chain 8.36e-09 1.87e-04 NA 0.909
2. PF B1LL58 ATP synthase epsilon chain 8.43e-09 1.87e-04 NA 0.9093
2. PF B0VNK5 ATP synthase epsilon chain 1.12e-11 5.12e-06 NA 0.8915
2. PF C0RF49 ATP synthase epsilon chain 1.00e-11 9.85e-03 NA 0.8947
2. PF Q0SYU5 ATP synthase epsilon chain 6.22e-15 1.87e-04 NA 0.91
2. PF Q4FP39 ATP synthase epsilon chain 1.53e-12 6.69e-09 NA 0.8606
2. PF Q8XRM1 ATP synthase epsilon chain 2 3.70e-13 3.50e-02 NA 0.9091
2. PF A9BPU8 ATP synthase epsilon chain 7.97e-12 8.00e-04 NA 0.9081
2. PF B1VFY8 ATP synthase epsilon chain 8.34e-13 1.49e-10 NA 0.7965
2. PF P0A2Z6 ATP synthase epsilon chain 4.62e-09 2.46e-11 NA 0.89
2. PF Q13IW4 ATP synthase epsilon chain 2 9.74e-13 1.11e-04 NA 0.901
2. PF Q6LKZ5 ATP synthase epsilon chain 2 4.68e-13 3.00e-06 NA 0.8963
2. PF P63660 ATP synthase epsilon chain 7.72e-12 9.85e-03 NA 0.896
2. PF Q04S19 ATP synthase epsilon chain 7.19e-14 1.24e-13 NA 0.8423
2. PF P35111 ATP synthase epsilon chain 2.22e-16 2.15e-12 NA 0.9149
2. PF Q0BK85 ATP synthase epsilon chain 2.34e-14 2.21e-02 NA 0.9408
2. PF Q162T0 ATP synthase epsilon chain 1.15e-11 1.09e-02 NA 0.8524
2. PF A3QJQ9 ATP synthase epsilon chain 8.33e-15 2.35e-03 NA 0.8505
2. PF B9KES4 ATP synthase epsilon chain 3.03e-09 3.37e-08 NA 0.9102
2. PF A1W2T8 ATP synthase epsilon chain 1.04e-14 1.26e-02 NA 0.8478
2. PF B0KRA7 ATP synthase epsilon chain 2.82e-14 1.69e-03 NA 0.9196
2. PF B1JRN3 ATP synthase epsilon chain 5.44e-13 2.54e-04 NA 0.9062
2. PF A1EA14 ATP synthase epsilon chain, chloroplastic 1.02e-14 1.02e-05 NA 0.9188
2. PF A1TD54 ATP synthase epsilon chain 4.80e-09 9.75e-15 NA 0.8835
2. PF Q03QY9 ATP synthase epsilon chain 4.00e-15 6.88e-08 NA 0.8769
2. PF B7H293 ATP synthase epsilon chain 1.38e-08 1.42e-05 NA 0.8477
2. PF Q9PE86 ATP synthase epsilon chain 8.32e-13 2.29e-02 NA 0.9171
2. PF P05442 ATP synthase epsilon chain 1.82e-12 3.04e-04 NA 0.8438
2. PF Q07VU5 ATP synthase epsilon chain 1.96e-12 2.91e-05 NA 0.9053
2. PF Q494C2 ATP synthase epsilon chain 3.53e-13 2.41e-02 NA 0.8498
2. PF A7ZC38 ATP synthase epsilon chain 3.46e-09 4.04e-09 NA 0.9036
2. PF B1W0A2 ATP synthase epsilon chain 4.52e-09 3.85e-13 NA 0.8899
2. PF Q14K05 ATP synthase epsilon chain 2.26e-14 2.96e-02 NA 0.9403
2. PF Q0HPG2 ATP synthase epsilon chain 5.74e-12 1.15e-04 NA 0.8525
2. PF A4W1V6 ATP synthase epsilon chain 2.68e-13 9.58e-03 NA 0.8507
2. PF A8YUK2 ATP synthase epsilon chain 1.14e-13 2.07e-06 NA 0.8781
2. PF A8A6J4 ATP synthase epsilon chain 5.88e-15 1.87e-04 NA 0.9102
2. PF Q4VZG9 ATP synthase epsilon chain, chloroplastic 4.09e-09 7.28e-06 NA 0.8432
2. PF B8CVU4 ATP synthase epsilon chain 5.00e-15 1.25e-04 NA 0.852
2. PF B1KQ33 ATP synthase epsilon chain 6.33e-15 6.37e-04 NA 0.8982
2. PF P57125 ATP synthase epsilon chain 3.97e-13 4.35e-03 NA 0.8329
2. PF O47036 ATP synthase epsilon chain, chloroplastic 2.24e-09 4.55e-04 NA 0.8779
2. PF Q21DK9 ATP synthase epsilon chain 9.76e-13 1.02e-05 NA 0.9132
2. PF A8G7M9 ATP synthase epsilon chain 8.20e-13 7.69e-05 NA 0.8431
2. PF A7FPD9 ATP synthase epsilon chain 5.25e-13 2.54e-04 NA 0.9065
2. PF Q6FFJ9 ATP synthase epsilon chain 9.87e-13 2.16e-06 NA 0.848
2. PF P63661 ATP synthase epsilon chain 9.57e-12 9.85e-03 NA 0.8951
2. PF Q87E91 ATP synthase epsilon chain 9.39e-13 1.57e-02 NA 0.9115
2. PF A9R5T8 ATP synthase epsilon chain 5.66e-13 2.54e-04 NA 0.9043
2. PF Q9PJ18 ATP synthase epsilon chain 2.30e-14 3.49e-07 NA 0.8586
2. PF A7H1I2 ATP synthase epsilon chain 5.56e-14 2.86e-07 NA 0.8558
2. PF A1V8T0 ATP synthase epsilon chain 1.08e-08 1.50e-02 NA 0.845
2. PF Q1GXN1 ATP synthase epsilon chain 1.66e-11 4.83e-04 NA 0.9019
2. PF O50160 ATP synthase epsilon chain 5.89e-13 1.25e-04 NA 0.844
2. PF A8ACN5 ATP synthase epsilon chain 7.07e-13 6.57e-04 NA 0.9062
2. PF Q9JXQ3 ATP synthase epsilon chain 1.03e-08 1.04e-04 NA 0.8387
2. PF P63663 ATP synthase epsilon chain 4.99e-09 8.53e-16 NA 0.8789
2. PF Q9MUT4 ATP synthase epsilon chain, chloroplastic 6.44e-15 2.88e-10 NA 0.9254
2. PF Q1LHL1 ATP synthase epsilon chain 1.16e-08 2.76e-02 NA 0.8423
2. PF A5UA12 ATP synthase epsilon chain 6.52e-12 2.46e-03 NA 0.9115
2. PF Q6ENG8 ATP synthase epsilon chain, chloroplastic 7.88e-15 8.40e-06 NA 0.9201
2. PF P69446 ATP synthase epsilon chain, chloroplastic 7.77e-15 1.34e-05 NA 0.9198
2. PF B7NR33 ATP synthase epsilon chain 8.42e-09 1.87e-04 NA 0.9092
2. PF A3NF39 ATP synthase epsilon chain 1.18e-08 1.50e-02 NA 0.8457
2. PF B2KEX4 ATP synthase epsilon chain 2.56e-14 5.12e-06 NA 0.9508
2. PF Q1RKD6 ATP synthase epsilon chain 6.43e-12 1.16e-42 NA 0.9061
2. PF Q0K5M8 ATP synthase epsilon chain 1.13e-08 1.95e-02 NA 0.9048
2. PF A4T8K3 ATP synthase epsilon chain 2.34e-13 3.53e-13 NA 0.8916
2. PF B8GRB7 ATP synthase epsilon chain 2.62e-11 1.91e-04 NA 0.8361
2. PF B0TQF3 ATP synthase epsilon chain 5.66e-15 3.20e-04 NA 0.8516
2. PF P51260 ATP synthase epsilon chain, chloroplastic 5.11e-15 1.01e-04 NA 0.9418
2. PF B4SJR8 ATP synthase epsilon chain 6.44e-15 1.54e-03 NA 0.8626
2. PF Q6L393 ATP synthase epsilon chain, chloroplastic 8.77e-15 6.31e-06 NA 0.9204
2. PF B2TUP4 ATP synthase epsilon chain 7.03e-13 1.67e-04 NA 0.905
2. PF B9DX60 ATP synthase epsilon chain 2.33e-15 2.56e-09 NA 0.9141
2. PF Q2STF0 ATP synthase epsilon chain 1.36e-08 2.19e-02 NA 0.8427
2. PF B1XSD5 ATP synthase epsilon chain 8.07e-09 9.83e-04 NA 0.8528
2. PF B2V688 ATP synthase epsilon chain 1.55e-15 2.27e-02 NA 0.9177
2. PF B2SEY2 ATP synthase epsilon chain 2.26e-14 3.04e-02 NA 0.9403
2. PF Q3K1J4 ATP synthase epsilon chain 4.06e-13 6.44e-04 NA 0.8339
2. PF Q5PKX3 ATP synthase epsilon chain 7.07e-13 1.74e-04 NA 0.8451
2. PF Q8E8C1 ATP synthase epsilon chain 5.88e-15 8.10e-05 NA 0.8511
2. PF A6TG35 ATP synthase epsilon chain 6.32e-13 1.74e-04 NA 0.8456
2. PF A8G1W4 ATP synthase epsilon chain 3.89e-15 1.45e-03 NA 0.8538
2. PF P72248 ATP synthase epsilon chain 1.09e-14 5.74e-05 NA 0.9214
2. PF B7LK76 ATP synthase epsilon chain 3.32e-13 1.87e-04 NA 0.9099
2. PF A6T469 ATP synthase epsilon chain 1.06e-08 4.73e-04 NA 0.8922
2. PF Q13DP1 ATP synthase epsilon chain 3.36e-13 1.14e-02 NA 0.851
2. PF B1MLW3 ATP synthase epsilon chain 3.14e-09 2.74e-10 NA 0.9106
2. PF B7NF47 ATP synthase epsilon chain 4.48e-13 1.87e-04 NA 0.9086
2. PF Q3J430 ATP synthase epsilon chain 1 8.89e-12 5.39e-05 NA 0.9056
2. PF Q7W3B1 ATP synthase epsilon chain 4.75e-09 2.96e-02 NA 0.8739
2. PF A4TSJ4 ATP synthase epsilon chain 4.84e-13 1.07e-03 NA 0.9041
2. PF Q1J7F8 ATP synthase epsilon chain 5.85e-14 1.51e-05 NA 0.8324
2. PF Q63PI1 ATP synthase epsilon chain 1.18e-08 1.50e-02 NA 0.8451
2. PF Q6LLG9 ATP synthase epsilon chain 1 2.10e-13 9.48e-06 NA 0.8532
2. PF C0MH16 ATP synthase epsilon chain 1.95e-12 1.48e-03 NA 0.8224
2. PF Q9ZCF3 ATP synthase epsilon chain 8.10e-11 9.49e-32 NA 0.8872
2. PF B2FHY7 ATP synthase epsilon chain 4.22e-15 1.54e-03 NA 0.8635
2. PF A6WUI9 ATP synthase epsilon chain 6.44e-15 3.13e-03 NA 0.8508
2. PF P0A6E7 ATP synthase epsilon chain 8.50e-09 1.87e-04 NA 0.9095
2. PF A9AJG5 ATP synthase epsilon chain 1.00e-08 1.53e-02 NA 0.8439
2. PF A1JTC5 ATP synthase epsilon chain 5.59e-13 1.16e-04 NA 0.9042
2. PF B5YXD5 ATP synthase epsilon chain 3.66e-13 1.87e-04 NA 0.9096
2. PF B5XZM5 ATP synthase epsilon chain 7.03e-13 1.13e-03 NA 0.9044
2. PF Q0BJL4 ATP synthase epsilon chain 1.29e-08 1.55e-02 NA 0.903
2. PF C3PLT0 ATP synthase epsilon chain 2.54e-11 9.87e-31 NA 0.8484
2. PF A1RQA9 ATP synthase epsilon chain 3.22e-15 2.16e-03 NA 0.8509
2. PF P0A6E8 ATP synthase epsilon chain 3.69e-13 1.87e-04 NA 0.9096
2. PF Q3JXW0 ATP synthase epsilon chain 1.37e-08 1.50e-02 NA 0.8453
2. PF P0A1B8 ATP synthase epsilon chain 5.95e-13 1.74e-04 NA 0.8458
2. PF B1KSS9 ATP synthase epsilon chain 5.77e-15 3.53e-07 NA 0.8663
2. PF Q6FYM4 ATP synthase epsilon chain 4.02e-10 6.97e-08 NA 0.8564
3. BF O66903 ATP synthase epsilon chain 5.83e-13 NA 5.06e-04 0.8795
3. BF B9LBL9 ATP synthase epsilon chain 0.00e+00 NA 0.002 0.9451
3. BF B8G6G5 ATP synthase epsilon chain 0.00e+00 NA 0.001 0.9451
3. BF Q0P3P3 ATP synthase epsilon chain, chloroplastic 1.84e-14 NA 4.58e-04 0.9404
3. BF A9WGS3 ATP synthase epsilon chain 1.11e-16 NA 0.002 0.9448
3. BF A9AVV5 ATP synthase epsilon chain 1.11e-16 NA 0.002 0.944
3. BF Q602P2 ATP synthase epsilon chain 2 5.36e-14 NA 0.019 0.8436
3. BF Q68S00 ATP synthase epsilon chain, chloroplastic 2.22e-09 NA 0.046 0.8767
3. BF C0HK54 ATP synthase subunit delta, mitochondrial 3.17e-08 NA 0.006 0.9159
3. BF B5YI25 ATP synthase epsilon chain 3.33e-16 NA 6.21e-07 0.9425
4. PB Q2PMU9 ATP synthase epsilon chain, chloroplastic 1.97e-14 2.62e-06 0.015 NA
4. PB Q2FWF1 ATP synthase epsilon chain 7.37e-14 2.53e-06 2.20e-07 NA
4. PB P09468 ATP synthase epsilon chain, chloroplastic 1.39e-09 5.78e-06 2.89e-05 NA
5. P P00835 ATP synthase epsilon chain, chloroplastic 2.68e-14 6.31e-06 NA NA
5. P P9WPV1 ATP synthase epsilon chain 5.13e-09 8.53e-16 NA NA
5. P P0A6E6 ATP synthase epsilon chain 4.33e-13 1.87e-04 NA NA
5. P P0C2Z3 ATP synthase epsilon chain, chloroplastic 9.44e-15 8.40e-06 NA NA
6. F Q3ZZT6 ATP synthase epsilon chain 5.55e-16 NA NA 0.9383
6. F B6J964 ATP synthase epsilon chain 5.11e-15 NA NA 0.9149
6. F Q87TT5 ATP synthase epsilon chain 4.62e-09 NA NA 0.9204
6. F Q12GP9 ATP synthase epsilon chain 6.16e-09 NA NA 0.8476
6. F Q5M103 ATP synthase epsilon chain 6.28e-13 NA NA 0.8447
6. F Q6A8C8 ATP synthase epsilon chain 3.48e-08 NA NA 0.8781
6. F Q2KU37 ATP synthase epsilon chain 6.47e-13 NA NA 0.9048
6. F Q223D7 ATP synthase epsilon chain 1.07e-11 NA NA 0.8455
6. F Q2RZV2 ATP synthase epsilon chain 5.54e-08 NA NA 0.8231
6. F A9H9B1 ATP synthase epsilon chain 1.17e-12 NA NA 0.9116
6. F Q13SQ3 ATP synthase epsilon chain 1 1.61e-08 NA NA 0.9033
6. F A1B8P1 ATP synthase epsilon chain 4.73e-12 NA NA 0.9263
6. F Q1BPR9 ATP synthase epsilon chain 2 7.87e-10 NA NA 0.839
6. F P05630 ATP synthase subunit delta, mitochondrial 8.38e-08 NA NA 0.9012
6. F A6VF31 ATP synthase epsilon chain 8.02e-14 NA NA 0.9192
6. F Q6C877 ATP synthase subunit delta, mitochondrial 4.09e-14 NA NA 0.9207
6. F Q89B38 ATP synthase epsilon chain 1.95e-12 NA NA 0.8411
6. F Q3HKH5 ATP synthase epsilon chain 2 1.43e-11 NA NA 0.8925
6. F P30159 ATP synthase epsilon chain, chloroplastic 6.49e-09 NA NA 0.8828
6. F A9NBD2 ATP synthase epsilon chain 4.88e-15 NA NA 0.9152
6. F A9HY45 ATP synthase epsilon chain 6.42e-09 NA NA 0.9068
6. F Q6MAK8 ATP synthase epsilon chain 5.38e-12 NA NA 0.8793
6. F B7V790 ATP synthase epsilon chain 4.14e-14 NA NA 0.918
6. F B6IPC5 ATP synthase epsilon chain 4.04e-12 NA NA 0.9042
6. F Q0A4M9 ATP synthase epsilon chain 1.39e-14 NA NA 0.9074
6. F Q820S4 ATP synthase epsilon chain 3.11e-11 NA NA 0.9036
6. F Q4K3B0 ATP synthase epsilon chain 6.99e-09 NA NA 0.9232
6. F Q3Z8Z1 ATP synthase epsilon chain 6.66e-16 NA NA 0.9431
6. F O51871 ATP synthase epsilon chain 3.11e-15 NA NA 0.8514
6. F B4EEZ0 ATP synthase epsilon chain 1.28e-08 NA NA 0.9035
6. F A5FRQ6 ATP synthase epsilon chain 6.66e-16 NA NA 0.9379
6. F C0QQ90 ATP synthase epsilon chain 1.37e-08 NA NA 0.8763
6. F Q40089 ATP synthase subunit delta', mitochondrial 9.54e-11 NA NA 0.9317
6. F B2T7J9 ATP synthase epsilon chain 1.60e-08 NA NA 0.8422
6. F Q1IIG9 ATP synthase epsilon chain 1.78e-15 NA NA 0.9419
6. F A4Y186 ATP synthase epsilon chain 6.86e-13 NA NA 0.8475
6. F Q03LX2 ATP synthase epsilon chain 6.89e-13 NA NA 0.8444
6. F B6J2E1 ATP synthase epsilon chain 7.91e-09 NA NA 0.9135
6. F Q9HT21 ATP synthase epsilon chain 5.84e-14 NA NA 0.9195
6. F Q31DM1 ATP synthase epsilon chain 2.61e-13 NA NA 0.9341
6. F A2SC71 ATP synthase epsilon chain 9.14e-13 NA NA 0.889
6. F Q83AF4 ATP synthase epsilon chain 8.74e-09 NA NA 0.9132
6. F Q92196 ATP synthase subunit delta, mitochondrial 1.23e-12 NA NA 0.944
6. F Q02DF5 ATP synthase epsilon chain 4.69e-14 NA NA 0.9194
6. F Q41000 ATP synthase subunit delta', mitochondrial 4.91e-11 NA NA 0.9106
6. F P56525 ATP synthase subunit delta, mitochondrial 4.67e-08 NA NA 0.9249
6. F A9KBF5 ATP synthase epsilon chain 8.18e-14 NA NA 0.9142
7. B Q12165 ATP synthase subunit delta, mitochondrial 7.70e-13 NA 0.006 NA