Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54959.1

JCVISYN3A_0790

F0F1 ATP synthase subunit beta.
M. mycoides homolog: Q6MS94.
TIGRfam Classification: 4=Probable.
Category: Essential.

Statistics

Total GO Annotation: 107
Unique PROST Go: 15
Unique BLAST Go: 3
Unique Foldseek Go: 1

Total Homologs: 2440
Unique PROST Homologs: 37
Unique BLAST Homologs: 35
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: atpD; ATP synthase subunit beta
Zhang et al. [4]: GO:0046933|proton-transporting ATP synthase activity, rotational mechanism
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q8XU76 (ATP synthase subunit beta) with a FATCAT P-Value: 0 and RMSD of 1.17 angstrom. The sequence alignment identity is 61.3%.
Structural alignment shown in left. Query protein AVX54959.1 colored as red in alignment, homolog Q8XU76 colored as blue. Query protein AVX54959.1 is also shown in right top, homolog Q8XU76 showed in right bottom. They are colored based on secondary structures.

  AVX54959.1 MVSKNTTDKKKNQSIGKVIQVLGPVVDVKFSENNIPKIYDALIVDNNG------KKLVLEVEQNIGDEIVRTIAMGPTEGLKRGLDVINTNSPITAPTGI 94
      Q8XU76 ------------MSIGTIVQCIGAVVDIQFPRDAMPKVYDALVLQDSGEASFAEKGLSFEVQQQLGDGVVRTIALGSSDGLRRGMPVSNTGAPISVPVGH 88

  AVX54959.1 EVLGRMFNVLGDPIDEK-P-DLDVKREPIHKDAPKYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVG 192
      Q8XU76 GTLGRIMDVLGRPIDEAGPIAADEKRA-IHQKAPKFDELSPSVDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKQHSGLSVFAGVG 187

  AVX54959.1 ERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDQKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQ 292
      Q8XU76 ERTREGNDFYHEMKDSNVLDKVAMVFGQMNEPPGNRLRVALTGLTMAERFRDE-GRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQ 286

  AVX54959.1 ERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGM 392
      Q8XU76 ERITSTKTGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIYPAVDPLDSTSRQLDPQIVGTEHYEVARRVQQTLQRYKELRDIIAILGM 386

  AVX54959.1 DELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSTIDDVIEKYNKDKDK 475
      Q8XU76 DELSPEDKLAVGRARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMLVDGECDHLPEQAFYMVGSIDEAFEKAKKLQ-- 467

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0046034	ATP metabolic process
1. PBF	GO:0009535	chloroplast thylakoid membrane
1. PBF	GO:0030257	type III protein secretion system complex
1. PBF	GO:0005754	mitochondrial proton-transporting ATP synthase, catalytic core
1. PBF	GO:0046961	proton-transporting ATPase activity, rotational mechanism
1. PBF	GO:0030254	protein secretion by the type III secretion system
1. PBF	GO:0005753	mitochondrial proton-transporting ATP synthase complex
1. PBF	GO:0015986	ATP synthesis coupled proton transport
1. PBF	GO:1902600	proton transmembrane transport
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0045261	proton-transporting ATP synthase complex, catalytic core F(1)
1. PBF	GO:0055035	plastid thylakoid membrane
1. PBF	GO:0031676	plasma membrane-derived thylakoid membrane
1. PBF	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism
1. PBF	GO:0046932	sodium-transporting ATP synthase activity, rotational mechanism
1. PBF	GO:0008270	zinc ion binding
1. PBF	GO:0042170	plastid membrane
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0000275	mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)
1. PBF	GO:0043531	ADP binding
1. PBF	GO:0045262	plasma membrane proton-transporting ATP synthase complex, catalytic core F(1)
1. PBF	GO:0042776	mitochondrial ATP synthesis coupled proton transport
1. PBF	GO:0042777	plasma membrane ATP synthesis coupled proton transport
1. PBF	GO:0046962	sodium-transporting ATPase activity, rotational mechanism
1. PBF	GO:0045260	plasma membrane proton-transporting ATP synthase complex
1. PBF	GO:0008564	protein-exporting ATPase activity
4. PB	GO:0006353	DNA-templated transcription, termination
4. PB	GO:0033180	proton-transporting V-type ATPase, V1 domain
4. PB	GO:0060142	regulation of syncytium formation by plasma membrane fusion
4. PB	GO:0003723	RNA binding
4. PB	GO:0015988	energy coupled proton transmembrane transport, against electrochemical gradient
4. PB	GO:0004386	helicase activity
4. PB	GO:0000325	plant-type vacuole
4. PB	GO:0005829	cytosol
4. PB	GO:0036295	cellular response to increased oxygen levels
4. PB	GO:0009507	chloroplast
4. PB	GO:0090465	arginine homeostasis
4. PB	GO:0090377	seed trichome initiation
4. PB	GO:0007035	vacuolar acidification
4. PB	GO:0090464	histidine homeostasis
4. PB	GO:0009544	chloroplast ATP synthase complex
4. PB	GO:1902769	regulation of choline O-acetyltransferase activity
4. PB	GO:0044781	bacterial-type flagellum organization
4. PB	GO:0031977	thylakoid lumen
4. PB	GO:0042288	MHC class I protein binding
4. PB	GO:0006357	regulation of transcription by RNA polymerase II
4. PB	GO:0009288	bacterial-type flagellum
4. PB	GO:0140603	obsolete ATP hydrolysis activity
4. PB	GO:0090463	lysine homeostasis
4. PB	GO:0005509	calcium ion binding
4. PB	GO:0051453	regulation of intracellular pH
4. PB	GO:0005634	nucleus
4. PB	GO:0006754	ATP biosynthetic process
4. PB	GO:0016787	hydrolase activity
4. PB	GO:0003091	renal water homeostasis
4. PB	GO:0098850	extrinsic component of synaptic vesicle membrane
4. PB	GO:0045851	pH reduction
4. PB	GO:0036176	response to neutral pH
4. PB	GO:0006351	transcription, DNA-templated
4. PB	GO:0030835	negative regulation of actin filament depolymerization
4. PB	GO:0016021	integral component of membrane
4. PB	GO:0070072	vacuolar proton-transporting V-type ATPase complex assembly
4. PB	GO:0003096	renal sodium ion transport
4. PB	GO:0006933	negative regulation of cell adhesion involved in substrate-bound cell migration
4. PB	GO:0042802	identical protein binding
4. PB	GO:1902906	proteasome storage granule assembly
4. PB	GO:0043536	positive regulation of blood vessel endothelial cell migration
4. PB	GO:0007588	excretion
4. PB	GO:0005794	Golgi apparatus
4. PB	GO:0016241	regulation of macroautophagy
4. PB	GO:0033178	proton-transporting two-sector ATPase complex, catalytic domain
4. PB	GO:0033181	plasma membrane proton-transporting V-type ATPase complex
4. PB	GO:0035812	renal sodium excretion
4. PB	GO:0000221	vacuolar proton-transporting V-type ATPase, V1 domain
4. PB	GO:0045259	proton-transporting ATP synthase complex
4. PB	GO:0005576	extracellular region
4. PB	GO:0005730	nucleolus
4. PB	GO:0030228	lipoprotein particle receptor activity
4. PB	GO:0008186	ATP-dependent activity, acting on RNA
4. PB	GO:0000425	pexophagy
4. PB	GO:0016020	membrane
4. PB	GO:0005902	microvillus
4. PB	GO:0042048	olfactory behavior
4. PB	GO:0055064	chloride ion homeostasis
4. PB	GO:0005654	nucleoplasm
4. PB	GO:0043532	angiostatin binding
4. PB	GO:1990816	vacuole-mitochondrion membrane contact site
5. P	GO:0035087	siRNA loading onto RISC involved in RNA interference
5. P	GO:0051731	polynucleotide 5'-hydroxyl-kinase activity
5. P	GO:0046404	polydeoxyribonucleotide 5'-hydroxyl-kinase activity
5. P	GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation
5. P	GO:0006378	mRNA polyadenylation
5. P	GO:0006281	DNA repair
5. P	GO:0098789	pre-mRNA cleavage required for polyadenylation
5. P	GO:0051736	polyribonucleotide 5'-hydroxyl-kinase activity
5. P	GO:0051733	polydeoxyribonucleotide kinase activity
5. P	GO:0031124	mRNA 3'-end processing
5. P	GO:0030423	targeting of mRNA for destruction involved in RNA interference
5. P	GO:0043484	regulation of RNA splicing
5. P	GO:0021695	cerebellar cortex development
5. P	GO:0000214	tRNA-intron endonuclease complex
5. P	GO:0005849	mRNA cleavage factor complex
6. F	GO:0009058	biosynthetic process
7. B	GO:0006314	intron homing
7. B	GO:0016539	intein-mediated protein splicing
7. B	GO:0003677	DNA binding

Uniprot GO Annotations

GO	Description
GO:0015986	ATP synthesis coupled proton transport
GO:1902600	proton transmembrane transport
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism
GO:0006811	ion transport
GO:0046034	ATP metabolic process
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0005524	ATP binding
GO:0045261	proton-transporting ATP synthase complex, catalytic core F(1)
GO:0045259	proton-transporting ATP synthase complex
GO:0006754	ATP biosynthetic process
GO:0046961	proton-transporting ATPase activity, rotational mechanism
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q3J431	ATP synthase subunit beta 1	0.00e+00	3.02e-71	0.0	0.9716
1. PBF	A7G9Q9	ATP synthase subunit beta	0.00e+00	1.59e-72	0.0	0.9889
1. PBF	Q2P7Q6	ATP synthase subunit alpha	0.00e+00	5.09e-24	1.22e-23	0.836
1. PBF	Q4UK18	ATP synthase subunit beta	0.00e+00	5.38e-72	0.0	0.9678
1. PBF	A5HY52	ATP synthase subunit beta	0.00e+00	1.41e-73	0.0	0.9898
1. PBF	A0LLG0	ATP synthase subunit alpha	0.00e+00	1.40e-28	1.15e-21	0.8676
1. PBF	B1I6J7	ATP synthase subunit beta	0.00e+00	3.32e-69	0.0	0.9739
1. PBF	B1XSD2	ATP synthase subunit alpha	0.00e+00	1.28e-25	9.58e-23	0.8315
1. PBF	P38482	ATP synthase subunit beta, mitochondrial	0.00e+00	9.06e-21	0.0	0.9558
1. PBF	A4WGF5	ATP synthase subunit beta	0.00e+00	4.11e-66	0.0	0.9835
1. PBF	A5FRQ5	ATP synthase subunit beta	0.00e+00	2.05e-72	0.0	0.9891
1. PBF	Q4FP38	ATP synthase subunit beta	0.00e+00	6.09e-71	0.0	0.9666
1. PBF	A2T340	ATP synthase subunit beta, chloroplastic	0.00e+00	7.36e-68	0.0	0.9697
1. PBF	Q88UU3	ATP synthase subunit beta	0.00e+00	5.64e-75	0.0	0.9824
1. PBF	Q85V24	ATP synthase subunit beta, chloroplastic	0.00e+00	1.39e-65	0.0	0.967
1. PBF	Q7HHX1	ATP synthase subunit beta, chloroplastic	0.00e+00	2.58e-68	0.0	0.9703
1. PBF	Q5P4E2	ATP synthase subunit beta	0.00e+00	6.01e-66	0.0	0.9664
1. PBF	O50292	ATP synthase subunit beta	0.00e+00	1.59e-72	0.0	0.9607
1. PBF	A9MXA6	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9823
1. PBF	Q70XZ6	ATP synthase subunit beta, chloroplastic	0.00e+00	3.13e-68	0.0	0.9665
1. PBF	B8J439	ATP synthase subunit beta	0.00e+00	8.91e-74	0.0	0.9836
1. PBF	Q2VEH0	ATP synthase subunit beta, chloroplastic	0.00e+00	3.19e-62	0.0	0.97
1. PBF	Q89X74	ATP synthase subunit beta	0.00e+00	1.91e-64	0.0	0.9612
1. PBF	C5D990	ATP synthase subunit beta	0.00e+00	8.35e-76	0.0	0.9666
1. PBF	B9K7U1	ATP synthase subunit beta	0.00e+00	2.38e-77	0.0	0.9899
1. PBF	Q85V50	ATP synthase subunit beta, chloroplastic	0.00e+00	1.59e-67	0.0	0.9688
1. PBF	Q5PAN2	ATP synthase subunit beta	0.00e+00	1.66e-69	0.0	0.9635
1. PBF	B2FHZ0	ATP synthase subunit alpha	0.00e+00	3.81e-25	1.07e-23	0.8345
1. PBF	Q9Z992	V-type ATP synthase beta chain	0.00e+00	1.63e-17	3.41e-15	0.8229
1. PBF	Q05FY3	ATP synthase subunit alpha	0.00e+00	2.83e-25	1.57e-26	0.7724
1. PBF	B0YPM5	ATP synthase subunit alpha, plastid	0.00e+00	1.09e-25	4.59e-21	0.8546
1. PBF	Q39Q56	ATP synthase subunit beta	0.00e+00	3.46e-74	0.0	0.9814
1. PBF	A3PIB9	ATP synthase subunit beta 1	0.00e+00	3.02e-71	0.0	0.9634
1. PBF	A6MVY0	ATP synthase subunit beta, chloroplastic	0.00e+00	2.50e-73	0.0	0.9684
1. PBF	A8HAG5	ATP synthase subunit alpha	0.00e+00	6.45e-25	3.03e-25	0.8403
1. PBF	A4W1V7	ATP synthase subunit beta	0.00e+00	1.84e-74	0.0	0.978
1. PBF	A6QB59	ATP synthase subunit beta	0.00e+00	2.58e-72	0.0	0.9746
1. PBF	B6I3W9	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9823
1. PBF	C4LDW2	ATP synthase subunit alpha	0.00e+00	8.31e-23	3.70e-26	0.8388
1. PBF	P26531	ATP synthase subunit beta, chloroplastic	0.00e+00	2.86e-64	0.0	0.9623
1. PBF	A9AVV2	ATP synthase subunit alpha	0.00e+00	7.64e-23	3.17e-17	0.8431
1. PBF	Q0TNC2	ATP synthase subunit alpha	0.00e+00	1.91e-27	1.26e-26	0.8652
1. PBF	C1F0M8	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9726
1. PBF	Q9MRQ5	ATP synthase subunit beta, chloroplastic	0.00e+00	2.37e-68	0.0	0.9663
1. PBF	A6MMC9	ATP synthase subunit beta, chloroplastic	0.00e+00	8.93e-67	0.0	0.9703
1. PBF	A0RR26	ATP synthase subunit beta	0.00e+00	1.53e-75	0.0	0.9774
1. PBF	Q9PE83	ATP synthase subunit alpha	0.00e+00	3.75e-25	5.12e-23	0.8414
1. PBF	A1B8P0	ATP synthase subunit beta	0.00e+00	7.21e-71	0.0	0.9729
1. PBF	Q4VZI5	ATP synthase subunit beta, chloroplastic	0.00e+00	1.03e-69	0.0	0.9746
1. PBF	A5UQN5	ATP synthase subunit alpha	0.00e+00	1.53e-25	3.56e-20	0.8387
1. PBF	Q0SYU4	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9838
1. PBF	Q3V527	ATP synthase subunit beta, chloroplastic	0.00e+00	2.08e-66	0.0	0.9697
1. PBF	Q0C100	ATP synthase subunit beta	0.00e+00	9.99e-74	0.0	0.977
1. PBF	A8W3J1	ATP synthase subunit beta, plastid	0.00e+00	2.93e-71	0.0	0.9646
1. PBF	B2IQX0	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	0.9779
1. PBF	A5VIR1	ATP synthase subunit beta	0.00e+00	4.76e-64	0.0	0.9832
1. PBF	A9BFX5	ATP synthase subunit alpha	0.00e+00	1.15e-26	2.79e-25	0.8645
1. PBF	B1LBC1	ATP synthase subunit alpha	0.00e+00	2.76e-29	2.41e-22	0.8581
1. PBF	B1A942	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-67	0.0	0.9701
1. PBF	C5CNB3	ATP synthase subunit alpha	0.00e+00	1.40e-23	1.35e-23	0.8233
1. PBF	Q9TL34	ATP synthase subunit beta, chloroplastic	0.00e+00	2.38e-66	0.0	0.9676
1. PBF	Q1GXM8	ATP synthase subunit alpha	0.00e+00	4.60e-23	3.21e-26	0.8398
1. PBF	A8GTS6	ATP synthase subunit beta	0.00e+00	1.23e-70	0.0	0.9684
1. PBF	Q04S18	ATP synthase subunit beta	0.00e+00	3.88e-74	0.0	0.9805
1. PBF	Q71WP7	ATP synthase subunit alpha 2	0.00e+00	1.85e-28	1.77e-20	0.8669
1. PBF	A5WBV9	ATP synthase subunit alpha	0.00e+00	1.77e-26	1.12e-25	0.8389
1. PBF	B1IE34	ATP synthase subunit beta	0.00e+00	1.59e-72	0.0	0.9898
1. PBF	C0MH17	ATP synthase subunit beta	0.00e+00	7.09e-74	0.0	0.9782
1. PBF	Q6L392	ATP synthase subunit beta, chloroplastic	0.00e+00	3.92e-69	0.0	0.9674
1. PBF	B7JGN0	ATP synthase subunit beta	0.00e+00	1.63e-77	0.0	0.9719
1. PBF	Q2RV18	ATP synthase subunit beta	0.00e+00	7.38e-70	0.0	0.9728
1. PBF	Q48BG5	ATP synthase subunit beta	0.00e+00	1.88e-62	0.0	0.9795
1. PBF	Q2YLE6	ATP synthase subunit beta	0.00e+00	2.29e-27	0.0	0.9559
1. PBF	Q39Q54	ATP synthase subunit alpha	0.00e+00	1.26e-26	3.27e-22	0.8623
1. PBF	Q0ZJ13	ATP synthase subunit beta, chloroplastic	0.00e+00	1.28e-67	0.0	0.973
1. PBF	Q7HHY4	ATP synthase subunit beta, chloroplastic	0.00e+00	8.21e-68	0.0	0.9666
1. PBF	Q21CY7	ATP synthase subunit beta	0.00e+00	4.29e-73	0.0	0.9709
1. PBF	P31476	ATP synthase subunit beta, chloroplastic	0.00e+00	9.44e-74	0.0	0.9658
1. PBF	Q72SX9	ATP synthase subunit beta	0.00e+00	5.39e-73	0.0	0.9802
1. PBF	A1RQB0	ATP synthase subunit beta	0.00e+00	8.21e-68	0.0	0.9765
1. PBF	Q2GKK8	ATP synthase subunit beta	0.00e+00	2.93e-70	0.0	0.9604
1. PBF	Q57B88	ATP synthase subunit beta	0.00e+00	2.29e-27	0.0	0.956
1. PBF	P06540	ATP synthase subunit beta	0.00e+00	4.61e-75	0.0	0.9645
1. PBF	Q8XU74	ATP synthase subunit alpha	0.00e+00	2.17e-25	1.10e-24	0.8411
1. PBF	A9BPU5	ATP synthase subunit alpha	0.00e+00	9.17e-22	2.79e-24	0.8404
1. PBF	Q2KU36	ATP synthase subunit beta	0.00e+00	2.60e-65	0.0	0.9662
1. PBF	P12986	ATP synthase subunit beta	0.00e+00	1.86e-63	0.0	0.9698
1. PBF	B2SQB2	ATP synthase subunit alpha	0.00e+00	5.09e-24	1.22e-23	0.8369
1. PBF	B1MW85	ATP synthase subunit beta	0.00e+00	9.75e-72	0.0	0.9835
1. PBF	P57124	ATP synthase subunit beta	0.00e+00	2.46e-65	0.0	0.9746
1. PBF	Q8EM83	ATP synthase subunit beta	0.00e+00	1.73e-74	0.0	0.9847
1. PBF	B3CN17	ATP synthase subunit beta	0.00e+00	5.13e-70	0.0	0.9639
1. PBF	P00825	ATP synthase subunit beta, chloroplastic	0.00e+00	1.06e-68	0.0	0.9723
1. PBF	Q9XQX2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.87e-66	0.0	0.9646
1. PBF	B3PQ68	ATP synthase subunit beta	0.00e+00	1.77e-70	0.0	0.965
1. PBF	A8F2U0	ATP synthase subunit beta	0.00e+00	2.05e-72	0.0	0.9709
1. PBF	A7FQH9	ATP synthase subunit beta	0.00e+00	1.41e-73	0.0	0.9892
1. PBF	Q65DX4	ATP synthase subunit beta	0.00e+00	6.81e-76	0.0	0.9694
1. PBF	A0T0R6	ATP synthase subunit beta, chloroplastic	0.00e+00	5.89e-76	0.0	0.9708
1. PBF	P00823	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.32e-25	6.78e-19	0.8593
1. PBF	B3WDL6	ATP synthase subunit alpha	0.00e+00	8.30e-27	2.22e-18	0.8631
1. PBF	Q89B39	ATP synthase subunit beta	0.00e+00	1.85e-68	0.0	0.9693
1. PBF	A4QKT8	ATP synthase subunit beta, chloroplastic	0.00e+00	2.41e-71	0.0	0.9619
1. PBF	P80658	ATP synthase subunit beta, chloroplastic	0.00e+00	1.42e-67	0.0	0.9732
1. PBF	Q1JMI9	ATP synthase subunit beta	0.00e+00	6.14e-74	0.0	0.9779
1. PBF	A5V3X5	ATP synthase subunit beta	0.00e+00	3.83e-72	0.0	0.9637
1. PBF	A5UGY9	ATP synthase subunit beta	0.00e+00	3.83e-62	0.0	0.9788
1. PBF	Q98EV8	ATP synthase subunit beta	0.00e+00	1.09e-73	0.0	0.9731
1. PBF	Q9TJR9	ATP synthase subunit beta, plastid	0.00e+00	1.42e-70	0.0	0.9619
1. PBF	A3Q3B1	ATP synthase subunit beta	0.00e+00	6.28e-43	0.0	0.958
1. PBF	O03081	ATP synthase subunit beta, chloroplastic	0.00e+00	5.90e-68	0.0	0.9726
1. PBF	Q3KM55	V-type ATP synthase beta chain	0.00e+00	5.48e-20	8.11e-17	0.8197
1. PBF	Q08807	ATP synthase subunit beta, chloroplastic	0.00e+00	2.45e-74	0.0	0.9737
1. PBF	Q74GY2	ATP synthase subunit alpha	0.00e+00	2.19e-26	1.05e-21	0.8601
1. PBF	Q2LCQ7	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.79e-25	2.16e-17	0.7607
1. PBF	A0Q2Z6	ATP synthase subunit alpha	0.00e+00	2.58e-28	1.11e-26	0.8641
1. PBF	B0BBT8	V-type ATP synthase beta chain	0.00e+00	4.84e-19	1.55e-16	0.8109
1. PBF	Q2YUK1	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9818
1. PBF	Q3MAS0	ATP synthase subunit beta	0.00e+00	2.82e-75	0.0	0.9641
1. PBF	A5GNB1	ATP synthase subunit beta	0.00e+00	7.21e-71	0.0	0.9628
1. PBF	A8ACN8	ATP synthase subunit alpha	0.00e+00	8.74e-23	4.02e-23	0.8429
1. PBF	Q0G9V5	ATP synthase subunit beta, chloroplastic	0.00e+00	3.28e-70	0.0	0.9633
1. PBF	Q8F2J2	ATP synthase subunit alpha	0.00e+00	7.44e-27	8.38e-25	0.8399
1. PBF	Q05373	ATP synthase subunit beta	0.00e+00	7.50e-74	0.0	0.9629
1. PBF	A2BYG3	ATP synthase subunit beta	0.00e+00	1.58e-71	0.0	0.9681
1. PBF	Q04HT9	ATP synthase subunit beta	0.00e+00	8.54e-71	0.0	0.9773
1. PBF	Q313W0	ATP synthase subunit beta	0.00e+00	2.08e-78	0.0	0.9829
1. PBF	O03064	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	4.91e-08	6.91e-170	0.9742
1. PBF	Q48UD3	ATP synthase subunit beta	0.00e+00	6.14e-74	0.0	0.9781
1. PBF	A2SC68	ATP synthase subunit alpha	0.00e+00	2.26e-23	3.74e-23	0.8419
1. PBF	Q13DP2	ATP synthase subunit beta	0.00e+00	2.73e-72	0.0	0.9704
1. PBF	Q87TT4	ATP synthase subunit beta	0.00e+00	2.79e-62	0.0	0.9858
1. PBF	Q2MI93	ATP synthase subunit beta, chloroplastic	0.00e+00	4.05e-64	0.0	0.9719
1. PBF	P23704	ATP synthase subunit beta, mitochondrial	0.00e+00	7.12e-30	0.0	0.9552
1. PBF	B2TUP3	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9822
1. PBF	A1JTC8	ATP synthase subunit alpha	0.00e+00	1.93e-23	6.05e-25	0.8398
1. PBF	Q3SVJ1	ATP synthase subunit beta	0.00e+00	5.86e-72	0.0	0.9716
1. PBF	P50002	ATP synthase subunit beta, sodium ion specific	0.00e+00	5.60e-71	0.0	0.9907
1. PBF	C3PLT1	ATP synthase subunit beta	0.00e+00	1.49e-71	0.0	0.9625
1. PBF	P41622	ATP synthase subunit beta, chloroplastic	0.00e+00	1.66e-69	0.0	0.9697
1. PBF	Q4UQF2	ATP synthase subunit alpha	0.00e+00	7.68e-24	1.52e-23	0.8368
1. PBF	B9LBM0	ATP synthase subunit beta	0.00e+00	5.03e-69	0.0	0.9649
1. PBF	B8DYT0	ATP synthase subunit beta	0.00e+00	1.07e-61	0.0	0.9866
1. PBF	A5ILX0	ATP synthase subunit alpha	0.00e+00	2.76e-29	2.41e-22	0.8575
1. PBF	Q3IK50	ATP synthase subunit beta	0.00e+00	6.41e-68	0.0	0.9852
1. PBF	Q68VU8	ATP synthase subunit beta	0.00e+00	1.33e-69	0.0	0.9677
1. PBF	A8G7M8	ATP synthase subunit beta	0.00e+00	1.82e-66	0.0	0.9895
1. PBF	C4LDW0	ATP synthase subunit beta	0.00e+00	4.23e-71	0.0	0.9844
1. PBF	B8D8H3	ATP synthase subunit beta	0.00e+00	2.46e-65	0.0	0.9751
1. PBF	A3N2U4	ATP synthase subunit beta	0.00e+00	3.17e-63	0.0	0.98
1. PBF	O03079	ATP synthase subunit beta, chloroplastic	0.00e+00	1.25e-63	0.0	0.9605
1. PBF	A5UA11	ATP synthase subunit beta	0.00e+00	3.10e-62	0.0	0.9791
1. PBF	B1JSV5	ATP synthase subunit alpha	0.00e+00	2.57e-26	4.29e-24	0.8308
1. PBF	A4JA33	ATP synthase subunit alpha	0.00e+00	7.25e-26	4.29e-24	0.8311
1. PBF	A4VVJ9	ATP synthase subunit beta	0.00e+00	1.84e-74	0.0	0.978
1. PBF	A5F457	ATP synthase subunit alpha	0.00e+00	1.37e-25	9.61e-28	0.8426
1. PBF	O50341	ATP synthase subunit beta	0.00e+00	2.63e-78	0.0	0.9887
1. PBF	P07677	ATP synthase subunit beta	0.00e+00	3.23e-73	0.0	0.9749
1. PBF	Q9MTG8	ATP synthase subunit beta, chloroplastic	0.00e+00	2.58e-68	0.0	0.9711
1. PBF	Q0SP71	V-type ATP synthase beta chain	0.00e+00	1.92e-19	5.69e-10	0.8525
1. PBF	A1VXJ0	ATP synthase subunit beta	0.00e+00	6.15e-75	0.0	0.9749
1. PBF	Q3ZJ68	ATP synthase subunit beta, chloroplastic	0.00e+00	1.72e-66	0.0	0.9608
1. PBF	B5EFI7	ATP synthase subunit beta	0.00e+00	1.46e-74	0.0	0.9816
1. PBF	B2S1S7	V-type ATP synthase beta chain	0.00e+00	5.57e-21	1.31e-10	0.8638
1. PBF	A1ALL7	ATP synthase subunit beta 1	0.00e+00	2.66e-75	0.0	0.9815
1. PBF	A4IW22	ATP synthase subunit alpha	0.00e+00	4.25e-28	2.46e-25	0.8385
1. PBF	C0R5I6	ATP synthase subunit beta	0.00e+00	7.21e-71	0.0	0.9548
1. PBF	P0C2Z4	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.42e-25	1.01e-20	0.8528
1. PBF	C1CLK6	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	0.9784
1. PBF	P63679	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9813
1. PBF	Q81JZ5	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9725
1. PBF	Q7HHY7	ATP synthase subunit beta, chloroplastic	0.00e+00	5.58e-68	0.0	0.9691
1. PBF	P72247	ATP synthase subunit beta	0.00e+00	1.36e-69	0.0	0.9725
1. PBF	Q6QBP2	ATP synthase subunit beta, chloroplastic	0.00e+00	5.00e-68	0.0	0.968
1. PBF	A7Y3E6	ATP synthase subunit beta, chloroplastic	0.00e+00	1.54e-70	0.0	0.9742
1. PBF	A8LJR4	ATP synthase subunit beta 2	0.00e+00	2.09e-71	0.0	0.9726
1. PBF	O67828	ATP synthase subunit beta	0.00e+00	8.91e-74	0.0	0.9605
1. PBF	O03080	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	1.91e-48	1.99e-179	0.927
1. PBF	P99112	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9819
1. PBF	Q5FKY0	ATP synthase subunit beta	0.00e+00	8.75e-65	0.0	0.976
1. PBF	A8W3D7	ATP synthase subunit beta, plastid	0.00e+00	9.48e-70	0.0	0.9785
1. PBF	A1E9S1	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.76e-25	1.27e-20	0.8539
1. PBF	Q5L5J1	V-type ATP synthase beta chain	0.00e+00	9.91e-18	5.75e-14	0.8196
1. PBF	O51874	ATP synthase subunit alpha	0.00e+00	1.59e-27	1.94e-24	0.7865
1. PBF	P62614	ATP synthase subunit beta, chloroplastic	0.00e+00	2.08e-66	0.0	0.9575
1. PBF	Q0AUD3	ATP synthase subunit beta	0.00e+00	2.80e-73	0.0	0.9598
1. PBF	Q9GPE9	ATP synthase subunit beta, mitochondrial	0.00e+00	1.71e-42	0.0	0.9591
1. PBF	A4WUM7	ATP synthase subunit beta	0.00e+00	2.77e-71	0.0	0.9619
1. PBF	B6JMX2	ATP synthase subunit beta	0.00e+00	5.76e-71	0.0	0.9761
1. PBF	A6LQH6	ATP synthase subunit beta	0.00e+00	2.91e-74	0.0	0.9909
1. PBF	P05037	ATP synthase subunit beta, chloroplastic	0.00e+00	1.36e-69	0.0	0.9753
1. PBF	P42467	ATP synthase subunit beta (Fragment)	0.00e+00	5.47e-40	0.0	0.9657
1. PBF	A9HY40	ATP synthase subunit alpha	0.00e+00	2.04e-26	1.80e-24	0.8441
1. PBF	A1RQB2	ATP synthase subunit alpha	0.00e+00	9.60e-24	1.28e-25	0.8397
1. PBF	C5BKJ7	ATP synthase subunit alpha	0.00e+00	1.61e-25	5.67e-22	0.8395
1. PBF	C6DJH2	ATP synthase subunit beta	0.00e+00	9.96e-67	0.0	0.9828
1. PBF	B5RFW3	ATP synthase subunit beta	0.00e+00	4.00e-66	0.0	0.982
1. PBF	A4QKJ9	ATP synthase subunit beta, chloroplastic	0.00e+00	9.83e-71	0.0	0.9629
1. PBF	Q2L8Z1	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.09e-25	7.52e-20	0.8567
1. PBF	A4GAH1	ATP synthase subunit alpha	0.00e+00	4.75e-24	7.62e-25	0.84
1. PBF	B5XZM4	ATP synthase subunit beta	0.00e+00	1.87e-66	0.0	0.9819
1. PBF	Q38WK5	ATP synthase subunit beta	0.00e+00	7.37e-67	0.0	0.9833
1. PBF	Q4QN64	ATP synthase subunit beta	0.00e+00	2.58e-62	0.0	0.9772
1. PBF	B2G691	ATP synthase subunit beta	0.00e+00	4.76e-64	0.0	0.9848
1. PBF	A6H5I4	ATP synthase subunit beta, chloroplastic	0.00e+00	6.41e-68	0.0	0.9697
1. PBF	Q32RI0	ATP synthase subunit beta, chloroplastic	0.00e+00	5.31e-67	0.0	0.9636
1. PBF	A8LN46	ATP synthase subunit alpha 1	0.00e+00	4.40e-26	4.81e-20	0.8485
1. PBF	A6YGB6	ATP synthase subunit beta, chloroplastic	0.00e+00	3.05e-72	0.0	0.9681
1. PBF	Q1XDM8	ATP synthase subunit beta, chloroplastic	0.00e+00	1.88e-73	0.0	0.9749
1. PBF	B9DRT6	ATP synthase subunit beta	0.00e+00	1.29e-75	0.0	0.9777
1. PBF	Q7CPE2	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9801
1. PBF	Q33C53	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.92e-25	2.96e-18	0.8601
1. PBF	Q40611	ATP synthase subunit alpha, chloroplastic (Fragment)	0.00e+00	6.03e-23	7.59e-21	0.861
1. PBF	Q5M5J3	ATP synthase subunit alpha	0.00e+00	1.91e-27	7.95e-20	0.8658
1. PBF	Q8MBQ1	ATP synthase subunit beta, chloroplastic	0.00e+00	4.76e-69	0.0	0.9717
1. PBF	Q71WP9	ATP synthase subunit beta 2	0.00e+00	1.15e-75	0.0	0.9708
1. PBF	A1WZT3	ATP synthase subunit alpha	0.00e+00	1.32e-24	2.26e-22	0.8377
1. PBF	A6L4L7	ATP synthase subunit beta	0.00e+00	9.37e-55	0.0	0.9558
1. PBF	B5EYZ6	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9835
1. PBF	A4YCH8	ATP synthase subunit beta	0.00e+00	8.21e-68	0.0	0.978
1. PBF	A5G9D8	ATP synthase subunit beta	0.00e+00	8.62e-77	0.0	0.981
1. PBF	A5F459	ATP synthase subunit beta	0.00e+00	1.06e-63	0.0	0.9658
1. PBF	Q5HE97	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9783
1. PBF	A8HS10	ATP synthase subunit beta	0.00e+00	1.63e-66	0.0	0.9587
1. PBF	O03069	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	1.62e-52	0.0	0.9484
1. PBF	Q8PGG5	ATP synthase subunit alpha	0.00e+00	2.41e-23	9.93e-24	0.8367
1. PBF	Q8A9V4	ATP synthase subunit beta	0.00e+00	8.03e-58	0.0	0.9559
1. PBF	Q9TMU1	ATP synthase subunit beta, chloroplastic	0.00e+00	1.38e-64	0.0	0.9683
1. PBF	Q6ENV6	ATP synthase subunit beta, chloroplastic	0.00e+00	3.92e-69	0.0	0.9683
1. PBF	Q9MRM0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-67	0.0	0.9685
1. PBF	A6LJR1	ATP synthase subunit beta	0.00e+00	7.15e-78	0.0	0.9872
1. PBF	A3CM14	ATP synthase subunit beta	0.00e+00	7.42e-71	0.0	0.9786
1. PBF	Q5LNP1	ATP synthase subunit beta	0.00e+00	6.75e-72	0.0	0.9746
1. PBF	Q21ZA6	ATP synthase subunit beta 2	0.00e+00	5.35e-26	1.56e-157	0.9758
1. PBF	Q7CFM8	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9798
1. PBF	B8GRC0	ATP synthase subunit alpha	0.00e+00	5.01e-23	1.32e-23	0.8391
1. PBF	Q73X59	ATP synthase subunit beta	0.00e+00	7.02e-69	0.0	0.9729
1. PBF	Q03QY6	ATP synthase subunit alpha	0.00e+00	3.36e-27	2.61e-20	0.844
1. PBF	P33253	ATP synthase subunit beta	0.00e+00	3.37e-81	0.0	0.9849
1. PBF	A9IYW6	ATP synthase subunit beta	0.00e+00	4.28e-24	0.0	0.9598
1. PBF	B0Z528	ATP synthase subunit beta, chloroplastic	0.00e+00	3.07e-67	0.0	0.9682
1. PBF	Q1KXV2	ATP synthase subunit beta, chloroplastic	0.00e+00	2.02e-64	0.0	0.9722
1. PBF	B9DRT4	ATP synthase subunit alpha	0.00e+00	2.33e-27	1.12e-19	0.8568
1. PBF	B1KSS8	ATP synthase subunit beta	0.00e+00	1.58e-73	0.0	0.9875
1. PBF	Q7U8U7	ATP synthase subunit beta	0.00e+00	3.14e-73	0.0	0.9638
1. PBF	P20858	ATP synthase subunit beta, chloroplastic	0.00e+00	7.68e-66	0.0	0.9586
1. PBF	B9LZ84	ATP synthase subunit beta	0.00e+00	9.11e-76	0.0	0.9803
1. PBF	Q87E88	ATP synthase subunit alpha	0.00e+00	9.15e-25	8.82e-25	0.8334
1. PBF	Q7YJW5	ATP synthase subunit beta, chloroplastic	0.00e+00	2.99e-67	0.0	0.9677
1. PBF	B2V6N6	ATP synthase subunit alpha	0.00e+00	2.49e-28	1.71e-25	0.836
1. PBF	B7UMJ7	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9794
1. PBF	A7MMW9	ATP synthase subunit beta	0.00e+00	6.98e-67	0.0	0.9815
1. PBF	Q9BA96	ATP synthase subunit beta, chloroplastic	0.00e+00	2.51e-68	0.0	0.9663
1. PBF	A7HJV7	ATP synthase subunit beta	0.00e+00	1.05e-75	0.0	0.9886
1. PBF	A8G1W7	ATP synthase subunit alpha	0.00e+00	1.05e-25	3.60e-24	0.8392
1. PBF	A7NEH6	ATP synthase subunit alpha	0.00e+00	3.40e-28	3.59e-26	0.8362
1. PBF	A8Y9H7	ATP synthase subunit beta, chloroplastic	0.00e+00	2.97e-65	0.0	0.9596
1. PBF	Q85V27	ATP synthase subunit beta, chloroplastic	0.00e+00	2.45e-66	0.0	0.9674
1. PBF	B7K2R8	ATP synthase subunit beta	0.00e+00	1.53e-75	0.0	0.9724
1. PBF	A9WWS2	ATP synthase subunit beta	0.00e+00	1.48e-27	0.0	0.9562
1. PBF	A4ITI9	ATP synthase subunit beta	0.00e+00	4.74e-75	0.0	0.9665
1. PBF	Q724W4	ATP synthase subunit beta 1	0.00e+00	1.76e-71	1.11e-168	0.9856
1. PBF	B8FGT4	ATP synthase subunit beta	0.00e+00	9.83e-71	0.0	0.9774
1. PBF	Q03EL4	ATP synthase subunit beta	0.00e+00	1.82e-70	0.0	0.9864
1. PBF	B8ZLB1	ATP synthase subunit alpha	0.00e+00	6.85e-30	3.50e-19	0.8566
1. PBF	Q3K1J5	ATP synthase subunit beta	0.00e+00	1.19e-74	0.0	0.9779
1. PBF	A0K2Y1	ATP synthase subunit alpha	0.00e+00	2.57e-26	4.29e-24	0.8319
1. PBF	B0YPN7	ATP synthase subunit beta, plastid	0.00e+00	7.42e-69	0.0	0.9687
1. PBF	Q7HHY5	ATP synthase subunit beta, chloroplastic	0.00e+00	2.65e-68	0.0	0.9691
1. PBF	Q0K5M5	ATP synthase subunit alpha	0.00e+00	3.86e-24	2.59e-22	0.8427
1. PBF	B1NWD5	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.74e-26	1.06e-18	0.8567
1. PBF	Q8FQ20	ATP synthase subunit beta	0.00e+00	2.58e-72	0.0	0.9702
1. PBF	C1FQP5	ATP synthase subunit beta	0.00e+00	1.58e-73	0.0	0.9887
1. PBF	B5Z8D0	ATP synthase subunit beta	0.00e+00	5.45e-71	0.0	0.9743
1. PBF	B5E673	ATP synthase subunit alpha	0.00e+00	5.67e-30	3.32e-19	0.8553
1. PBF	A9BCC6	ATP synthase subunit beta	0.00e+00	4.22e-70	0.0	0.9593
1. PBF	Q0K5M7	ATP synthase subunit beta	0.00e+00	3.37e-70	0.0	0.9648
1. PBF	Q74GY0	ATP synthase subunit beta	0.00e+00	1.88e-75	0.0	0.9817
1. PBF	Q82J84	ATP synthase subunit beta	0.00e+00	6.69e-74	0.0	0.9593
1. PBF	Q7W3B0	ATP synthase subunit beta	0.00e+00	1.35e-67	0.0	0.9741
1. PBF	Q0C9L8	ATP synthase subunit beta, mitochondrial	0.00e+00	1.13e-07	0.0	0.9517
1. PBF	P17614	ATP synthase subunit beta, mitochondrial	0.00e+00	3.10e-18	0.0	0.9624
1. PBF	Q98QU5	ATP synthase subunit beta 1	0.00e+00	1.82e-67	0.0	0.9905
1. PBF	P00828	ATP synthase subunit beta, chloroplastic	0.00e+00	1.36e-65	0.0	0.958
1. PBF	Q494C5	ATP synthase subunit alpha	0.00e+00	4.25e-27	3.79e-22	0.8399
1. PBF	B0Z5B2	ATP synthase subunit beta, chloroplastic	0.00e+00	3.07e-67	0.0	0.9711
1. PBF	A9WGS4	ATP synthase subunit beta	0.00e+00	5.03e-69	0.0	0.9724
1. PBF	Q2RFX7	ATP synthase subunit alpha	0.00e+00	1.48e-26	3.53e-28	0.8592
1. PBF	Q5M104	ATP synthase subunit beta	0.00e+00	1.26e-73	0.0	0.9782
1. PBF	Q0AUD1	ATP synthase subunit alpha	0.00e+00	8.08e-28	3.80e-24	0.8655
1. PBF	Q5HMB9	ATP synthase subunit beta	0.00e+00	2.67e-74	0.0	0.9765
1. PBF	C1AVZ9	ATP synthase subunit beta	0.00e+00	7.35e-72	0.0	0.9716
1. PBF	P26527	ATP synthase subunit beta	0.00e+00	2.07e-69	0.0	0.9722
1. PBF	B3CRK6	ATP synthase subunit beta	0.00e+00	2.03e-71	0.0	0.9627
1. PBF	P0DA04	ATP synthase subunit beta	0.00e+00	6.14e-74	0.0	0.9777
1. PBF	A3PS59	ATP synthase subunit beta 2	0.00e+00	2.34e-57	7.21e-152	0.9687
1. PBF	B0SLC6	ATP synthase subunit alpha	0.00e+00	1.06e-27	2.17e-23	0.8619
1. PBF	Q3ZZT7	ATP synthase subunit beta	0.00e+00	2.05e-72	0.0	0.9898
1. PBF	B5YBP8	ATP synthase subunit beta	0.00e+00	2.02e-61	0.0	0.9857
1. PBF	Q97PT6	ATP synthase subunit beta	0.00e+00	8.54e-71	0.0	0.978
1. PBF	Q06J29	ATP synthase subunit beta, chloroplastic	0.00e+00	2.31e-69	0.0	0.9678
1. PBF	B6EHG4	ATP synthase subunit beta	0.00e+00	1.88e-65	0.0	0.9635
1. PBF	Q13XV9	ATP synthase subunit alpha 1	0.00e+00	6.06e-26	2.08e-21	0.8576
1. PBF	A8GPZ4	ATP synthase subunit beta	0.00e+00	3.72e-72	0.0	0.9695
1. PBF	P00829	ATP synthase subunit beta, mitochondrial	0.00e+00	1.10e-23	0.0	0.9655
1. PBF	A5UQN3	ATP synthase subunit beta	0.00e+00	1.60e-65	0.0	0.9725
1. PBF	A8ACN6	ATP synthase subunit beta	0.00e+00	1.58e-66	0.0	0.9894
1. PBF	C4K227	ATP synthase subunit beta	0.00e+00	3.57e-71	0.0	0.9684
1. PBF	Q2LR05	ATP synthase subunit beta	0.00e+00	2.31e-68	0.0	0.9786
1. PBF	A7X4U5	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	0.8637
1. PBF	Q6B8S4	ATP synthase subunit beta, chloroplastic	0.00e+00	5.89e-76	0.0	0.9738
1. PBF	A8YUK1	ATP synthase subunit beta	0.00e+00	2.24e-64	0.0	0.9766
1. PBF	Q4G397	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.02e-27	3.17e-21	0.8592
1. PBF	Q3YVN6	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9797
1. PBF	B2TUP1	ATP synthase subunit alpha	0.00e+00	7.90e-23	9.48e-25	0.8428
1. PBF	A9R5T9	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9792
1. PBF	Q7H8L9	ATP synthase subunit beta, chloroplastic	0.00e+00	3.19e-70	0.0	0.9728
1. PBF	O47037	ATP synthase subunit beta, chloroplastic	0.00e+00	9.80e-66	0.0	0.9595
1. PBF	Q3A946	ATP synthase subunit beta	0.00e+00	6.59e-68	0.0	0.9737
1. PBF	Q7VU44	ATP synthase subunit beta	0.00e+00	2.40e-67	0.0	0.9655
1. PBF	B4SJS1	ATP synthase subunit alpha	0.00e+00	1.21e-24	6.85e-24	0.8368
1. PBF	A3P8M2	ATP synthase subunit beta 2	0.00e+00	1.11e-37	5.76e-163	0.9657
1. PBF	Q0BK82	ATP synthase subunit alpha	0.00e+00	3.40e-28	3.59e-26	0.8362
1. PBF	A0LDA0	ATP synthase subunit beta	0.00e+00	4.81e-72	0.0	0.9714
1. PBF	B5ZSN7	ATP synthase subunit beta	0.00e+00	1.03e-71	0.0	0.9703
1. PBF	Q06GQ3	ATP synthase subunit beta, chloroplastic	0.00e+00	6.96e-68	0.0	0.9704
1. PBF	Q1LHL0	ATP synthase subunit beta	0.00e+00	9.75e-70	0.0	0.9688
1. PBF	A8LN39	ATP synthase subunit beta 1	0.00e+00	1.22e-61	7.62e-159	0.9748
1. PBF	A0KQY0	ATP synthase subunit alpha	0.00e+00	5.32e-25	4.75e-24	0.8411
1. PBF	O50290	ATP synthase subunit beta	0.00e+00	2.62e-71	0.0	0.9685
1. PBF	O03066	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	7.13e-06	4.17e-166	0.971
1. PBF	B4SYD1	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9899
1. PBF	Q9MRI8	ATP synthase subunit beta, chloroplastic	0.00e+00	1.68e-65	0.0	0.9698
1. PBF	B1KQ36	ATP synthase subunit alpha	0.00e+00	2.41e-25	1.10e-24	0.8401
1. PBF	Q662R9	V-type ATP synthase beta chain	0.00e+00	3.73e-20	5.69e-10	0.8526
1. PBF	A3QJR2	ATP synthase subunit alpha	0.00e+00	2.14e-23	2.90e-24	0.8404
1. PBF	A8FIB2	ATP synthase subunit beta	0.00e+00	9.65e-76	0.0	0.9727
1. PBF	P33252	ATP synthase subunit alpha	0.00e+00	2.73e-28	1.16e-17	0.7851
1. PBF	A4TSJ3	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9876
1. PBF	Q8FYR5	ATP synthase subunit beta	0.00e+00	1.48e-27	0.0	0.9563
1. PBF	Q68RZ9	ATP synthase subunit beta, chloroplastic	0.00e+00	1.55e-67	0.0	0.9716
1. PBF	P00826	ATP synthase subunit beta, chloroplastic	0.00e+00	9.49e-65	0.0	0.9668
1. PBF	B0UWG5	ATP synthase subunit beta	0.00e+00	1.67e-63	0.0	0.9789
1. PBF	A5VSE1	ATP synthase subunit beta	0.00e+00	1.48e-27	0.0	0.9609
1. PBF	B7H296	ATP synthase subunit alpha	0.00e+00	2.26e-23	1.06e-22	0.8336
1. PBF	Q17Y78	ATP synthase subunit beta	0.00e+00	2.96e-68	0.0	0.9763
1. PBF	P0A301	ATP synthase subunit beta	0.00e+00	1.64e-74	0.0	0.9606
1. PBF	Q0I5X3	ATP synthase subunit beta	0.00e+00	5.84e-63	0.0	0.9776
1. PBF	Q11Y90	ATP synthase subunit beta	0.00e+00	3.34e-63	0.0	0.9565
1. PBF	B5ZAW1	ATP synthase subunit beta	0.00e+00	3.70e-76	0.0	0.9953
1. PBF	Q32RY8	ATP synthase subunit beta, chloroplastic	0.00e+00	9.29e-71	0.0	0.9663
1. PBF	C1C899	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	0.9781
1. PBF	A9HY42	ATP synthase subunit beta	0.00e+00	2.01e-68	0.0	0.9621
1. PBF	C1CF95	ATP synthase subunit alpha	0.00e+00	6.85e-30	3.50e-19	0.8552
1. PBF	Q9LA80	ATP synthase subunit beta	0.00e+00	8.94e-75	0.0	0.9707
1. PBF	Q6G7K7	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9821
1. PBF	Q9MU41	ATP synthase subunit beta, chloroplastic	0.00e+00	3.52e-67	0.0	0.9661
1. PBF	O03068	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	4.94e-58	0.0	0.9577
1. PBF	A3NN65	ATP synthase subunit beta 2	0.00e+00	7.39e-32	2.74e-156	0.9805
1. PBF	Q6KI82	ATP synthase subunit beta	0.00e+00	9.48e-70	0.0	0.9899
1. PBF	Q831A5	ATP synthase subunit beta	0.00e+00	3.07e-75	0.0	0.9778
1. PBF	Q1C095	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9795
1. PBF	A0L2S8	ATP synthase subunit beta	0.00e+00	1.54e-66	0.0	0.984
1. PBF	Q12GQ2	ATP synthase subunit alpha	0.00e+00	2.97e-22	7.40e-24	0.8462
1. PBF	C3M9S1	ATP synthase subunit beta	0.00e+00	3.64e-53	0.0	0.9653
1. PBF	Q8RK01	Type 3 secretion system ATPase	0.00e+00	1.92e-35	3.69e-30	0.862
1. PBF	C3P1F4	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9716
1. PBF	P43451	ATP synthase subunit beta	0.00e+00	2.66e-75	0.0	0.9787
1. PBF	Q7UFB5	ATP synthase subunit beta	0.00e+00	3.40e-68	0.0	0.968
1. PBF	A0KQX8	ATP synthase subunit beta	0.00e+00	5.92e-67	0.0	0.9835
1. PBF	Q5KUJ3	ATP synthase subunit beta	0.00e+00	9.93e-76	0.0	0.974
1. PBF	A8Y9G7	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.19e-24	3.60e-22	0.8552
1. PBF	Q601Z5	ATP synthase subunit beta	0.00e+00	6.82e-71	0.0	0.9864
1. PBF	Q9MRF3	ATP synthase subunit beta, chloroplastic	0.00e+00	2.27e-67	0.0	0.9662
1. PBF	Q8E5U8	ATP synthase subunit beta	0.00e+00	1.67e-75	0.0	0.978
1. PBF	Q9PTY0	ATP synthase subunit beta, mitochondrial	0.00e+00	2.97e-30	0.0	0.9658
1. PBF	B8ZLA9	ATP synthase subunit beta	0.00e+00	8.54e-71	0.0	0.9783
1. PBF	O83442	V-type ATP synthase beta chain 1	0.00e+00	3.02e-19	2.10e-12	0.8654
1. PBF	Q13XV3	ATP synthase subunit beta 1	0.00e+00	4.77e-57	1.70e-161	0.974
1. PBF	Q255D8	V-type ATP synthase beta chain	0.00e+00	7.26e-19	1.39e-13	0.8205
1. PBF	P63680	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9812
1. PBF	A5ILX2	ATP synthase subunit beta	0.00e+00	6.06e-76	0.0	0.9877
1. PBF	P41167	ATP synthase subunit alpha	0.00e+00	2.04e-24	1.36e-24	0.8407
1. PBF	Q2VZN2	ATP synthase subunit beta	0.00e+00	1.13e-72	0.0	0.9734
1. PBF	A8MJV9	ATP synthase subunit beta	0.00e+00	1.29e-71	0.0	0.9917
1. PBF	Q7VQV6	ATP synthase subunit beta	0.00e+00	5.15e-71	0.0	0.9742
1. PBF	P0A1C0	SPI-1 type 3 secretion system ATPase	0.00e+00	1.85e-35	1.95e-36	0.8816
1. PBF	P26532	ATP synthase subunit beta, chloroplastic	0.00e+00	1.58e-77	0.0	0.9675
1. PBF	Q0BQE8	ATP synthase subunit beta	0.00e+00	2.36e-73	0.0	0.9575
1. PBF	Q04G22	ATP synthase subunit alpha	0.00e+00	1.23e-27	1.94e-24	0.8667
1. PBF	Q72SY1	ATP synthase subunit alpha	0.00e+00	7.44e-27	8.38e-25	0.8576
1. PBF	Q73IG3	ATP synthase subunit beta	0.00e+00	7.42e-71	0.0	0.9558
1. PBF	B1IX06	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9829
1. PBF	A6WUJ0	ATP synthase subunit beta	0.00e+00	1.28e-67	0.0	0.9766
1. PBF	A3NF42	ATP synthase subunit alpha 1	0.00e+00	2.09e-27	4.10e-24	0.8316
1. PBF	B8CZ12	ATP synthase subunit alpha	0.00e+00	7.65e-20	5.66e-28	0.8663
1. PBF	Q1IIG8	ATP synthase subunit beta	0.00e+00	4.48e-68	0.0	0.96
1. PBF	Q06RC2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.96e-68	0.0	0.9706
1. PBF	Q0I7U1	ATP synthase subunit beta	0.00e+00	1.87e-71	0.0	0.9617
1. PBF	A5E950	ATP synthase subunit beta 1	0.00e+00	5.00e-68	0.0	0.9613
1. PBF	A8GY40	ATP synthase subunit beta	0.00e+00	5.63e-69	0.0	0.9715
1. PBF	Q9A0I7	ATP synthase subunit beta	0.00e+00	3.08e-74	0.0	0.9784
1. PBF	B6YQC5	ATP synthase subunit beta	0.00e+00	2.95e-57	0.0	0.9489
1. PBF	Q7VQV8	ATP synthase subunit alpha	0.00e+00	3.46e-29	1.35e-23	0.8271
1. PBF	B8G6G8	ATP synthase subunit alpha	0.00e+00	1.31e-22	5.93e-19	0.8408
1. PBF	Q0PC30	ATP synthase subunit beta	0.00e+00	6.15e-75	0.0	0.9744
1. PBF	Q1MRB8	ATP synthase subunit beta	0.00e+00	2.22e-70	0.0	0.9828
1. PBF	A0RL95	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9723
1. PBF	C5BF40	ATP synthase subunit beta	0.00e+00	2.81e-66	0.0	0.9818
1. PBF	A7H1I1	ATP synthase subunit beta	0.00e+00	2.84e-61	0.0	0.9758
1. PBF	Q6GEX2	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9821
1. PBF	Q6MAK7	ATP synthase subunit beta	0.00e+00	1.03e-64	0.0	0.9859
1. PBF	Q332X1	ATP synthase subunit beta, chloroplastic	0.00e+00	3.50e-65	0.0	0.9679
1. PBF	Q57HX9	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9805
1. PBF	P0DA05	ATP synthase subunit beta	0.00e+00	6.14e-74	0.0	0.978
1. PBF	A6L8P2	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	0.9621
1. PBF	Q8MBG0	ATP synthase subunit beta, plastid	0.00e+00	1.13e-68	0.0	0.9824
1. PBF	A9H9A8	ATP synthase subunit beta	0.00e+00	4.63e-69	0.0	0.9695
1. PBF	B2UGV1	ATP synthase subunit alpha	0.00e+00	1.26e-25	2.32e-24	0.8413
1. PBF	Q7HHX4	ATP synthase subunit beta, chloroplastic	0.00e+00	2.65e-68	0.0	0.9648
1. PBF	Q6MS94	ATP synthase subunit beta	0.00e+00	1.09e-107	0.0	0.9986
1. PBF	Q19V65	ATP synthase subunit beta, chloroplastic	0.00e+00	2.24e-75	0.0	0.972
1. PBF	P26530	ATP synthase subunit beta, chloroplastic	0.00e+00	2.57e-64	0.0	0.9595
1. PBF	Q07VU2	ATP synthase subunit alpha 2	0.00e+00	5.36e-23	7.97e-22	0.8418
1. PBF	B5QUS4	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9899
1. PBF	B0SDA3	ATP synthase subunit alpha	0.00e+00	1.06e-27	2.17e-23	0.8615
1. PBF	Q72E04	ATP synthase subunit beta	0.00e+00	1.27e-70	0.0	0.9825
1. PBF	Q0HPG1	ATP synthase subunit beta	0.00e+00	6.70e-66	0.0	0.9784
1. PBF	Q4ZL24	ATP synthase subunit beta	0.00e+00	1.73e-62	0.0	0.9785
1. PBF	P69369	ATP synthase subunit beta, chloroplastic	0.00e+00	1.18e-63	0.0	0.9658
1. PBF	Q8YAM6	ATP synthase subunit beta 1	0.00e+00	8.07e-71	1.40e-167	0.9851
1. PBF	Q8RGE2	ATP synthase subunit beta	0.00e+00	1.50e-66	0.0	0.9837
1. PBF	Q3A605	ATP synthase subunit beta 1	0.00e+00	6.82e-77	0.0	0.9817
1. PBF	A1VPR5	ATP synthase subunit beta 2	0.00e+00	1.09e-63	2.47e-150	0.9692
1. PBF	O03075	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	4.51e-52	4.60e-178	0.9312
1. PBF	B3H2P3	ATP synthase subunit beta	0.00e+00	3.17e-63	0.0	0.9785
1. PBF	Q14FF0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.67e-66	0.0	0.9667
1. PBF	A7ZTU4	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9896
1. PBF	Q927W4	ATP synthase subunit beta 2	0.00e+00	1.37e-75	0.0	0.9706
1. PBF	A6MML4	ATP synthase subunit beta, chloroplastic	0.00e+00	2.81e-69	0.0	0.9619
1. PBF	A4TSJ1	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	0.8388
1. PBF	B2K847	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9746
1. PBF	O03074	ATP synthase subunit beta, chloroplastic (Fragment)	0.00e+00	6.51e-08	2.50e-164	0.966
1. PBF	B0T335	ATP synthase subunit beta	0.00e+00	1.35e-22	0.0	0.9601
1. PBF	Q52371	Type 3 secretion system ATPase	0.00e+00	3.54e-35	2.70e-30	0.8435
1. PBF	Q2T880	ATP synthase subunit beta 2	0.00e+00	1.43e-50	5.51e-159	0.9701
1. PBF	A6WXX1	ATP synthase subunit beta	0.00e+00	2.90e-34	0.0	0.9564
1. PBF	B3WDL8	ATP synthase subunit beta	0.00e+00	9.96e-57	0.0	0.9835
1. PBF	Q2L917	ATP synthase subunit beta, chloroplastic	0.00e+00	9.01e-69	0.0	0.9612
1. PBF	Q95AD6	ATP synthase subunit beta, chloroplastic	0.00e+00	5.89e-64	0.0	0.9666
1. PBF	B9KES3	ATP synthase subunit beta	0.00e+00	2.84e-61	0.0	0.976
1. PBF	Q6HAY0	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9723
1. PBF	Q09X10	ATP synthase subunit beta, chloroplastic	0.00e+00	1.61e-68	0.0	0.9627
1. PBF	Q7WEM9	ATP synthase subunit beta	0.00e+00	1.35e-67	0.0	0.9737
1. PBF	Q9BA69	ATP synthase subunit beta, chloroplastic	0.00e+00	6.59e-68	0.0	0.9703
1. PBF	B7MGF2	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9814
1. PBF	A9KX08	ATP synthase subunit alpha	0.00e+00	2.81e-23	1.83e-25	0.8362
1. PBF	B8D8H1	ATP synthase subunit alpha	0.00e+00	2.82e-26	1.29e-24	0.8402
1. PBF	C1F3N6	ATP synthase subunit beta	0.00e+00	2.44e-68	0.0	0.9628
1. PBF	A0Q2Z4	ATP synthase subunit beta	0.00e+00	4.60e-78	0.0	0.989
1. PBF	Q73M29	V-type ATP synthase beta chain	0.00e+00	2.05e-18	1.87e-12	0.8592
1. PBF	Q5M106	ATP synthase subunit alpha	0.00e+00	1.91e-27	7.95e-20	0.8664
1. PBF	A1E9T1	ATP synthase subunit beta, chloroplastic	0.00e+00	3.92e-69	0.0	0.9677
1. PBF	B8D6S5	ATP synthase subunit alpha	0.00e+00	6.99e-26	1.53e-24	0.7805
1. PBF	Q63PH8	ATP synthase subunit alpha 1	0.00e+00	2.09e-27	4.10e-24	0.8305
1. PBF	Q9X1U7	ATP synthase subunit alpha	0.00e+00	2.76e-29	2.41e-22	0.8585
1. PBF	Q4A8V9	ATP synthase subunit beta	0.00e+00	5.76e-71	0.0	0.9906
1. PBF	A4SUT4	ATP synthase subunit beta	0.00e+00	9.29e-71	0.0	0.9677
1. PBF	O51120	V-type ATP synthase beta chain	0.00e+00	5.06e-20	2.73e-09	0.8423
1. PBF	Q8P1K5	ATP synthase subunit beta	0.00e+00	7.29e-74	0.0	0.9781
1. PBF	Q95FL8	ATP synthase subunit beta, chloroplastic	0.00e+00	3.43e-67	0.0	0.9673
1. PBF	Q9MTP7	ATP synthase subunit beta, chloroplastic	0.00e+00	3.07e-67	0.0	0.9679
1. PBF	A9MJR7	ATP synthase subunit alpha	0.00e+00	3.63e-23	5.66e-23	0.8406
1. PBF	Q3AZK5	ATP synthase subunit beta	0.00e+00	4.23e-74	0.0	0.9611
1. PBF	Q04G20	ATP synthase subunit beta	0.00e+00	4.11e-71	0.0	0.9806
1. PBF	Q8XGX4	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9823
1. PBF	A1QYP2	V-type ATP synthase beta chain	0.00e+00	5.14e-20	2.53e-11	0.8604
1. PBF	Q7V049	ATP synthase subunit beta	0.00e+00	1.23e-70	0.0	0.9675
1. PBF	Q5XCY0	ATP synthase subunit beta	0.00e+00	7.29e-74	0.0	0.9776
1. PBF	B7J126	V-type ATP synthase beta chain	0.00e+00	5.06e-20	2.73e-09	0.8419
1. PBF	Q8E072	ATP synthase subunit beta	0.00e+00	1.19e-74	0.0	0.9777
1. PBF	P42006	ATP synthase subunit beta	0.00e+00	2.00e-74	0.0	0.9708
1. PBF	Q10Z38	ATP synthase subunit beta	0.00e+00	2.41e-70	0.0	0.9694
1. PBF	A7N6Q5	ATP synthase subunit beta 2	0.00e+00	7.38e-73	0.0	0.9781
1. PBF	Q2NQ86	ATP synthase subunit beta	0.00e+00	2.30e-64	0.0	0.9798
1. PBF	Q7V5U2	ATP synthase subunit beta	0.00e+00	7.85e-71	0.0	0.9658
1. PBF	Q8SLY2	ATP synthase subunit beta, chloroplastic	0.00e+00	3.07e-67	0.0	0.9686
1. PBF	C1A1X8	ATP synthase subunit beta	0.00e+00	2.44e-69	0.0	0.9686
1. PBF	B7N2H1	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9895
1. PBF	A9KK92	ATP synthase subunit beta	0.00e+00	7.81e-78	0.0	0.9743
1. PBF	Q180W5	ATP synthase subunit beta	0.00e+00	1.58e-73	0.0	0.9838
1. PBF	Q8RC15	ATP synthase subunit beta	0.00e+00	7.42e-69	0.0	0.9868
1. PBF	P55988	ATP synthase subunit beta	0.00e+00	5.60e-71	0.0	0.9759
1. PBF	B5Y831	ATP synthase subunit beta	0.00e+00	9.68e-63	1.17e-164	0.9801
1. PBF	A1AP52	ATP synthase subunit beta 2	0.00e+00	2.51e-75	0.0	0.9816
1. PBF	A8SEB0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-67	0.0	0.9614
1. PBF	Q0AKW0	ATP synthase subunit beta	0.00e+00	2.03e-67	0.0	0.9626
1. PBF	P42470	ATP synthase subunit beta	0.00e+00	3.62e-72	0.0	0.9785
1. PBF	B2UZK0	ATP synthase subunit beta	0.00e+00	1.88e-75	0.0	0.9908
1. PBF	A0PUK0	ATP synthase subunit beta	0.00e+00	2.41e-71	0.0	0.9622
1. PBF	P43715	ATP synthase subunit beta	0.00e+00	2.58e-62	0.0	0.9792
1. PBF	Q06GS5	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.42e-25	5.88e-20	0.8602
1. PBF	Q06SG7	ATP synthase subunit beta, chloroplastic	0.00e+00	1.68e-72	0.0	0.9688
1. PBF	Q8D3J3	ATP synthase subunit beta	0.00e+00	1.87e-66	0.0	0.9848
1. PBF	B1AIB8	ATP synthase subunit beta	0.00e+00	1.19e-76	0.0	0.9958
1. PBF	Q5NIK5	ATP synthase subunit alpha	0.00e+00	9.71e-28	1.69e-25	0.8374
1. PBF	Q9K6H5	ATP synthase subunit beta	0.00e+00	4.15e-77	0.0	0.9678
1. PBF	Q7H8M1	ATP synthase subunit beta, chloroplastic	0.00e+00	4.15e-69	0.0	0.9724
1. PBF	P51259	ATP synthase subunit beta, chloroplastic	0.00e+00	1.41e-71	0.0	0.974
1. PBF	Q1QQS8	ATP synthase subunit beta	0.00e+00	5.74e-70	0.0	0.969
1. PBF	A7I175	ATP synthase subunit alpha	0.00e+00	2.27e-28	5.47e-25	0.8569
1. PBF	Q1BRA8	ATP synthase subunit alpha	0.00e+00	2.57e-26	4.29e-24	0.8302
1. PBF	C1D5G4	ATP synthase subunit alpha	0.00e+00	4.79e-25	2.30e-23	0.8378
1. PBF	A4Y189	ATP synthase subunit alpha	0.00e+00	1.73e-25	1.03e-21	0.8392
1. PBF	Q6EW72	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-66	0.0	0.966
1. PBF	A2C6Z4	ATP synthase subunit beta	0.00e+00	4.38e-69	0.0	0.9576
1. PBF	A3DAR6	ATP synthase subunit alpha	0.00e+00	2.81e-23	1.83e-25	0.8357
1. PBF	B1X9W0	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9784
1. PBF	A2S6K0	ATP synthase subunit alpha	0.00e+00	1.59e-27	3.04e-24	0.8303
1. PBF	P50000	ATP synthase subunit alpha, sodium ion specific	0.00e+00	1.25e-29	1.52e-26	0.873
1. PBF	Q1B553	ATP synthase subunit beta	0.00e+00	3.55e-50	0.0	0.9625
1. PBF	Q7HHW4	ATP synthase subunit beta, chloroplastic	0.00e+00	2.65e-68	0.0	0.9689
1. PBF	B8G6G6	ATP synthase subunit beta	0.00e+00	8.07e-69	0.0	0.9671
1. PBF	B7I1W2	ATP synthase subunit alpha	0.00e+00	2.26e-23	1.06e-22	0.8336
1. PBF	Q8E8C0	ATP synthase subunit beta	0.00e+00	1.63e-66	0.0	0.9842
1. PBF	A1VIV0	ATP synthase subunit alpha 1	0.00e+00	2.69e-22	4.20e-24	0.8457
1. PBF	A0R200	ATP synthase subunit beta	0.00e+00	4.67e-72	0.0	0.9745
1. PBF	P23445	Flagellum-specific ATP synthase	0.00e+00	3.11e-39	7.87e-38	0.8755
1. PBF	C0M720	ATP synthase subunit beta	0.00e+00	7.09e-74	0.0	0.9783
1. PBF	Q9PR15	ATP synthase subunit beta	0.00e+00	1.19e-76	0.0	0.9957
1. PBF	Q2A1I0	ATP synthase subunit alpha	0.00e+00	3.40e-28	3.59e-26	0.8358
1. PBF	B7M588	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9834
1. PBF	Q477Z3	ATP synthase subunit alpha	0.00e+00	2.96e-23	3.26e-23	0.8295
1. PBF	B3QUP6	ATP synthase subunit beta	0.00e+00	7.63e-71	0.0	0.9856
1. PBF	B5FN33	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9805
1. PBF	Q1R4K2	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9822
1. PBF	P69370	ATP synthase subunit beta, chloroplastic	0.00e+00	1.18e-63	0.0	0.9679
1. PBF	A0Q8E1	ATP synthase subunit alpha	0.00e+00	6.85e-28	4.14e-26	0.8371
1. PBF	Q28TJ6	ATP synthase subunit beta	0.00e+00	5.39e-73	0.0	0.9577
1. PBF	Q2GD08	ATP synthase subunit beta	0.00e+00	3.71e-69	0.0	0.972
1. PBF	Q03234	ATP synthase subunit beta	0.00e+00	5.40e-76	0.0	0.9842
1. PBF	Q3C1J5	ATP synthase subunit beta, chloroplastic	0.00e+00	2.57e-64	0.0	0.967
1. PBF	A6TK65	ATP synthase subunit beta	0.00e+00	5.87e-73	0.0	0.9935
1. PBF	A4STP3	ATP synthase subunit beta	0.00e+00	1.38e-66	0.0	0.9836
1. PBF	P48081	ATP synthase subunit beta, cyanelle	0.00e+00	2.55e-71	0.0	0.9638
1. PBF	B1XSD4	ATP synthase subunit beta	0.00e+00	1.50e-70	0.0	0.9738
1. PBF	A4QL26	ATP synthase subunit beta, chloroplastic	0.00e+00	3.67e-71	0.0	0.9628
1. PBF	A6QIU7	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9817
1. PBF	Q6CYJ5	ATP synthase subunit beta	0.00e+00	2.68e-67	0.0	0.9817
1. PBF	C0Z776	ATP synthase subunit beta	0.00e+00	9.11e-76	0.0	0.9774
1. PBF	A1E9I8	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.62e-25	5.64e-21	0.8548
1. PBF	Q9MTY2	ATP synthase subunit beta, chloroplastic	0.00e+00	4.46e-65	0.0	0.9667
1. PBF	A4SC45	ATP synthase subunit beta	0.00e+00	2.36e-73	0.0	0.9848
1. PBF	Q1JHN5	ATP synthase subunit beta	0.00e+00	7.29e-74	0.0	0.9777
1. PBF	Q1GAW5	ATP synthase subunit beta	0.00e+00	4.84e-65	0.0	0.9805
1. PBF	A5CYE2	ATP synthase subunit beta	0.00e+00	5.58e-64	0.0	0.9701
1. PBF	B7LK77	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9818
1. PBF	C3LFH9	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	0.9726
1. PBF	Q8XID4	ATP synthase subunit beta	0.00e+00	2.00e-74	0.0	0.9848
1. PBF	Q6ENG7	ATP synthase subunit beta, chloroplastic	0.00e+00	2.33e-65	0.0	0.9575
1. PBF	Q7MGI0	ATP synthase subunit beta	0.00e+00	3.14e-65	0.0	0.9737
1. PBF	A7FPE0	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9795
1. PBF	Q5FNZ3	ATP synthase subunit beta 2	0.00e+00	7.11e-64	2.84e-157	0.9716
1. PBF	Q13IW9	ATP synthase subunit alpha 3	0.00e+00	1.07e-24	2.51e-18	0.8622
1. PBF	A7H017	ATP synthase subunit beta	0.00e+00	6.15e-75	0.0	0.9737
1. PBF	B1VFY7	ATP synthase subunit beta	0.00e+00	3.17e-74	0.0	0.9657
1. PBF	Q5P4E4	ATP synthase subunit alpha	0.00e+00	1.44e-24	7.74e-25	0.8417
1. PBF	Q8MBQ2	ATP synthase subunit beta, chloroplastic	0.00e+00	9.27e-69	0.0	0.9689
1. PBF	A9L9A3	ATP synthase subunit beta, chloroplastic	0.00e+00	2.38e-69	0.0	0.967
1. PBF	B8CVU7	ATP synthase subunit alpha	0.00e+00	2.46e-25	6.52e-25	0.832
1. PBF	P30399	ATP synthase subunit beta, plastid	0.00e+00	1.14e-67	0.0	0.9852
1. PBF	A5GV55	ATP synthase subunit beta	0.00e+00	2.89e-72	0.0	0.9659
1. PBF	B7NR34	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9831
1. PBF	Q85V28	ATP synthase subunit beta, chloroplastic	0.00e+00	8.45e-67	0.0	0.9711
1. PBF	Q89B41	ATP synthase subunit alpha	0.00e+00	2.67e-26	7.97e-24	0.7926
1. PBF	O03062	ATP synthase subunit beta, chloroplastic	0.00e+00	4.63e-69	0.0	0.9653
1. PBF	Q2IHQ2	ATP synthase subunit beta	0.00e+00	3.67e-71	0.0	0.9692
1. PBF	B0TWS5	ATP synthase subunit alpha	0.00e+00	2.80e-27	5.64e-26	0.8388
1. PBF	Q9BA86	ATP synthase subunit beta, chloroplastic	0.00e+00	7.36e-68	0.0	0.966
1. PBF	Q2KU34	ATP synthase subunit alpha	0.00e+00	8.65e-26	1.13e-23	0.8304
1. PBF	Q5PKX2	ATP synthase subunit beta	0.00e+00	1.01e-65	0.0	0.9904
1. PBF	P0C2Z7	ATP synthase subunit beta, chloroplastic	0.00e+00	2.33e-65	0.0	0.959
1. PBF	Q223D4	ATP synthase subunit alpha 1	0.00e+00	9.33e-22	2.56e-26	0.8324
1. PBF	Q5E1N7	ATP synthase subunit beta	0.00e+00	1.88e-65	0.0	0.9619
1. PBF	B5BIN6	ATP synthase subunit beta	0.00e+00	1.01e-65	0.0	0.9807
1. PBF	A6W3T0	ATP synthase subunit alpha 2	0.00e+00	6.80e-27	2.00e-26	0.8383
1. PBF	C3LSI9	ATP synthase subunit beta	0.00e+00	1.06e-63	0.0	0.974
1. PBF	P06284	ATP synthase subunit beta, chloroplastic	0.00e+00	4.48e-68	0.0	0.9615
1. PBF	Q49Z52	ATP synthase subunit alpha	0.00e+00	7.18e-27	1.87e-23	0.8652
1. PBF	A8L3W5	ATP synthase subunit beta	0.00e+00	7.79e-67	0.0	0.9569
1. PBF	A7IH31	ATP synthase subunit beta	0.00e+00	3.49e-68	0.0	0.9506
1. PBF	Q7NA94	ATP synthase subunit beta	0.00e+00	1.68e-67	0.0	0.9903
1. PBF	Q3Z8Z2	ATP synthase subunit beta	0.00e+00	8.07e-71	0.0	0.9903
1. PBF	B2TK00	ATP synthase subunit beta	0.00e+00	4.28e-76	0.0	0.9892
1. PBF	B3EST8	ATP synthase subunit beta	0.00e+00	3.31e-60	0.0	0.955
1. PBF	A6VL59	ATP synthase subunit alpha	0.00e+00	2.78e-25	6.83e-24	0.8425
1. PBF	Q2JIV9	ATP synthase subunit beta	0.00e+00	2.58e-75	0.0	0.9748
1. PBF	A6TG36	ATP synthase subunit beta	0.00e+00	2.66e-66	0.0	0.9829
1. PBF	C0QW65	ATP synthase subunit alpha	0.00e+00	8.38e-28	3.14e-21	0.8598
1. PBF	Q3AP13	ATP synthase subunit beta	0.00e+00	5.28e-70	0.0	0.9846
1. PBF	Q03A18	ATP synthase subunit beta	0.00e+00	9.96e-57	0.0	0.9834
1. PBF	Q7WEM7	ATP synthase subunit alpha	0.00e+00	4.16e-25	1.46e-23	0.8289
1. PBF	A0A342	ATP synthase subunit beta, chloroplastic	0.00e+00	1.04e-70	0.0	0.9698
1. PBF	Q1AVH9	ATP synthase subunit beta	0.00e+00	2.53e-57	0.0	0.9605
1. PBF	Q5E1N5	ATP synthase subunit alpha	0.00e+00	4.16e-25	1.87e-27	0.8374
1. PBF	Q0TAX7	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9899
1. PBF	B8D6S7	ATP synthase subunit beta	0.00e+00	2.46e-65	0.0	0.9769
1. PBF	Q92G88	ATP synthase subunit beta	0.00e+00	4.54e-72	0.0	0.9683
1. PBF	A7HT52	ATP synthase subunit beta	0.00e+00	7.45e-65	0.0	0.9539
1. PBF	B8FZ34	ATP synthase subunit beta	0.00e+00	1.88e-75	0.0	0.9769
1. PBF	Q40612	ATP synthase subunit beta, chloroplastic	0.00e+00	8.44e-75	0.0	0.976
1. PBF	Q4AAV7	ATP synthase subunit beta	0.00e+00	2.69e-71	0.0	0.9915
1. PBF	A4YKE0	ATP synthase subunit beta	0.00e+00	5.95e-69	0.0	0.9613
1. PBF	Q8MBG4	ATP synthase subunit beta, plastid	0.00e+00	2.85e-71	0.0	0.9616
1. PBF	A1JTC6	ATP synthase subunit beta	0.00e+00	1.77e-66	0.0	0.9892
1. PBF	Q494C3	ATP synthase subunit beta	0.00e+00	3.40e-68	0.0	0.984
1. PBF	A3MQJ7	ATP synthase subunit alpha 1	0.00e+00	1.59e-27	3.04e-24	0.8308
1. PBF	A4QKB2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.63e-70	0.0	0.9629
1. PBF	Q1LTV4	ATP synthase subunit beta	0.00e+00	1.40e-68	0.0	0.9894
1. PBF	Q31794	ATP synthase subunit beta, chloroplastic	0.00e+00	2.44e-68	0.0	0.9552
1. PBF	B0B7M3	V-type ATP synthase beta chain	0.00e+00	4.84e-19	1.55e-16	0.8105
1. PBF	Q8D3J5	ATP synthase subunit alpha	0.00e+00	4.24e-25	4.68e-28	0.8324
1. PBF	Q0RDB4	ATP synthase subunit beta	0.00e+00	1.87e-71	0.0	0.958
1. PBF	B5YI24	ATP synthase subunit beta	0.00e+00	4.15e-69	0.0	0.9667
1. PBF	Q46VY0	ATP synthase subunit beta	0.00e+00	6.64e-69	0.0	0.9659
1. PBF	P9WPU4	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	0.9604
1. PBF	Q15SF7	ATP synthase subunit beta 1	0.00e+00	1.69e-19	2.68e-160	0.9511
1. PBF	Q9TMV0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.55e-67	0.0	0.9663
1. PBF	C6E9F1	ATP synthase subunit beta	0.00e+00	2.06e-74	0.0	0.9799
1. PBF	B8EDV2	ATP synthase subunit alpha	0.00e+00	2.81e-23	1.83e-25	0.8403
1. PBF	B8FZ36	ATP synthase subunit alpha	0.00e+00	1.72e-28	1.73e-19	0.8652
1. PBF	B3EA01	ATP synthase subunit beta	0.00e+00	3.16e-75	0.0	0.9817
1. PBF	A9AVV4	ATP synthase subunit beta	0.00e+00	4.00e-66	0.0	0.9678
1. PBF	A3M142	ATP synthase subunit alpha	0.00e+00	2.26e-23	1.06e-22	0.8332
1. PBF	P47639	ATP synthase subunit beta	0.00e+00	4.95e-72	0.0	0.9722
1. PBF	A1AHR4	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9814
1. PBF	A4QK25	ATP synthase subunit beta, chloroplastic	0.00e+00	1.82e-71	0.0	0.9633
1. PBF	A4QLK1	ATP synthase subunit beta, chloroplastic	0.00e+00	4.11e-71	0.0	0.9571
1. PBF	Q31UN2	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.982
1. PBF	B0TQF6	ATP synthase subunit alpha	0.00e+00	2.54e-25	2.69e-24	0.8411
1. PBF	A4J999	ATP synthase subunit beta	0.00e+00	1.39e-63	0.0	0.9719
1. PBF	C4ZZ10	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9798
1. PBF	Q49KZ1	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-67	0.0	0.965
1. PBF	Q2Y8G9	ATP synthase subunit alpha 2	0.00e+00	5.12e-29	9.56e-30	0.8595
1. PBF	Q06FV3	ATP synthase subunit beta, chloroplastic	0.00e+00	3.88e-70	0.0	0.9806
1. PBF	Q1Q897	ATP synthase subunit alpha	0.00e+00	6.63e-26	3.72e-24	0.8403
1. PBF	Q65Q05	ATP synthase subunit alpha	0.00e+00	4.24e-25	2.14e-22	0.841
1. PBF	Q8MBQ3	ATP synthase subunit beta, chloroplastic	0.00e+00	1.09e-69	0.0	0.9739
1. PBF	C3PFR5	ATP synthase subunit beta	0.00e+00	7.88e-76	0.0	0.9654
1. PBF	O66907	ATP synthase subunit alpha	0.00e+00	3.80e-28	7.22e-25	0.847
1. PBF	B7IQV8	ATP synthase subunit beta	0.00e+00	3.48e-77	0.0	0.9785
1. PBF	A4YCI0	ATP synthase subunit alpha	0.00e+00	9.60e-24	1.28e-25	0.8392
1. PBF	Q9TKI7	ATP synthase subunit beta, chloroplastic	0.00e+00	2.96e-68	0.0	0.9684
1. PBF	Q2FF24	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9819
1. PBF	P07890	ATP synthase subunit beta	0.00e+00	3.70e-76	0.0	0.9645
1. PBF	Q5QZI6	ATP synthase subunit beta	0.00e+00	8.72e-70	0.0	0.9774
1. PBF	B5ER44	ATP synthase subunit alpha	0.00e+00	1.25e-24	9.19e-25	0.8411
1. PBF	P0C2Z5	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.42e-25	1.01e-20	0.8555
1. PBF	A8Z6C7	ATP synthase subunit beta	0.00e+00	3.52e-63	0.0	0.959
1. PBF	Q1RKD7	ATP synthase subunit beta	0.00e+00	1.06e-68	0.0	0.9697
1. PBF	Q03LX5	ATP synthase subunit alpha	0.00e+00	1.91e-27	7.95e-20	0.8656
1. PBF	Q6MAJ6	V-type ATP synthase beta chain	0.00e+00	9.50e-23	1.91e-15	0.8329
1. PBF	A1V8T3	ATP synthase subunit alpha 1	0.00e+00	1.59e-27	3.04e-24	0.8324
1. PBF	B0U5A0	ATP synthase subunit alpha	0.00e+00	2.00e-24	2.70e-22	0.8418
1. PBF	Q50331	ATP synthase subunit beta	0.00e+00	1.29e-75	0.0	0.9866
1. PBF	Q85V35	ATP synthase subunit beta, chloroplastic	0.00e+00	5.14e-68	0.0	0.9686
1. PBF	B0RWC4	ATP synthase subunit alpha	0.00e+00	7.68e-24	1.52e-23	0.837
1. PBF	P42466	ATP synthase subunit beta	0.00e+00	7.36e-68	0.0	0.9682
1. PBF	A7ZC37	ATP synthase subunit beta	0.00e+00	4.47e-75	0.0	0.9728
1. PBF	A8F004	ATP synthase subunit beta	0.00e+00	2.07e-69	0.0	0.9688
1. PBF	B1Y3S9	ATP synthase subunit alpha	0.00e+00	2.18e-23	1.42e-24	0.8418
1. PBF	Q0AEJ6	ATP synthase subunit beta 2	0.00e+00	5.91e-58	1.38e-166	0.9325
1. PBF	A0LLF8	ATP synthase subunit beta	0.00e+00	1.03e-65	0.0	0.9787
1. PBF	B4EEY7	ATP synthase subunit alpha	0.00e+00	7.64e-26	4.80e-24	0.831
1. PBF	A5N3H7	ATP synthase subunit beta	0.00e+00	5.54e-72	0.0	0.9833
1. PBF	Q12HP9	ATP synthase subunit alpha	0.00e+00	6.12e-25	6.94e-26	0.8373
1. PBF	Q9BBU0	ATP synthase subunit beta, chloroplastic	0.00e+00	2.59e-66	0.0	0.9737
1. PBF	C1CSC8	ATP synthase subunit beta	0.00e+00	1.92e-71	0.0	0.9782
1. PBF	Q3BP13	ATP synthase subunit alpha	0.00e+00	2.41e-23	9.93e-24	0.8369
1. PBF	A2BT12	ATP synthase subunit beta	0.00e+00	1.07e-70	0.0	0.9724
1. PBF	B1LL59	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9905
1. PBF	Q9TMQ4	ATP synthase subunit beta, chloroplastic	0.00e+00	1.11e-66	0.0	0.9684
1. PBF	Q09FV4	ATP synthase subunit beta, chloroplastic	0.00e+00	1.97e-66	0.0	0.9601
1. PBF	Q4G3C8	ATP synthase subunit beta, chloroplastic	0.00e+00	5.17e-74	0.0	0.9717
1. PBF	P62626	ATP synthase subunit beta, chloroplastic	0.00e+00	2.08e-66	0.0	0.9586
1. PBF	Q8MBG3	ATP synthase subunit beta, plastid	0.00e+00	3.28e-70	0.0	0.9569
1. PBF	B9K7T9	ATP synthase subunit alpha	0.00e+00	1.14e-29	9.84e-23	0.8557
1. PBF	Q6ENW6	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.76e-25	1.27e-20	0.8524
1. PBF	A9VSA3	ATP synthase subunit beta	0.00e+00	1.25e-77	0.0	0.9739
1. PBF	P74857	SPI-2 type 3 secretion system ATPase	0.00e+00	7.03e-33	3.22e-35	0.8991
1. PBF	Q663Q8	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9883
1. PBF	Q03235	ATP synthase subunit beta	0.00e+00	1.15e-73	0.0	0.9777
1. PBF	A6BM09	ATP synthase subunit beta, chloroplastic	0.00e+00	3.72e-67	0.0	0.9525
1. PBF	B2HQK2	ATP synthase subunit beta	0.00e+00	2.41e-71	0.0	0.9673
1. PBF	A8ZNR6	ATP synthase subunit beta	0.00e+00	4.44e-45	6.09e-157	0.9856
1. PBF	Q09MH1	ATP synthase subunit beta, chloroplastic	0.00e+00	3.06e-65	0.0	0.9768
1. PBF	B8I579	ATP synthase subunit beta	0.00e+00	6.42e-70	0.0	0.9912
1. PBF	A6LJR3	ATP synthase subunit alpha	0.00e+00	9.19e-28	1.84e-21	0.8587
1. PBF	Q4PLI6	ATP synthase subunit beta, chloroplastic	0.00e+00	7.50e-64	0.0	0.977
1. PBF	Q33C27	ATP synthase subunit beta, chloroplastic	0.00e+00	7.58e-67	0.0	0.9631
1. PBF	P0ABB6	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9834
1. PBF	Q07VU4	ATP synthase subunit beta 1	0.00e+00	5.58e-68	0.0	0.9831
1. PBF	B6EHT9	ATP synthase subunit alpha	0.00e+00	9.46e-26	7.80e-28	0.8431
1. PBF	Q8DLG8	ATP synthase subunit beta	0.00e+00	7.72e-74	0.0	0.9675
1. PBF	C3KYJ3	ATP synthase subunit beta	0.00e+00	1.41e-73	0.0	0.9898
1. PBF	Q3HKH4	ATP synthase subunit beta 2	0.00e+00	3.18e-57	1.92e-151	0.9706
1. PBF	A7NIR1	ATP synthase subunit alpha	0.00e+00	1.11e-25	9.47e-22	0.8418
1. PBF	Q9KNH5	ATP synthase subunit beta	0.00e+00	1.06e-63	0.0	0.9638
1. PBF	A9KX06	ATP synthase subunit beta	0.00e+00	1.28e-67	0.0	0.976
1. PBF	B0JFM7	ATP synthase subunit beta	0.00e+00	6.04e-73	0.0	0.9701
1. PBF	P28250	ATP synthase subunit beta, chloroplastic	0.00e+00	6.41e-68	0.0	0.9643
1. PBF	B1JRN2	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.9797
1. PBF	P0A1C1	Type 3 secretion system ATPase	0.00e+00	7.91e-37	2.21e-33	0.8801
1. PBF	Q1J7F9	ATP synthase subunit beta	0.00e+00	7.29e-74	0.0	0.9784
1. PBF	A1SBU0	ATP synthase subunit beta	0.00e+00	4.15e-69	0.0	0.9842
1. PBF	Q85FQ8	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.37e-28	9.18e-24	0.8631
1. PBF	Q07UZ5	ATP synthase subunit beta	0.00e+00	2.64e-73	0.0	0.9662
1. PBF	Q0QEP2	ATP synthase subunit beta, mitochondrial (Fragment)	0.00e+00	4.50e-10	5.17e-179	0.9741
1. PBF	B4U2E1	ATP synthase subunit beta	0.00e+00	7.09e-74	0.0	0.9784
1. PBF	Q1AVH7	ATP synthase subunit alpha	0.00e+00	3.51e-23	5.34e-20	0.8675
1. PBF	A6WUJ2	ATP synthase subunit alpha	0.00e+00	2.81e-23	1.83e-25	0.8346
1. PBF	A7NIQ9	ATP synthase subunit beta	0.00e+00	1.73e-65	0.0	0.976
1. PBF	A4GG90	ATP synthase subunit beta, chloroplastic	0.00e+00	8.22e-67	0.0	0.9671
1. PBF	Q9BA84	ATP synthase subunit beta, chloroplastic	0.00e+00	1.19e-68	0.0	0.965
1. PBF	Q11DD5	ATP synthase subunit beta	0.00e+00	7.29e-39	0.0	0.9573
1. PBF	A1VFJ5	ATP synthase subunit beta	0.00e+00	1.27e-70	0.0	0.9814
1. PBF	A8FJR2	ATP synthase subunit beta	0.00e+00	6.15e-75	0.0	0.9754
1. PBF	B6JD09	ATP synthase subunit beta	0.00e+00	6.03e-72	0.0	0.9674
1. PBF	Q8EM81	ATP synthase subunit alpha	0.00e+00	1.11e-26	1.79e-23	0.8548
1. PBF	B0VBP5	ATP synthase subunit alpha	0.00e+00	2.26e-23	1.06e-22	0.8329
1. PBF	Q8Y4C1	ATP synthase subunit beta 2	0.00e+00	1.15e-75	0.0	0.9712
1. PBF	Q8MBM4	ATP synthase subunit beta, chloroplastic	0.00e+00	2.99e-67	0.0	0.9714
1. PBF	P07137	ATP synthase subunit beta, chloroplastic	0.00e+00	6.29e-69	0.0	0.9733
1. PBF	Q9MU80	ATP synthase subunit beta, chloroplastic	0.00e+00	1.37e-68	0.0	0.9648
1. PBF	Q1GEU8	ATP synthase subunit beta	0.00e+00	1.16e-70	0.0	0.9727
1. PBF	A8F3K2	ATP synthase subunit beta	0.00e+00	3.52e-72	0.0	0.989
1. PBF	C1CF93	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	0.9777
1. PBF	A5FZ54	ATP synthase subunit beta	0.00e+00	1.69e-74	0.0	0.9665
1. PBF	A6T472	ATP synthase subunit alpha	0.00e+00	8.53e-25	7.07e-24	0.8398
1. PBF	A6MM21	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.68e-24	5.16e-19	0.8572
1. PBF	Q4L7Y4	ATP synthase subunit beta	0.00e+00	9.93e-76	0.0	0.9741
1. PBF	Q8S8W8	ATP synthase subunit beta, chloroplastic	0.00e+00	1.67e-64	0.0	0.9713
1. PBF	A3P0Z2	ATP synthase subunit alpha 1	0.00e+00	2.09e-27	4.10e-24	0.8297
1. PBF	B1YQL2	ATP synthase subunit alpha	0.00e+00	2.57e-26	1.67e-24	0.8298
1. PBF	A1WF56	ATP synthase subunit alpha	0.00e+00	2.54e-21	2.15e-24	0.8338
1. PBF	B0BVB6	ATP synthase subunit beta	0.00e+00	1.23e-70	0.0	0.9685
1. PBF	Q5NQY9	ATP synthase subunit beta	0.00e+00	1.30e-72	0.0	0.9655
1. PBF	B3PIS9	ATP synthase subunit alpha	0.00e+00	4.64e-26	3.33e-23	0.8389
1. PBF	B9MBA1	ATP synthase subunit alpha	0.00e+00	4.45e-23	1.13e-22	0.8345
1. PBF	A7GV56	ATP synthase subunit beta	0.00e+00	1.13e-70	0.0	0.9816
1. PBF	Q38WK3	ATP synthase subunit alpha	0.00e+00	2.83e-25	9.05e-21	0.8472
1. PBF	Q8MBM3	ATP synthase subunit beta, chloroplastic	0.00e+00	9.42e-68	0.0	0.9706
1. PBF	Q7VJ21	ATP synthase subunit beta	0.00e+00	4.59e-70	0.0	0.9744
1. PBF	O50550	ATP synthase subunit beta	0.00e+00	6.06e-76	0.0	0.9899
1. PBF	A8ZUA1	ATP synthase subunit beta	0.00e+00	3.32e-73	0.0	0.9786
1. PBF	P42469	ATP synthase subunit beta	0.00e+00	4.42e-72	0.0	0.9696
1. PBF	B4TAX2	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9811
1. PBF	Q2JX57	ATP synthase subunit beta	0.00e+00	5.09e-76	0.0	0.9658
1. PBF	P32978	ATP synthase subunit beta, chloroplastic	0.00e+00	1.19e-71	0.0	0.9619
1. PBF	Q5ZLC5	ATP synthase subunit beta, mitochondrial	0.00e+00	1.67e-20	0.0	0.9581
1. PBF	B7IG44	ATP synthase subunit beta	0.00e+00	2.14e-78	0.0	0.9834
1. PBF	A4QJU0	ATP synthase subunit beta, chloroplastic	0.00e+00	7.42e-71	0.0	0.9641
1. PBF	A9NGW2	ATP synthase subunit beta	0.00e+00	4.90e-69	0.0	0.9863
1. PBF	Q3BAN5	ATP synthase subunit beta, chloroplastic	0.00e+00	1.38e-66	0.0	0.9671
1. PBF	Q48AW0	ATP synthase subunit beta	0.00e+00	2.81e-66	0.0	0.9771
1. PBF	A9WGS6	ATP synthase subunit alpha	0.00e+00	1.29e-22	2.83e-18	0.8403
1. PBF	A1SS55	ATP synthase subunit beta 1	0.00e+00	1.80e-55	8.50e-153	0.9465
1. PBF	Q1MAZ2	ATP synthase subunit beta	0.00e+00	1.68e-72	0.0	0.9665
1. PBF	Q5Z0Y1	ATP synthase subunit beta	0.00e+00	9.22e-72	0.0	0.9629
1. PBF	P05038	ATP synthase subunit beta	0.00e+00	7.38e-70	0.0	0.9752
1. PBF	P25075	ATP synthase subunit beta	0.00e+00	1.12e-55	0.0	0.9593
1. PBF	Q2ST34	ATP synthase subunit beta	0.00e+00	5.21e-98	0.0	0.9856
1. PBF	B1HM56	ATP synthase subunit beta	0.00e+00	5.73e-77	0.0	0.9731
1. PBF	P06541	ATP synthase subunit beta, chloroplastic	0.00e+00	1.19e-74	0.0	0.9667
1. PBF	Q46J68	ATP synthase subunit beta	0.00e+00	5.03e-69	0.0	0.9619
1. PBF	Q9MU43	ATP synthase subunit beta, chloroplastic	0.00e+00	1.50e-67	0.0	0.9695
1. PBF	A0QCX8	ATP synthase subunit beta	0.00e+00	2.04e-70	0.0	0.9613
1. PBF	B0Z4U4	ATP synthase subunit beta, chloroplastic	0.00e+00	3.07e-67	0.0	0.9682
1. PBF	Q8UC76	ATP synthase subunit beta	0.00e+00	1.89e-72	0.0	0.9503
1. PBF	Q3JXV6	ATP synthase subunit alpha 1	0.00e+00	2.09e-27	4.10e-24	0.8306
1. PBF	Q87KA8	ATP synthase subunit beta	0.00e+00	1.12e-63	0.0	0.9675
1. PBF	Q2PQH4	ATP synthase subunit beta, chloroplastic	0.00e+00	1.23e-74	0.0	0.9729
1. PBF	Q9MS49	ATP synthase subunit beta, chloroplastic	0.00e+00	2.13e-69	0.0	0.9679
1. PBF	Q7W3A8	ATP synthase subunit alpha	0.00e+00	4.16e-25	1.46e-23	0.831
1. PBF	Q8XU76	ATP synthase subunit beta	0.00e+00	8.29e-65	0.0	0.9649
1. PBF	Q04ZU5	ATP synthase subunit beta	0.00e+00	3.88e-74	0.0	0.9802
1. PBF	Q3JJN9	ATP synthase subunit beta 2	0.00e+00	1.11e-37	5.76e-163	0.9709
1. PBF	P12698	ATP synthase subunit beta	0.00e+00	1.13e-74	0.0	0.9702
1. PBF	A9MJR9	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.982
1. PBF	Q8CNJ7	ATP synthase subunit beta	0.00e+00	2.67e-74	0.0	0.9758
1. PBF	Q9PK86	V-type ATP synthase beta chain	0.00e+00	1.14e-19	1.27e-15	0.821
1. PBF	Q0BJL7	ATP synthase subunit alpha	0.00e+00	2.57e-26	1.67e-24	0.831
1. PBF	Q8XID2	ATP synthase subunit alpha	0.00e+00	1.91e-27	1.26e-26	0.8632
1. PBF	Q6L3A1	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.03e-25	6.81e-21	0.8538
1. PBF	B1NWF7	ATP synthase subunit beta, chloroplastic	0.00e+00	3.82e-67	0.0	0.9655
1. PBF	A1TD55	ATP synthase subunit beta	0.00e+00	7.81e-73	0.0	0.9736
1. PBF	A3DAR4	ATP synthase subunit beta	0.00e+00	1.28e-67	0.0	0.9738
1. PBF	Q5M5J1	ATP synthase subunit beta	0.00e+00	2.58e-72	0.0	0.9795
1. PBF	Q1CSD5	ATP synthase subunit beta	0.00e+00	5.14e-68	0.0	0.9763
1. PBF	A1UR49	ATP synthase subunit beta	0.00e+00	4.09e-28	0.0	0.9542
1. PBF	A1EA15	ATP synthase subunit beta, chloroplastic	0.00e+00	6.33e-65	0.0	0.9596
1. PBF	Q0SGP9	ATP synthase subunit beta	0.00e+00	2.03e-71	0.0	0.9701
1. PBF	Q2J3I4	ATP synthase subunit beta	0.00e+00	1.06e-71	0.0	0.9705
1. PBF	B4RS81	ATP synthase subunit beta	0.00e+00	3.99e-70	0.0	0.9791
1. PBF	B7KGV4	ATP synthase subunit beta	0.00e+00	8.18e-74	0.0	0.9725
1. PBF	B7NF48	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9816
1. PBF	B3R7L5	ATP synthase subunit beta	0.00e+00	3.14e-69	0.0	0.9644
1. PBF	A4QLB3	ATP synthase subunit beta, chloroplastic	0.00e+00	2.33e-65	0.0	0.9649
1. PBF	A3DIM9	ATP synthase subunit beta	0.00e+00	3.08e-74	0.0	0.9929
1. PBF	P0ABB7	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9843
1. PBF	A1K1S0	ATP synthase subunit alpha	0.00e+00	1.80e-24	3.87e-25	0.8417
1. PBF	Q2N8Z2	ATP synthase subunit beta	0.00e+00	1.12e-71	0.0	0.9663
1. PBF	P05440	ATP synthase subunit beta	0.00e+00	7.38e-70	0.0	0.9588
1. PBF	Q9MUT5	ATP synthase subunit beta, chloroplastic	0.00e+00	4.35e-75	0.0	0.9688
1. PBF	B5YXD6	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9806
1. PBF	Q6FYM3	ATP synthase subunit beta	0.00e+00	2.71e-29	0.0	0.9569
1. PBF	A9GHR6	ATP synthase subunit alpha	6.66e-16	1.23e-08	6.02e-19	0.8399
1. PBF	A8YY70	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9782
1. PBF	P13356	ATP synthase subunit beta	0.00e+00	7.41e-60	0.0	0.9485
1. PBF	Q2G5N5	ATP synthase subunit beta	0.00e+00	8.71e-72	0.0	0.9619
1. PBF	Q1JCL3	ATP synthase subunit beta	0.00e+00	6.14e-74	0.0	0.9779
1. PBF	Q92LK8	ATP synthase subunit beta	0.00e+00	5.02e-55	0.0	0.9645
1. PBF	Q2YCA5	ATP synthase subunit alpha 1	0.00e+00	9.94e-24	1.07e-27	0.8307
1. PBF	Q13SQ0	ATP synthase subunit alpha 2	0.00e+00	5.00e-27	1.66e-25	0.8314
1. PBF	B9L7Y7	ATP synthase subunit beta	0.00e+00	4.60e-71	0.0	0.9739
1. PBF	O84309	V-type ATP synthase beta chain	0.00e+00	2.24e-20	8.72e-17	0.8203
1. PBF	C1AMV4	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	0.9672
1. PBF	A1T0Z1	ATP synthase subunit alpha 2	0.00e+00	1.79e-25	8.17e-27	0.8405
1. PBF	Q822J9	V-type ATP synthase beta chain	0.00e+00	7.65e-18	1.01e-13	0.8222
1. PBF	A8AYG1	ATP synthase subunit beta	0.00e+00	1.01e-72	0.0	0.9785
1. PBF	Q162S9	ATP synthase subunit beta	0.00e+00	5.93e-71	0.0	0.973
1. PBF	Q92FG8	ATP synthase subunit beta 1	0.00e+00	1.49e-73	5.51e-172	0.9851
1. PBF	Q39ZU1	ATP synthase subunit beta 3	0.00e+00	3.92e-76	0.0	0.9818
1. PBF	Q6F202	ATP synthase subunit beta	0.00e+00	1.21e-79	0.0	0.9736
1. PBF	B4F0E7	ATP synthase subunit beta	0.00e+00	5.58e-68	0.0	0.9821
1. PBF	Q887B5	Type 3 secretion system ATPase	0.00e+00	5.11e-35	5.41e-29	0.8619
1. PBF	O67531	Flagellum-specific ATP synthase	0.00e+00	3.97e-36	3.28e-41	0.8646
1. PBF	Q7HDI4	ATP synthase subunit beta, chloroplastic	0.00e+00	2.65e-68	0.0	0.9682
1. PBF	Q0SQZ3	ATP synthase subunit alpha	0.00e+00	1.08e-27	1.20e-26	0.8637
1. PBF	A6U3I8	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9814
1. PBF	Q9Z687	ATP synthase subunit beta	0.00e+00	3.42e-73	0.0	0.9843
1. PBF	Q09G39	ATP synthase subunit beta, chloroplastic	0.00e+00	3.82e-67	0.0	0.9691
1. PBF	Q07232	ATP synthase subunit beta	0.00e+00	2.51e-69	0.0	0.9679
1. PBF	B7L882	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.982
1. PBF	A6VWP9	ATP synthase subunit beta 1	0.00e+00	1.25e-56	1.52e-165	0.9695
1. PBF	A6MMV1	ATP synthase subunit beta, chloroplastic	0.00e+00	5.28e-70	0.0	0.9663
1. PBF	Q6NDD2	ATP synthase subunit beta	0.00e+00	2.04e-73	0.0	0.9711
1. PBF	Q329S1	ATP synthase subunit beta	0.00e+00	1.06e-65	0.0	0.9833
1. PBF	P0A1C2	Type 3 secretion system ATPase	0.00e+00	7.91e-37	2.21e-33	0.8796
1. PBF	Q95AD7	ATP synthase subunit beta, chloroplastic	0.00e+00	1.06e-68	0.0	0.971
1. PBF	Q95DR6	ATP synthase subunit beta, chloroplastic	0.00e+00	4.63e-67	0.0	0.971
1. PBF	Q3AHM2	ATP synthase subunit beta	0.00e+00	1.98e-70	0.0	0.9628
1. PBF	Q85V57	ATP synthase subunit beta, chloroplastic	0.00e+00	6.07e-68	0.0	0.9728
1. PBF	B2IUL2	ATP synthase subunit beta	0.00e+00	4.99e-70	0.0	0.9696
1. PBF	A8EV70	ATP synthase subunit beta	0.00e+00	1.26e-68	0.0	0.9703
1. PBF	B9L1H1	ATP synthase subunit alpha	0.00e+00	2.09e-27	5.44e-21	0.8562
1. PBF	Q85FT2	ATP synthase subunit beta, chloroplastic	0.00e+00	2.04e-70	0.0	0.9753
1. PBF	Q9ZK81	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	0.9765
1. PBF	Q12HQ1	ATP synthase subunit beta	0.00e+00	2.58e-69	0.0	0.9753
1. PBF	Q31KS4	ATP synthase subunit beta	0.00e+00	3.70e-76	0.0	0.9642
1. PBF	A4XKX0	ATP synthase subunit beta	0.00e+00	6.29e-69	0.0	0.9932
1. PBF	Q85V45	ATP synthase subunit beta, chloroplastic	0.00e+00	3.69e-68	0.0	0.9678
1. PBF	Q6LLG8	ATP synthase subunit beta 1	0.00e+00	2.89e-69	0.0	0.9671
1. PBF	P0A300	ATP synthase subunit beta	0.00e+00	1.64e-74	0.0	0.9601
1. PBF	A6UDM1	ATP synthase subunit beta	0.00e+00	2.34e-47	0.0	0.9605
1. PBF	Q25117	ATP synthase subunit beta, mitochondrial	0.00e+00	5.78e-27	0.0	0.9705
1. PBF	Q46VX8	ATP synthase subunit alpha	0.00e+00	9.98e-25	1.34e-22	0.8455
1. PBF	Q6AQ10	ATP synthase subunit beta	0.00e+00	1.63e-75	0.0	0.9699
1. PBF	B3H2P5	ATP synthase subunit alpha	0.00e+00	2.77e-23	7.99e-26	0.8352
1. PBF	A4QJK6	ATP synthase subunit beta, chloroplastic	0.00e+00	8.10e-66	0.0	0.9624
1. PBF	B2VCA6	ATP synthase subunit alpha	0.00e+00	5.01e-23	6.09e-23	0.8424
1. PBF	Q24MP1	ATP synthase subunit beta	0.00e+00	5.17e-75	0.0	0.9755
1. PBF	Q2MII0	ATP synthase subunit beta, chloroplastic	0.00e+00	3.43e-63	0.0	0.9774
1. PBF	P0A1B9	SPI-1 type 3 secretion system ATPase	0.00e+00	1.85e-35	1.95e-36	0.8836
1. PBF	Q8MBF7	ATP synthase subunit beta, chloroplastic	0.00e+00	1.22e-68	0.0	0.9656
1. PBF	Q9BA85	ATP synthase subunit beta, chloroplastic	0.00e+00	9.43e-67	0.0	0.9684
1. PBF	Q318V4	ATP synthase subunit beta	0.00e+00	3.05e-72	0.0	0.9692
1. PBF	Q0HD79	ATP synthase subunit beta	0.00e+00	2.14e-66	0.0	0.9749
1. PBF	P49647	ATP synthase subunit beta, chloroplastic	0.00e+00	1.88e-77	0.0	0.9721
1. PBF	Q1ACK1	ATP synthase subunit beta, chloroplastic	0.00e+00	1.98e-71	0.0	0.9685
1. PBF	B2VCA4	ATP synthase subunit beta	0.00e+00	1.68e-65	0.0	0.9844
1. PBF	P0ABB5	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	0.9821
1. PBF	Q04S16	ATP synthase subunit alpha	0.00e+00	1.64e-26	1.95e-24	0.86
1. PBF	C0Z778	ATP synthase subunit alpha	0.00e+00	9.19e-28	2.61e-26	0.8673
1. PBF	Q2J6N3	ATP synthase subunit beta	0.00e+00	8.02e-70	0.0	0.9576
1. PBF	Q2STE7	ATP synthase subunit alpha 1	0.00e+00	1.40e-27	3.91e-24	0.8309
1. PBF	Q9MRR1	ATP synthase subunit beta, chloroplastic	0.00e+00	4.60e-68	0.0	0.9681
1. PBF	Q2K3H0	ATP synthase subunit beta	0.00e+00	3.10e-70	0.0	0.9648
1. PBF	Q04ZU3	ATP synthase subunit alpha	0.00e+00	1.64e-26	1.95e-24	0.8481
1. PBF	Q1KVT0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.55e-72	0.0	0.9648
1. PBF	B0THN2	ATP synthase subunit beta	0.00e+00	8.88e-77	0.0	0.9697
1. PBF	Q5ZWN7	ATP synthase subunit alpha 1	0.00e+00	5.78e-27	6.54e-21	0.8484
1. PBF	A6MM43	ATP synthase subunit beta, chloroplastic	0.00e+00	6.46e-69	0.0	0.9684
1. PBF	A1KI98	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	0.9521
1. PBF	A4QLH9	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.21e-25	6.36e-19	0.8566
1. PBF	B2I862	ATP synthase subunit alpha	0.00e+00	9.15e-25	8.82e-25	0.834
1. PBF	P49376	ATP synthase subunit beta, mitochondrial	0.00e+00	1.85e-38	0.0	0.9775
1. PBF	B5FCZ1	ATP synthase subunit beta	0.00e+00	1.88e-65	0.0	0.9733
1. PBF	B0Z4L0	ATP synthase subunit beta, chloroplastic	0.00e+00	3.52e-67	0.0	0.9688
1. PBF	P95789	ATP synthase subunit beta	0.00e+00	4.29e-73	0.0	0.978
1. PBF	A1W2T5	ATP synthase subunit alpha	0.00e+00	4.45e-23	1.13e-22	0.8404
1. PBF	A0ZZ42	ATP synthase subunit beta, chloroplastic	0.00e+00	1.04e-68	0.0	0.9611
1. PBF	A0ALL3	ATP synthase subunit beta 2	0.00e+00	3.29e-76	0.0	0.9701
1. PBF	B7HFK1	ATP synthase subunit beta	0.00e+00	1.63e-77	0.0	0.9779
1. PBF	Q15MU4	ATP synthase subunit beta 2	0.00e+00	9.80e-69	0.0	0.9761
1. PBF	Q74K15	ATP synthase subunit beta	0.00e+00	6.92e-64	0.0	0.9815
1. PBF	A3PES6	ATP synthase subunit beta	0.00e+00	8.23e-72	0.0	0.9706
1. PBF	Q6MGM7	ATP synthase subunit beta	0.00e+00	9.17e-74	0.0	0.9806
1. PBF	Q9JW72	ATP synthase subunit alpha	0.00e+00	2.37e-25	1.91e-21	0.8418
1. PBF	A2C4I4	ATP synthase subunit beta	0.00e+00	1.16e-68	0.0	0.9633
1. PBF	Q85V31	ATP synthase subunit beta, chloroplastic	0.00e+00	4.48e-68	0.0	0.9675
1. PBF	Q9BA92	ATP synthase subunit beta, chloroplastic	0.00e+00	8.53e-69	0.0	0.967
1. PBF	A1K1S2	ATP synthase subunit beta	0.00e+00	1.01e-68	0.0	0.9757
1. PBF	P29707	ATP synthase subunit beta, sodium ion specific	0.00e+00	1.38e-70	0.0	0.981
1. PBF	Q477Z1	ATP synthase subunit beta	0.00e+00	4.58e-66	0.0	0.9648
1. PBF	P29685	ATP synthase subunit beta, mitochondrial	0.00e+00	7.68e-16	0.0	0.9591
1. PBF	Q13IW3	ATP synthase subunit beta 3	0.00e+00	1.97e-60	1.58e-158	0.9738
1. PBF	Q72XE8	ATP synthase subunit beta	0.00e+00	1.49e-77	0.0	0.9774
1. PBF	Q1CCH5	ATP synthase subunit beta	0.00e+00	4.76e-67	0.0	0.978
1. PBF	C5BKJ5	ATP synthase subunit beta	0.00e+00	9.68e-63	0.0	0.9656
1. PBF	A4STP5	ATP synthase subunit alpha	0.00e+00	1.53e-25	5.89e-24	0.8409
1. PBF	B1LBB9	ATP synthase subunit beta	0.00e+00	6.06e-76	0.0	0.9895
1. PBF	B8EDV0	ATP synthase subunit beta	0.00e+00	1.28e-67	0.0	0.9766
1. PBF	P50003	ATP synthase subunit beta	0.00e+00	2.67e-74	0.0	0.9696
1. PBF	P41009	ATP synthase subunit beta	0.00e+00	2.36e-73	0.0	0.9704
1. PBF	Q49Z50	ATP synthase subunit beta	0.00e+00	1.58e-75	0.0	0.9805
1. PBF	B0BRX2	ATP synthase subunit beta	0.00e+00	2.63e-63	0.0	0.986
1. PBF	Q8DDG8	ATP synthase subunit beta	0.00e+00	3.14e-65	0.0	0.9649
1. PBF	Q2RFX9	ATP synthase subunit beta	0.00e+00	1.85e-68	0.0	0.9903
1. PBF	A9AJG2	ATP synthase subunit alpha	0.00e+00	1.97e-26	6.64e-24	0.8323
1. PBF	Q03QY8	ATP synthase subunit beta	0.00e+00	6.11e-69	0.0	0.9848
1. PBF	Q62FR7	ATP synthase subunit alpha 1	0.00e+00	1.59e-27	3.04e-24	0.8296
1. PBF	Q8F2J5	ATP synthase subunit beta	0.00e+00	5.39e-73	0.0	0.9803
1. PBF	A7X4U3	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9817
1. PBF	Q8YJ35	ATP synthase subunit beta	0.00e+00	1.48e-27	0.0	0.9625
1. PBF	B8DRD2	ATP synthase subunit beta	0.00e+00	4.29e-72	0.0	0.9772
1. PBF	A9BFX3	ATP synthase subunit beta	0.00e+00	1.50e-78	0.0	0.9886
1. PBF	Q1GXN0	ATP synthase subunit beta	0.00e+00	1.04e-70	0.0	0.9763
1. PBF	A5U209	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	0.9602
1. PBF	Q30QQ1	ATP synthase subunit beta	0.00e+00	2.38e-74	0.0	0.9722
1. PBF	Q8DP44	ATP synthase subunit beta	0.00e+00	8.54e-71	0.0	0.9783
1. PBF	Q85X24	ATP synthase subunit beta, chloroplastic	0.00e+00	1.72e-64	0.0	0.966
1. PBF	Q03A20	ATP synthase subunit alpha	0.00e+00	8.30e-27	2.22e-18	0.863
1. PBF	Q04BA3	ATP synthase subunit beta	0.00e+00	1.12e-65	0.0	0.9809
1. PBF	Q1WUC6	ATP synthase subunit beta	0.00e+00	5.86e-72	0.0	0.9809
1. PBF	A4QLU0	ATP synthase subunit beta, chloroplastic	0.00e+00	3.99e-70	0.0	0.9633
1. PBF	O78491	ATP synthase subunit beta, chloroplastic	0.00e+00	3.72e-72	0.0	0.971
1. PBF	A4GYR7	ATP synthase subunit beta, chloroplastic	0.00e+00	1.38e-67	0.0	0.9676
1. PBF	Q5HX59	ATP synthase subunit beta	0.00e+00	6.15e-75	0.0	0.9769
1. PBF	B4SYD3	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	0.8407
1. PBF	Q85V26	ATP synthase subunit beta, chloroplastic	0.00e+00	2.73e-66	0.0	0.9678
1. PBF	A7HIX7	ATP synthase subunit beta	0.00e+00	6.46e-69	0.0	0.9681
1. PBF	Q6ENH7	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.42e-25	1.01e-20	0.8543
1. PBF	Q4JUK0	ATP synthase subunit beta	0.00e+00	5.02e-75	0.0	0.9678
1. PBF	A7I177	ATP synthase subunit beta	0.00e+00	8.62e-77	0.0	0.9764
1. PBF	Q5FRC5	ATP synthase subunit beta 1	0.00e+00	1.06e-73	0.0	0.9629
1. PBF	B8F774	ATP synthase subunit beta	0.00e+00	2.86e-64	0.0	0.9793
1. PBF	A4T8K2	ATP synthase subunit beta	0.00e+00	3.36e-74	0.0	0.9752
1. PBF	Q7NHG7	ATP synthase subunit beta	0.00e+00	1.02e-77	0.0	0.9712
1. PBF	A5IUP8	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	0.9817
1. PBF	A1BCJ2	ATP synthase subunit beta	0.00e+00	8.00e-72	0.0	0.9856
1. PBF	B1ICS9	ATP synthase subunit beta	0.00e+00	8.54e-71	0.0	0.9782
1. PBF	Q67TB7	ATP synthase subunit beta	0.00e+00	5.45e-71	0.0	0.9803
1. PBF	A8G6T8	ATP synthase subunit beta	0.00e+00	4.11e-71	0.0	0.9717
1. PBF	Q48AW2	ATP synthase subunit alpha	0.00e+00	1.03e-24	7.83e-22	0.8365
1. PBF	B4TN31	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.982
1. PBF	A6Q4C0	ATP synthase subunit beta	0.00e+00	3.14e-73	0.0	0.9739
1. PBF	B3EJK9	ATP synthase subunit beta	0.00e+00	3.33e-72	0.0	0.9874
1. PBF	A0AFR1	ATP synthase subunit beta 1	0.00e+00	2.85e-71	1.76e-169	0.9862
1. PBF	A0LSL6	ATP synthase subunit beta	0.00e+00	5.58e-68	0.0	0.9554
1. PBF	A7N0Y1	ATP synthase subunit beta 1	0.00e+00	1.86e-64	0.0	0.968
1. PBF	Q9CKW1	ATP synthase subunit beta	0.00e+00	6.56e-61	0.0	0.9774
1. PBF	A8A6J5	ATP synthase subunit beta	0.00e+00	3.69e-66	0.0	0.9824
1. PBF	Q06GZ0	ATP synthase subunit beta, chloroplastic	0.00e+00	1.02e-66	0.0	0.9724
1. PBF	Q21DK6	ATP synthase subunit alpha	0.00e+00	1.42e-25	4.45e-23	0.8384
1. PBF	A5CDA5	ATP synthase subunit beta	0.00e+00	3.23e-69	0.0	0.963
1. PBF	Q1CX36	ATP synthase subunit beta	0.00e+00	7.35e-72	0.0	0.9708
1. PBF	Q03V29	ATP synthase subunit beta	0.00e+00	3.28e-70	0.0	0.9789
1. PBF	A4SUT2	ATP synthase subunit alpha	0.00e+00	9.97e-26	6.40e-22	0.842
1. PBF	B9MS68	ATP synthase subunit beta	0.00e+00	6.24e-70	0.0	0.9911
1. PBF	Q6G1W9	ATP synthase subunit beta	0.00e+00	3.88e-30	0.0	0.9649
1. PBF	Q1GQS5	ATP synthase subunit beta	0.00e+00	2.98e-44	0.0	0.9644
1. PBF	Q95AF8	ATP synthase subunit beta, chloroplastic	0.00e+00	3.45e-64	0.0	0.9682
1. PBF	Q7VA76	ATP synthase subunit beta	0.00e+00	3.19e-70	0.0	0.9653
1. PBF	Q042L5	ATP synthase subunit beta	0.00e+00	3.27e-64	0.0	0.9855
1. PBF	P0C2Z8	ATP synthase subunit beta, chloroplastic	0.00e+00	2.33e-65	0.0	0.9579
1. PBF	A9M837	ATP synthase subunit beta	0.00e+00	1.48e-27	0.0	0.9561
1. PBF	A1TJ39	ATP synthase subunit alpha	0.00e+00	2.37e-23	3.33e-23	0.8339
1. PBF	C0Q2N2	ATP synthase subunit beta	0.00e+00	3.31e-66	0.0	0.9893
1. PBF	Q85V29	ATP synthase subunit beta, chloroplastic	0.00e+00	2.02e-66	0.0	0.9698
1. PBF	Q7VPP0	ATP synthase subunit beta	0.00e+00	1.03e-63	0.0	0.9862
1. PBF	Q67TB9	ATP synthase subunit alpha	0.00e+00	9.53e-28	6.58e-29	0.8574
1. PBF	Q9MU82	ATP synthase subunit beta, chloroplastic	0.00e+00	2.03e-67	0.0	0.9612
1. PBF	A7HJV9	ATP synthase subunit alpha	0.00e+00	4.49e-27	9.38e-21	0.8604
1. PBF	A4GGB2	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.50e-25	2.13e-18	0.8575
1. PBF	Q3A083	ATP synthase subunit beta 2	0.00e+00	2.20e-62	1.35e-154	0.978
1. PBF	Q20EW8	ATP synthase subunit beta, chloroplastic	0.00e+00	1.55e-72	0.0	0.9658
3. BF	P20022	V-type ATP synthase beta chain (Fragment)	0.00e+00	NA	6.70e-22	0.9035
3. BF	Q8EWY8	ATP synthase subunit beta	0.00e+00	NA	0.0	0.9883
3. BF	A3P8L5	ATP synthase subunit alpha 2	0.00e+00	NA	3.79e-19	0.8603
4. PB	Q5ZRA1	ATP synthase subunit beta	0.00e+00	9.04e-64	0.0	NA
4. PB	O51891	Transcription termination factor Rho	2.19e-08	2.65e-08	0.006	NA
4. PB	C3MW93	V-type ATP synthase alpha chain	3.80e-14	1.37e-18	1.09e-32	NA
4. PB	Q5F4Z2	ATP synthase subunit alpha	0.00e+00	2.41e-25	1.12e-21	NA
4. PB	P38606	V-type proton ATPase catalytic subunit A	9.09e-14	4.50e-15	5.19e-32	NA
4. PB	C0HK51	ATP synthase subunit alpha, mitochondrial	0.00e+00	5.93e-23	6.30e-17	NA
4. PB	A6WXW9	ATP synthase subunit alpha	0.00e+00	1.97e-24	1.48e-20	NA
4. PB	B7GTZ3	ATP synthase subunit beta	0.00e+00	4.51e-69	0.0	NA
4. PB	A4WHI5	V-type ATP synthase beta chain	0.00e+00	2.85e-16	2.76e-32	NA
4. PB	Q662R8	V-type ATP synthase alpha chain	0.00e+00	1.27e-15	3.87e-21	NA
4. PB	Q97CP9	V-type ATP synthase beta chain	0.00e+00	4.97e-22	2.59e-40	NA
4. PB	Q4K3A9	ATP synthase subunit beta	0.00e+00	1.81e-64	0.0	NA
4. PB	B9DX63	ATP synthase subunit alpha	0.00e+00	6.06e-29	1.39e-25	NA
4. PB	A4QDH1	ATP synthase subunit alpha	0.00e+00	2.33e-23	2.39e-22	NA
4. PB	Q09FX6	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.03e-24	1.53e-19	NA
4. PB	P0A295	Transcription termination factor Rho	1.92e-08	1.87e-08	0.005	NA
4. PB	Q38676	V-type proton ATPase catalytic subunit A isoform 1	4.15e-13	6.99e-17	5.61e-34	NA
4. PB	A5EBX1	ATP synthase subunit beta 2	0.00e+00	2.87e-62	2.59e-160	NA
4. PB	B4EEY9	ATP synthase subunit beta	0.00e+00	2.07e-68	0.0	NA
4. PB	Q2QDA3	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.88e-26	6.25e-19	NA
4. PB	P12985	ATP synthase subunit alpha	0.00e+00	5.75e-26	4.62e-28	NA
4. PB	P42464	ATP synthase subunit beta	0.00e+00	1.00e-71	0.0	NA
4. PB	C5CIV6	ATP synthase subunit alpha	0.00e+00	5.23e-25	2.53e-20	NA
4. PB	B9LS42	V-type ATP synthase beta chain	0.00e+00	2.86e-23	6.38e-26	NA
4. PB	B8DYT2	ATP synthase subunit alpha	0.00e+00	1.06e-27	8.04e-23	NA
4. PB	Q82XQ0	ATP synthase subunit alpha	0.00e+00	1.02e-22	9.87e-27	NA
4. PB	Q03498	V-type proton ATPase catalytic subunit A	1.14e-13	8.61e-17	4.06e-36	NA
4. PB	C4KHV0	V-type ATP synthase alpha chain	3.92e-14	1.37e-18	1.09e-32	NA
4. PB	B4UKF2	ATP synthase subunit alpha	0.00e+00	5.08e-26	5.93e-25	NA
4. PB	B5E551	V-type ATP synthase beta chain	0.00e+00	2.90e-21	1.31e-27	NA
4. PB	Q2S6P1	ATP synthase subunit beta	0.00e+00	6.83e-69	0.0	NA
4. PB	O83441	V-type ATP synthase alpha chain 1	0.00e+00	1.78e-18	1.28e-21	NA
4. PB	Q8XJW5	V-type ATP synthase alpha chain	1.38e-13	5.91e-16	6.37e-32	NA
4. PB	P48413	V-type proton ATPase subunit B	0.00e+00	3.50e-20	6.73e-35	NA
4. PB	Q1CSD3	ATP synthase subunit alpha	0.00e+00	3.03e-25	1.95e-26	NA
4. PB	P0CH93	Transcription termination factor Rho 2	2.46e-08	1.08e-07	2.97e-06	NA
4. PB	Q112Z6	ATP synthase subunit alpha	0.00e+00	5.70e-28	3.98e-23	NA
4. PB	A7HDG9	V-type ATP synthase alpha chain	0.00e+00	1.19e-18	1.34e-27	NA
4. PB	A6YG64	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.23e-27	4.62e-20	NA
4. PB	Q5FKY2	ATP synthase subunit alpha	0.00e+00	8.80e-29	3.70e-19	NA
4. PB	B6JMX4	ATP synthase subunit alpha	0.00e+00	3.81e-25	4.66e-27	NA
4. PB	Q18FB7	V-type ATP synthase alpha chain	1.67e-14	7.35e-16	5.78e-28	NA
4. PB	A6VF32	ATP synthase subunit beta	0.00e+00	1.63e-63	0.0	NA
4. PB	Q1IIG6	ATP synthase subunit alpha	0.00e+00	1.21e-28	6.91e-27	NA
4. PB	B7H294	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	Q5FNY6	ATP synthase subunit alpha 2	0.00e+00	2.63e-28	1.39e-21	NA
4. PB	P07251	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.55e-16	1.27e-17	NA
4. PB	B6J961	ATP synthase subunit alpha	0.00e+00	5.32e-25	3.82e-27	NA
4. PB	A8G6V1	ATP synthase subunit alpha	0.00e+00	2.25e-29	1.49e-24	NA
4. PB	Q5NQZ1	ATP synthase subunit alpha	0.00e+00	6.01e-25	4.27e-21	NA
4. PB	B1YQL4	ATP synthase subunit beta	0.00e+00	1.13e-68	0.0	NA
4. PB	P0ABB3	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q9HT18	ATP synthase subunit alpha	0.00e+00	2.18e-24	3.30e-24	NA
4. PB	Q8SR34	V-type proton ATPase subunit B	0.00e+00	4.60e-23	1.58e-32	NA
4. PB	C1CLK8	ATP synthase subunit alpha	0.00e+00	5.67e-30	3.32e-19	NA
4. PB	A3PS65	ATP synthase subunit alpha 2	0.00e+00	3.14e-25	1.02e-16	NA
4. PB	A7N0Y3	ATP synthase subunit alpha 1	0.00e+00	2.69e-24	4.06e-27	NA
4. PB	P52156	Transcription termination factor Rho	1.98e-08	7.35e-07	4.39e-05	NA
4. PB	C5A336	V-type ATP synthase alpha chain	0.00e+00	6.37e-14	6.43e-29	NA
4. PB	A1RX20	V-type ATP synthase beta chain	0.00e+00	2.71e-20	1.96e-31	NA
4. PB	A5VSE3	ATP synthase subunit alpha	0.00e+00	9.97e-26	1.10e-20	NA
4. PB	B5XJH3	V-type ATP synthase alpha chain	0.00e+00	5.87e-13	1.29e-33	NA
4. PB	A3N2U6	ATP synthase subunit alpha	0.00e+00	3.45e-23	7.41e-26	NA
4. PB	Q9MTL7	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.48e-26	1.15e-18	NA
4. PB	P12085	ATP synthase subunit beta, chloroplastic	0.00e+00	2.33e-65	0.0	NA
4. PB	B4UH39	V-type ATP synthase alpha chain	4.11e-15	4.14e-19	4.77e-27	NA
4. PB	B7LK79	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q40078	V-type proton ATPase subunit B 1	0.00e+00	8.29e-20	3.33e-31	NA
4. PB	Q3BP15	ATP synthase subunit beta	0.00e+00	7.45e-65	0.0	NA
4. PB	Q76NU1	V-type proton ATPase subunit B	0.00e+00	3.73e-20	8.36e-34	NA
4. PB	B0VBP3	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	Q08636	V-type sodium ATPase catalytic subunit A	2.37e-13	4.96e-17	5.28e-33	NA
4. PB	Q5HB71	ATP synthase subunit beta	0.00e+00	1.23e-62	0.0	NA
4. PB	B8HPK1	ATP synthase subunit alpha	0.00e+00	9.08e-27	1.06e-21	NA
4. PB	Q5X0P1	ATP synthase subunit alpha 2	0.00e+00	2.19e-26	1.83e-20	NA
4. PB	Q11YP1	ATP synthase subunit alpha	0.00e+00	2.00e-24	3.08e-19	NA
4. PB	B5RLG8	V-type ATP synthase alpha chain	0.00e+00	1.19e-16	1.25e-20	NA
4. PB	Q0SGP7	ATP synthase subunit alpha	0.00e+00	1.10e-21	5.66e-19	NA
4. PB	P10719	ATP synthase subunit beta, mitochondrial	0.00e+00	4.81e-26	0.0	NA
4. PB	Q4FQ35	ATP synthase subunit alpha	0.00e+00	3.36e-27	4.28e-24	NA
4. PB	P05495	ATP synthase subunit alpha, mitochondrial	0.00e+00	8.17e-29	1.63e-21	NA
4. PB	Q2Y8G2	ATP synthase subunit beta 2	0.00e+00	3.54e-64	8.25e-142	NA
4. PB	Q07UZ3	ATP synthase subunit alpha	0.00e+00	9.94e-27	5.67e-23	NA
4. PB	Q971B6	V-type ATP synthase beta chain	0.00e+00	4.89e-22	7.34e-41	NA
4. PB	A4FN29	ATP synthase subunit alpha	0.00e+00	2.10e-20	1.34e-18	NA
4. PB	A3DHP1	V-type ATP synthase beta chain	0.00e+00	1.29e-22	1.99e-33	NA
4. PB	C1CXU4	V-type ATP synthase beta chain	0.00e+00	1.89e-22	5.62e-35	NA
4. PB	Q0I7R2	ATP synthase subunit alpha	0.00e+00	9.45e-30	3.65e-23	NA
4. PB	Q9BBS3	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.17e-25	1.28e-18	NA
4. PB	Q02DF2	ATP synthase subunit alpha	0.00e+00	2.18e-24	3.30e-24	NA
4. PB	A1SHJ1	ATP synthase subunit beta	0.00e+00	1.79e-76	0.0	NA
4. PB	A9WNC6	ATP synthase subunit alpha	0.00e+00	2.77e-23	1.36e-19	NA
4. PB	O07025	Flagellum-specific ATP synthase	0.00e+00	2.41e-37	1.65e-41	NA
4. PB	Q724W6	ATP synthase subunit alpha 1	0.00e+00	3.80e-28	1.93e-13	NA
4. PB	O84310	V-type ATP synthase alpha chain	0.00e+00	5.11e-14	1.39e-23	NA
4. PB	B5E552	V-type ATP synthase alpha chain	NA	6.45e-16	1.14e-32	NA
4. PB	B5XKQ1	ATP synthase subunit beta	0.00e+00	9.11e-76	0.0	NA
4. PB	A6VFZ3	V-type ATP synthase beta chain	0.00e+00	1.06e-23	2.91e-30	NA
4. PB	Q3K439	ATP synthase subunit alpha	0.00e+00	4.96e-25	1.46e-21	NA
4. PB	Q31RF1	ATP synthase subunit alpha	0.00e+00	1.71e-27	2.86e-20	NA
4. PB	A6MMA7	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.07e-24	8.89e-19	NA
4. PB	Q64UA4	ATP synthase subunit alpha	0.00e+00	1.34e-24	5.40e-21	NA
4. PB	C1D5G2	ATP synthase subunit beta	0.00e+00	5.39e-65	0.0	NA
4. PB	Q1IWP4	V-type ATP synthase beta chain	0.00e+00	3.17e-22	1.11e-34	NA
4. PB	Q1CWT2	ATP synthase subunit alpha	0.00e+00	1.34e-24	2.93e-22	NA
4. PB	Q9JXQ2	ATP synthase subunit beta	0.00e+00	7.02e-59	0.0	NA
4. PB	P49375	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.69e-16	6.53e-17	NA
4. PB	C4KHU9	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	Q5H4Y6	ATP synthase subunit alpha	0.00e+00	5.09e-24	1.22e-23	NA
4. PB	C4KYS5	ATP synthase subunit alpha	0.00e+00	1.37e-25	1.66e-23	NA
4. PB	A3DNQ5	V-type ATP synthase beta chain	0.00e+00	1.47e-22	8.66e-29	NA
4. PB	A0RXK1	V-type ATP synthase alpha chain	0.00e+00	1.43e-17	4.78e-31	NA
4. PB	A2RMI4	ATP synthase subunit alpha	0.00e+00	1.93e-26	1.74e-18	NA
4. PB	Q9KNH3	ATP synthase subunit alpha	0.00e+00	1.37e-25	9.61e-28	NA
4. PB	Q2P7Q4	ATP synthase subunit beta	0.00e+00	4.76e-64	0.0	NA
4. PB	Q47M80	ATP synthase subunit alpha	0.00e+00	8.88e-23	4.71e-20	NA
4. PB	Q1LHK8	ATP synthase subunit alpha	0.00e+00	1.41e-24	4.32e-25	NA
4. PB	Q9MU26	ATP synthase subunit beta, chloroplastic	NA	6.96e-68	0.0	NA
4. PB	Q3K1J7	ATP synthase subunit alpha	0.00e+00	5.91e-28	3.00e-18	NA
4. PB	P22662	V-type ATP synthase alpha chain	1.55e-15	5.68e-17	7.76e-33	NA
4. PB	A4FXD4	V-type ATP synthase alpha chain	1.68e-14	1.30e-17	3.47e-30	NA
4. PB	B7L884	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q8P2U6	V-type ATP synthase alpha chain	0.00e+00	7.37e-13	2.15e-33	NA
4. PB	A1W2T7	ATP synthase subunit beta	0.00e+00	5.54e-66	0.0	NA
4. PB	Q24MN9	ATP synthase subunit alpha	0.00e+00	1.19e-28	7.91e-20	NA
4. PB	A6UDM3	ATP synthase subunit alpha	0.00e+00	1.71e-24	8.03e-21	NA
4. PB	Q15SF1	ATP synthase subunit alpha 1	0.00e+00	3.81e-25	1.15e-24	NA
4. PB	Q971B7	V-type ATP synthase alpha chain	2.38e-14	5.06e-20	1.24e-31	NA
4. PB	A1EA05	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.30e-24	7.51e-22	NA
4. PB	A8HS15	ATP synthase subunit alpha	0.00e+00	8.00e-27	2.27e-22	NA
4. PB	B5XZM2	ATP synthase subunit alpha	0.00e+00	1.86e-22	2.35e-23	NA
4. PB	A4VVK1	ATP synthase subunit alpha	0.00e+00	1.12e-28	8.20e-20	NA
4. PB	B7V793	ATP synthase subunit alpha	0.00e+00	2.18e-24	3.30e-24	NA
4. PB	Q3YT21	ATP synthase subunit alpha	0.00e+00	1.10e-28	1.10e-24	NA
4. PB	Q8RI79	V-type ATP synthase beta chain	0.00e+00	3.63e-22	2.22e-29	NA
4. PB	P31409	V-type proton ATPase subunit B	0.00e+00	2.76e-21	2.52e-34	NA
4. PB	Q83HY0	ATP synthase subunit beta	0.00e+00	5.17e-74	0.0	NA
4. PB	Q8PCZ5	ATP synthase subunit beta	0.00e+00	3.82e-63	0.0	NA
4. PB	A0QCX6	ATP synthase subunit alpha	0.00e+00	4.98e-20	1.13e-22	NA
4. PB	P15999	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.05e-14	4.37e-18	NA
4. PB	B1ICC9	V-type ATP synthase alpha chain	0.00e+00	3.99e-16	2.97e-32	NA
4. PB	A0T0P4	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.94e-27	3.63e-20	NA
4. PB	Q0VKX4	ATP synthase subunit beta	0.00e+00	1.12e-64	0.0	NA
4. PB	B3CN53	ATP synthase subunit alpha	0.00e+00	1.08e-28	9.07e-27	NA
4. PB	Q39KX8	ATP synthase subunit alpha	0.00e+00	2.82e-26	5.31e-24	NA
4. PB	Q0AKV8	ATP synthase subunit alpha	0.00e+00	3.55e-26	1.28e-21	NA
4. PB	B8ZK30	V-type ATP synthase beta chain	0.00e+00	2.90e-21	1.31e-27	NA
4. PB	P26679	ATP synthase subunit alpha	0.00e+00	3.06e-27	2.29e-18	NA
4. PB	B8F772	ATP synthase subunit alpha	0.00e+00	7.82e-25	6.62e-26	NA
4. PB	Q0G9N4	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.15e-24	4.27e-19	NA
4. PB	Q9A2V7	ATP synthase subunit alpha	0.00e+00	8.81e-26	1.56e-19	NA
4. PB	A9AAQ3	V-type ATP synthase beta chain	0.00e+00	1.22e-23	3.60e-30	NA
4. PB	A1UJY4	ATP synthase subunit beta	0.00e+00	3.55e-50	0.0	NA
4. PB	Q8MBK3	ATP synthase subunit beta, chloroplastic	NA	4.47e-71	0.0	NA
4. PB	A6H2D7	ATP synthase subunit alpha	0.00e+00	1.03e-24	2.38e-21	NA
4. PB	B1KQ34	ATP synthase subunit beta	0.00e+00	5.69e-66	0.0	NA
4. PB	B2SEX9	ATP synthase subunit alpha	0.00e+00	5.70e-28	3.49e-26	NA
4. PB	B3EA03	ATP synthase subunit alpha	0.00e+00	2.42e-24	1.13e-19	NA
4. PB	P31401	V-type proton ATPase subunit B	0.00e+00	1.93e-20	7.02e-34	NA
4. PB	A7M951	ATP synthase subunit alpha, plastid	0.00e+00	1.74e-24	8.10e-19	NA
4. PB	P51242	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.09e-27	1.02e-19	NA
4. PB	A1SBU2	ATP synthase subunit alpha	0.00e+00	4.30e-23	1.17e-22	NA
4. PB	Q21DK8	ATP synthase subunit beta	0.00e+00	2.65e-62	0.0	NA
4. PB	Q48UD5	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	A7MMX1	ATP synthase subunit alpha	0.00e+00	4.30e-23	1.61e-23	NA
4. PB	B0K8E8	V-type ATP synthase alpha chain	3.79e-14	3.10e-14	4.72e-34	NA
4. PB	A8M2J3	ATP synthase subunit beta	0.00e+00	3.19e-70	0.0	NA
4. PB	P06450	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.17e-26	1.20e-19	NA
4. PB	Q9C5A9	ATP synthase subunit beta-3, mitochondrial	0.00e+00	1.56e-19	0.0	NA
4. PB	Q7CPE1	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q56404	V-type ATP synthase beta chain	0.00e+00	1.63e-21	2.46e-33	NA
4. PB	Q14FH2	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.50e-26	1.35e-19	NA
4. PB	Q5FF66	ATP synthase subunit alpha	0.00e+00	6.02e-28	4.87e-31	NA
4. PB	B7GMF3	ATP synthase subunit beta	0.00e+00	4.74e-78	0.0	NA
4. PB	A6VFZ2	V-type ATP synthase alpha chain	9.10e-15	2.22e-16	1.96e-30	NA
4. PB	Q60187	V-type ATP synthase beta chain	0.00e+00	3.75e-23	1.62e-28	NA
4. PB	B7NR36	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A8ZNS4	ATP synthase subunit alpha 2	0.00e+00	1.74e-26	1.24e-30	NA
4. PB	Q601Z7	ATP synthase subunit alpha	0.00e+00	3.49e-26	2.82e-26	NA
4. PB	A3M144	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	A8AYG3	ATP synthase subunit alpha	0.00e+00	7.58e-29	4.35e-18	NA
4. PB	P0DA07	V-type ATP synthase alpha chain	3.45e-13	9.89e-13	1.74e-33	NA
4. PB	Q7NA92	ATP synthase subunit alpha	0.00e+00	2.42e-24	1.97e-23	NA
4. PB	B8HAY9	ATP synthase subunit beta	0.00e+00	1.83e-65	0.0	NA
4. PB	C1CES1	V-type ATP synthase beta chain	0.00e+00	2.90e-21	1.31e-27	NA
4. PB	B7M590	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A6TG38	ATP synthase subunit alpha	0.00e+00	1.03e-22	3.25e-23	NA
4. PB	C3NEU2	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	A9NBC8	ATP synthase subunit alpha	0.00e+00	5.32e-25	3.82e-27	NA
4. PB	A5FRQ3	ATP synthase subunit alpha	0.00e+00	5.35e-26	1.23e-21	NA
4. PB	P46561	ATP synthase subunit beta, mitochondrial	0.00e+00	2.06e-22	0.0	NA
4. PB	B7JGN2	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	P0AG32	Transcription termination factor Rho	3.88e-07	1.96e-08	0.005	NA
4. PB	Q6F204	ATP synthase subunit alpha	0.00e+00	4.62e-25	7.38e-20	NA
4. PB	A4YI06	V-type ATP synthase beta chain	0.00e+00	8.22e-21	1.53e-39	NA
4. PB	Q55CS9	ATP synthase subunit beta, mitochondrial	0.00e+00	2.31e-08	0.0	NA
4. PB	A7HDG8	V-type ATP synthase beta chain	0.00e+00	2.03e-20	3.35e-30	NA
4. PB	A4QLR8	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.85e-26	3.39e-19	NA
4. PB	Q589B3	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.31e-26	1.56e-19	NA
4. PB	B5QUS6	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q92FH0	ATP synthase subunit alpha 1	0.00e+00	8.38e-28	3.34e-14	NA
4. PB	Q6MAJ5	V-type ATP synthase alpha chain	0.00e+00	5.23e-19	2.25e-23	NA
4. PB	Q02BU3	ATP synthase subunit alpha	0.00e+00	2.33e-27	7.02e-23	NA
4. PB	A3MQJ9	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	B2I102	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	A2SST6	V-type ATP synthase beta chain	0.00e+00	8.63e-21	3.26e-24	NA
4. PB	Q8P2U5	V-type ATP synthase beta chain	0.00e+00	3.12e-22	1.97e-30	NA
4. PB	Q1XDP5	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.08e-28	3.71e-19	NA
4. PB	A4QL91	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.02e-25	6.02e-19	NA
4. PB	A5GV72	ATP synthase subunit alpha	0.00e+00	7.37e-28	7.61e-23	NA
4. PB	Q03265	ATP synthase subunit alpha, mitochondrial	0.00e+00	4.57e-14	3.52e-18	NA
4. PB	A0T0D2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.64e-78	0.0	NA
4. PB	Q39KX6	ATP synthase subunit beta	0.00e+00	9.80e-69	0.0	NA
4. PB	Q2GER5	ATP synthase subunit alpha	0.00e+00	1.54e-29	2.35e-26	NA
4. PB	Q1C093	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	A6QIU9	ATP synthase subunit alpha	0.00e+00	3.28e-28	6.84e-25	NA
4. PB	B5E670	ATP synthase subunit beta	NA	1.20e-70	0.0	NA
4. PB	Q4UQF4	ATP synthase subunit beta	0.00e+00	3.82e-63	0.0	NA
4. PB	P48080	ATP synthase subunit alpha, cyanelle	0.00e+00	1.70e-25	6.43e-22	NA
4. PB	B5YBQ0	ATP synthase subunit alpha	0.00e+00	6.33e-27	2.67e-22	NA
4. PB	B8EQP9	ATP synthase subunit alpha	0.00e+00	1.62e-24	3.67e-22	NA
4. PB	Q8ZXR2	V-type ATP synthase beta chain	0.00e+00	1.47e-15	3.92e-28	NA
4. PB	A6UT35	V-type ATP synthase alpha chain	1.08e-14	2.49e-17	1.25e-29	NA
4. PB	B1JSV7	ATP synthase subunit beta	0.00e+00	7.63e-69	0.0	NA
4. PB	Q9MUT2	ATP synthase subunit alpha, chloroplastic	0.00e+00	6.56e-27	8.25e-21	NA
4. PB	Q37380	ATP synthase subunit alpha, mitochondrial	0.00e+00	9.77e-24	2.05e-23	NA
4. PB	C3M9S3	ATP synthase subunit alpha	0.00e+00	2.21e-25	2.99e-21	NA
4. PB	Q8XJW6	V-type ATP synthase beta chain	0.00e+00	1.27e-20	6.38e-34	NA
4. PB	Q834X9	V-type ATP synthase alpha chain	3.91e-14	2.69e-17	7.90e-33	NA
4. PB	A5WBA3	ATP synthase subunit beta	0.00e+00	1.01e-65	0.0	NA
4. PB	C1FTN6	V-type ATP synthase beta chain	0.00e+00	3.38e-19	1.63e-32	NA
4. PB	A2T317	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.03e-25	7.00e-23	NA
4. PB	Q4A602	ATP synthase subunit alpha	0.00e+00	3.48e-24	2.14e-22	NA
4. PB	P0ABB4	ATP synthase subunit beta	0.00e+00	5.11e-66	0.0	NA
4. PB	P37211	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.85e-16	1.58e-19	NA
4. PB	Q3HKH9	ATP synthase subunit alpha 2	0.00e+00	9.13e-26	1.16e-16	NA
4. PB	B4RJG0	ATP synthase subunit beta	0.00e+00	9.57e-59	0.0	NA
4. PB	Q3B3Z9	ATP synthase subunit alpha 1	0.00e+00	3.73e-28	1.20e-24	NA
4. PB	Q9JW70	ATP synthase subunit beta	0.00e+00	7.21e-59	0.0	NA
4. PB	Q13DP4	ATP synthase subunit alpha	0.00e+00	1.56e-27	3.49e-22	NA
4. PB	Q31UN4	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	B5ZSN9	ATP synthase subunit alpha	0.00e+00	1.28e-25	3.17e-22	NA
4. PB	Q57HX7	ATP synthase subunit alpha	0.00e+00	3.17e-23	1.08e-22	NA
4. PB	Q5ZR99	ATP synthase subunit alpha 2	0.00e+00	2.19e-26	1.83e-20	NA
4. PB	Q1KXW5	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.02e-25	2.23e-19	NA
4. PB	C1F0N0	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	Q1MAZ0	ATP synthase subunit alpha	0.00e+00	1.15e-25	7.89e-22	NA
4. PB	A4QJI4	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.55e-25	5.86e-19	NA
4. PB	A7HIX9	ATP synthase subunit alpha	0.00e+00	2.68e-25	2.29e-22	NA
4. PB	Q2FP51	V-type ATP synthase beta chain 1	0.00e+00	2.81e-21	6.81e-33	NA
4. PB	Q81JZ3	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	Q3ITC8	V-type ATP synthase alpha chain	1.38e-14	2.10e-14	2.99e-33	NA
4. PB	B1YAT5	V-type ATP synthase beta chain	0.00e+00	4.61e-16	3.91e-33	NA
4. PB	A1RTZ6	V-type ATP synthase beta chain	0.00e+00	1.83e-16	1.10e-31	NA
4. PB	Q6C326	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.61e-19	1.90e-16	NA
4. PB	P55987	ATP synthase subunit alpha	0.00e+00	3.81e-25	4.66e-27	NA
4. PB	A0ALL5	ATP synthase subunit alpha 2	0.00e+00	2.23e-28	1.68e-20	NA
4. PB	C1C8A1	ATP synthase subunit alpha	0.00e+00	6.85e-30	3.50e-19	NA
4. PB	B7UMJ9	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	P22201	ATP synthase subunit alpha, mitochondrial	0.00e+00	4.09e-28	1.46e-22	NA
4. PB	Q6CYJ3	ATP synthase subunit alpha	0.00e+00	1.52e-23	2.14e-25	NA
4. PB	A1UJY6	ATP synthase subunit alpha	0.00e+00	1.14e-18	2.38e-21	NA
4. PB	A9L981	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.93e-24	3.27e-21	NA
4. PB	B0TWS7	ATP synthase subunit beta	0.00e+00	1.73e-65	0.0	NA
4. PB	A4T8K0	ATP synthase subunit alpha	0.00e+00	8.09e-19	9.46e-22	NA
4. PB	Q6EW63	ATP synthase subunit alpha, chloroplastic	0.00e+00	7.82e-25	5.67e-20	NA
4. PB	Q60CR4	ATP synthase subunit beta	0.00e+00	1.72e-61	0.0	NA
4. PB	A5UKB1	V-type ATP synthase beta chain	0.00e+00	5.27e-23	2.46e-35	NA
4. PB	Q3AZM1	ATP synthase subunit alpha	0.00e+00	1.81e-27	1.55e-23	NA
4. PB	P83483	ATP synthase subunit beta-1, mitochondrial	0.00e+00	1.01e-18	0.0	NA
4. PB	Q6A8C7	ATP synthase subunit beta	0.00e+00	1.98e-71	0.0	NA
4. PB	A3CK49	V-type ATP synthase beta chain	0.00e+00	1.77e-22	9.73e-31	NA
4. PB	Q7U8W5	ATP synthase subunit alpha	0.00e+00	2.46e-27	1.59e-22	NA
4. PB	Q21Z99	ATP synthase subunit alpha 2	0.00e+00	8.09e-21	2.79e-26	NA
4. PB	Q9CES0	ATP synthase subunit beta	0.00e+00	7.23e-77	0.0	NA
4. PB	B2IP44	V-type ATP synthase beta chain	0.00e+00	3.41e-21	6.87e-28	NA
4. PB	B0KRA8	ATP synthase subunit beta	0.00e+00	2.66e-66	0.0	NA
4. PB	Q48VL2	V-type ATP synthase beta chain	0.00e+00	4.50e-22	9.49e-30	NA
4. PB	P35009	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.47e-31	9.90e-22	NA
4. PB	Q6FYM1	ATP synthase subunit alpha	0.00e+00	1.32e-24	1.33e-19	NA
4. PB	P22477	ATP synthase subunit alpha	0.00e+00	6.98e-30	1.25e-23	NA
4. PB	Q2RV20	ATP synthase subunit alpha	0.00e+00	1.11e-26	4.20e-26	NA
4. PB	A6VL57	ATP synthase subunit beta	0.00e+00	7.70e-64	0.0	NA
4. PB	B1X9W2	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	P0A296	Transcription termination factor Rho	1.96e-08	1.87e-08	0.005	NA
4. PB	Q5LD89	ATP synthase subunit beta	0.00e+00	7.41e-60	0.0	NA
4. PB	Q8MBQ4	ATP synthase subunit beta, chloroplastic	NA	1.57e-68	0.0	NA
4. PB	Q85V44	ATP synthase subunit beta, chloroplastic	0.00e+00	3.69e-68	0.0	NA
4. PB	B1IE32	ATP synthase subunit alpha	0.00e+00	3.05e-28	2.07e-24	NA
4. PB	Q9CKW2	ATP synthase subunit alpha	0.00e+00	1.97e-23	7.71e-24	NA
4. PB	Q3V549	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.48e-26	1.03e-19	NA
4. PB	C1AW01	ATP synthase subunit alpha	0.00e+00	8.17e-22	1.53e-18	NA
4. PB	Q01859	ATP synthase subunit beta, mitochondrial	0.00e+00	1.76e-20	0.0	NA
4. PB	O32467	V-type ATP synthase beta chain	0.00e+00	4.82e-20	9.42e-37	NA
4. PB	Q29048	V-type proton ATPase catalytic subunit A	5.08e-14	1.14e-16	5.88e-32	NA
4. PB	A9H9A4	ATP synthase subunit alpha	0.00e+00	6.17e-26	4.38e-20	NA
4. PB	Q1QQS5	ATP synthase subunit alpha	0.00e+00	2.02e-25	7.50e-24	NA
4. PB	Q85FN4	ATP synthase subunit alpha, chloroplastic	0.00e+00	7.16e-25	3.64e-23	NA
4. PB	A5VIQ9	ATP synthase subunit alpha	0.00e+00	4.85e-29	6.05e-21	NA
4. PB	P29706	ATP synthase subunit alpha, sodium ion specific	0.00e+00	6.06e-26	9.01e-25	NA
4. PB	B1JFU3	ATP synthase subunit alpha	0.00e+00	8.09e-25	1.58e-23	NA
4. PB	Q8E5V0	ATP synthase subunit alpha	0.00e+00	5.91e-28	4.39e-18	NA
4. PB	P19366	ATP synthase subunit beta, chloroplastic	0.00e+00	3.94e-72	0.0	NA
4. PB	Q6NHT1	ATP synthase subunit alpha	0.00e+00	3.86e-24	6.35e-22	NA
4. PB	B8JE34	V-type ATP synthase beta chain	0.00e+00	2.22e-23	1.44e-31	NA
4. PB	P05036	ATP synthase subunit alpha	0.00e+00	1.11e-26	4.20e-26	NA
4. PB	A0JY66	ATP synthase subunit alpha	0.00e+00	6.34e-23	7.78e-20	NA
4. PB	B6YV14	V-type ATP synthase alpha chain	0.00e+00	2.31e-13	5.95e-28	NA
4. PB	B2FHY8	ATP synthase subunit beta	0.00e+00	7.42e-63	0.0	NA
4. PB	A5GNC8	ATP synthase subunit alpha	0.00e+00	6.85e-28	2.24e-22	NA
4. PB	Q2FQF0	V-type ATP synthase beta chain 3	0.00e+00	3.69e-23	4.41e-32	NA
4. PB	Q9HNE3	V-type ATP synthase alpha chain	6.26e-14	2.20e-15	2.35e-29	NA
4. PB	A5WBW1	ATP synthase subunit beta	0.00e+00	1.60e-62	0.0	NA
4. PB	A4QJA0	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.25e-25	7.98e-19	NA
4. PB	P22478	ATP synthase subunit beta	0.00e+00	5.40e-77	0.0	NA
4. PB	Q8RGE0	ATP synthase subunit alpha	0.00e+00	8.02e-29	3.00e-29	NA
4. PB	P48414	V-type proton ATPase catalytic subunit A	5.44e-15	1.78e-18	5.35e-33	NA
4. PB	A1R7V3	ATP synthase subunit beta	0.00e+00	3.79e-65	0.0	NA
4. PB	P99111	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	Q09X32	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.81e-25	7.29e-19	NA
4. PB	B7IG42	ATP synthase subunit alpha	0.00e+00	3.24e-27	1.54e-21	NA
4. PB	A3CS72	V-type ATP synthase beta chain	0.00e+00	3.83e-21	5.44e-32	NA
4. PB	A3Q3B3	ATP synthase subunit alpha	0.00e+00	1.14e-18	2.38e-21	NA
4. PB	P05439	ATP synthase subunit alpha	0.00e+00	2.21e-25	2.79e-21	NA
4. PB	O27035	V-type ATP synthase beta chain	0.00e+00	4.21e-24	1.93e-35	NA
4. PB	O34171	Flagellum-specific ATP synthase	0.00e+00	2.85e-27	3.28e-38	NA
4. PB	Q8Y4C0	ATP synthase subunit alpha 2	0.00e+00	1.59e-28	1.80e-20	NA
4. PB	Q91YH6	V-type proton ATPase subunit B, kidney isoform	0.00e+00	1.23e-17	5.64e-32	NA
4. PB	B7I1W4	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	A9NGW4	ATP synthase subunit alpha	0.00e+00	1.25e-29	3.92e-23	NA
4. PB	A6UP55	V-type ATP synthase beta chain	0.00e+00	3.82e-23	1.52e-32	NA
4. PB	Q184E7	V-type ATP synthase alpha chain	1.06e-13	1.32e-17	7.68e-34	NA
4. PB	A4YI05	V-type ATP synthase alpha chain	3.06e-14	1.31e-18	2.38e-30	NA
4. PB	Q1JNS8	V-type ATP synthase alpha chain	0.00e+00	1.62e-12	2.44e-33	NA
4. PB	Q60186	V-type ATP synthase alpha chain	1.33e-15	5.91e-16	1.56e-33	NA
4. PB	Q9HNE4	V-type ATP synthase beta chain	0.00e+00	1.50e-21	4.28e-31	NA
4. PB	Q3YVN8	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A8M2J5	ATP synthase subunit alpha	0.00e+00	4.75e-20	5.53e-21	NA
4. PB	Q03LX3	ATP synthase subunit beta	0.00e+00	1.26e-73	0.0	NA
4. PB	A0PZC7	V-type ATP synthase beta chain	0.00e+00	7.96e-21	2.58e-30	NA
4. PB	Q04BA5	ATP synthase subunit alpha	0.00e+00	1.91e-27	1.05e-20	NA
4. PB	B3PLV6	ATP synthase subunit alpha	0.00e+00	1.09e-25	5.80e-22	NA
4. PB	Q7VA63	ATP synthase subunit alpha	0.00e+00	1.69e-28	3.70e-23	NA
4. PB	B8CZG8	V-type ATP synthase alpha chain	0.00e+00	2.85e-15	3.32e-31	NA
4. PB	A4GYP3	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.50e-26	1.35e-19	NA
4. PB	A4QDH3	ATP synthase subunit beta	0.00e+00	3.62e-72	0.0	NA
4. PB	D2B129	Transcription termination factor Rho	7.10e-09	1.12e-09	0.007	NA
4. PB	A2BYH6	ATP synthase subunit alpha	0.00e+00	4.17e-28	4.74e-24	NA
4. PB	A9KBF7	ATP synthase subunit beta	0.00e+00	7.80e-70	0.0	NA
4. PB	P0C521	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.05e-27	4.10e-22	NA
4. PB	B0VNK4	ATP synthase subunit beta	0.00e+00	5.18e-61	0.0	NA
4. PB	B0RWC2	ATP synthase subunit beta	0.00e+00	1.86e-64	0.0	NA
4. PB	Q5HC95	ATP synthase subunit alpha	0.00e+00	6.02e-28	4.87e-31	NA
4. PB	Q7P097	ATP synthase subunit alpha	0.00e+00	1.45e-23	2.76e-22	NA
4. PB	Q48BG3	ATP synthase subunit alpha	0.00e+00	4.43e-24	9.20e-22	NA
4. PB	Q7CRB1	ATP synthase subunit alpha	0.00e+00	3.53e-30	1.29e-18	NA
4. PB	Q6B8Q8	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.66e-28	2.67e-18	NA
4. PB	Q03V27	ATP synthase subunit alpha	0.00e+00	2.08e-26	4.23e-21	NA
4. PB	A4WGF3	ATP synthase subunit alpha	0.00e+00	7.90e-23	7.23e-25	NA
4. PB	Q7V5S7	ATP synthase subunit alpha	0.00e+00	1.14e-28	3.87e-23	NA
4. PB	Q46FH4	V-type ATP synthase beta chain	0.00e+00	6.90e-23	1.23e-30	NA
4. PB	Q6AG60	ATP synthase subunit alpha	0.00e+00	1.90e-23	3.27e-22	NA
4. PB	A8A6J7	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q73HB2	ATP synthase subunit alpha	0.00e+00	6.91e-29	6.10e-27	NA
4. PB	Q318U1	ATP synthase subunit alpha	0.00e+00	2.27e-28	1.01e-23	NA
4. PB	A4QL04	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.82e-25	8.66e-19	NA
4. PB	A7FPE2	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	O23654	V-type proton ATPase catalytic subunit A	5.03e-13	1.89e-16	1.18e-34	NA
4. PB	Q6L1S8	V-type ATP synthase beta chain	0.00e+00	1.65e-20	9.52e-40	NA
4. PB	Q2S432	ATP synthase subunit alpha	0.00e+00	9.51e-21	1.40e-20	NA
4. PB	A5III3	ATP synthase subunit beta	0.00e+00	9.04e-64	0.0	NA
4. PB	B7MGF4	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q9XXK1	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.50e-21	2.77e-19	NA
4. PB	C0M718	ATP synthase subunit alpha	0.00e+00	4.33e-28	2.69e-19	NA
4. PB	A5UGZ1	ATP synthase subunit alpha	0.00e+00	6.92e-25	6.58e-24	NA
4. PB	Q70XV0	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.13e-26	5.81e-19	NA
4. PB	Q2G5N7	ATP synthase subunit alpha	0.00e+00	4.25e-26	6.21e-22	NA
4. PB	A9M839	ATP synthase subunit alpha	0.00e+00	1.55e-25	1.07e-20	NA
4. PB	A4VS64	ATP synthase subunit alpha	0.00e+00	5.32e-25	1.19e-22	NA
4. PB	C3L1B0	V-type ATP synthase beta chain	0.00e+00	2.39e-19	3.20e-33	NA
4. PB	B6J2D8	ATP synthase subunit alpha	0.00e+00	5.32e-25	3.82e-27	NA
4. PB	Q0TPW7	V-type ATP synthase alpha chain	1.40e-13	5.91e-16	6.37e-32	NA
4. PB	A6MVW4	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.23e-25	1.60e-22	NA
4. PB	P31410	V-type proton ATPase subunit B	0.00e+00	9.06e-21	3.56e-34	NA
4. PB	C1FQP3	ATP synthase subunit alpha	0.00e+00	1.21e-27	2.36e-24	NA
4. PB	Q8E074	ATP synthase subunit alpha	0.00e+00	5.91e-28	3.00e-18	NA
4. PB	A9MXA8	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q8U4A5	V-type ATP synthase beta chain	0.00e+00	6.76e-21	3.12e-37	NA
4. PB	Q5UXY7	V-type ATP synthase beta chain	0.00e+00	4.22e-21	4.20e-29	NA
4. PB	A5I556	V-type ATP synthase beta chain	0.00e+00	9.31e-19	2.20e-33	NA
4. PB	Q2GIG2	ATP synthase subunit alpha	0.00e+00	1.09e-24	2.82e-18	NA
4. PB	A1U7H4	ATP synthase subunit beta	0.00e+00	3.79e-65	0.0	NA
4. PB	A8G1W5	ATP synthase subunit beta	0.00e+00	1.25e-65	0.0	NA
4. PB	Q8W4E2	V-type proton ATPase subunit B3	0.00e+00	1.38e-19	1.47e-31	NA
4. PB	A0A320	ATP synthase subunit alpha, chloroplastic	0.00e+00	6.81e-24	5.81e-19	NA
4. PB	A9IYX0	ATP synthase subunit alpha	0.00e+00	5.81e-25	1.03e-19	NA
4. PB	C3N6D5	V-type ATP synthase alpha chain	3.90e-14	1.37e-18	1.09e-32	NA
4. PB	A9BPU7	ATP synthase subunit beta	0.00e+00	4.05e-64	0.0	NA
4. PB	Q76NM6	V-type proton ATPase catalytic subunit A	8.04e-14	8.61e-17	4.06e-36	NA
4. PB	A3MU07	V-type ATP synthase beta chain	0.00e+00	1.58e-17	1.53e-31	NA
4. PB	C1A1Y0	ATP synthase subunit alpha	0.00e+00	2.02e-22	6.62e-18	NA
4. PB	B2TP91	V-type ATP synthase alpha chain	0.00e+00	1.19e-16	3.62e-32	NA
4. PB	Q97QA8	V-type ATP synthase alpha chain	0.00e+00	4.89e-16	1.04e-32	NA
4. PB	A8FIB4	ATP synthase subunit alpha	0.00e+00	4.33e-28	1.52e-24	NA
4. PB	B8HAZ1	ATP synthase subunit alpha	0.00e+00	9.19e-23	1.86e-20	NA
4. PB	Q3YS09	ATP synthase subunit beta	0.00e+00	2.59e-57	0.0	NA
4. PB	A8HAG3	ATP synthase subunit beta	0.00e+00	1.76e-64	0.0	NA
4. PB	A9F3R4	ATP synthase subunit beta	0.00e+00	1.42e-67	0.0	NA
4. PB	A1AXU2	ATP synthase subunit beta	0.00e+00	1.88e-65	0.0	NA
4. PB	B7V791	ATP synthase subunit beta	0.00e+00	1.63e-63	0.0	NA
4. PB	B3DTV2	ATP synthase subunit alpha	0.00e+00	3.98e-20	4.84e-17	NA
4. PB	Q6HAX7	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	P56480	ATP synthase subunit beta, mitochondrial	0.00e+00	1.24e-23	0.0	NA
4. PB	B7N2H3	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A6W7G7	ATP synthase subunit alpha	0.00e+00	1.45e-20	1.68e-19	NA
4. PB	Q0SQZ5	ATP synthase subunit beta	0.00e+00	8.69e-75	0.0	NA
4. PB	A9KBF9	ATP synthase subunit alpha	0.00e+00	5.32e-25	3.82e-27	NA
4. PB	C6DJH0	ATP synthase subunit alpha	0.00e+00	2.04e-23	2.10e-25	NA
4. PB	Q1J7G1	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	Q0HPF9	ATP synthase subunit alpha	0.00e+00	1.31e-23	1.40e-24	NA
4. PB	B8ZR40	ATP synthase subunit alpha	0.00e+00	2.82e-22	8.75e-24	NA
4. PB	Q2RZV3	ATP synthase subunit beta	0.00e+00	1.28e-64	0.0	NA
4. PB	Q5WB76	ATP synthase subunit alpha	0.00e+00	8.93e-30	6.93e-25	NA
4. PB	Q0A4M8	ATP synthase subunit beta	0.00e+00	2.93e-63	0.0	NA
4. PB	A4W1V9	ATP synthase subunit alpha	0.00e+00	1.12e-28	8.20e-20	NA
4. PB	A5N3H9	ATP synthase subunit alpha	0.00e+00	4.02e-29	1.67e-25	NA
4. PB	Q1ACM8	ATP synthase subunit alpha, chloroplastic	0.00e+00	9.48e-29	2.69e-21	NA
4. PB	B2SQB0	ATP synthase subunit beta	0.00e+00	4.76e-64	0.0	NA
4. PB	P11593	V-type proton ATPase subunit B	0.00e+00	4.03e-18	5.69e-31	NA
4. PB	P26526	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.25e-27	1.28e-19	NA
4. PB	Q28TJ8	ATP synthase subunit alpha	0.00e+00	5.64e-24	1.08e-19	NA
4. PB	B8GFQ7	V-type ATP synthase beta chain	0.00e+00	1.54e-20	7.26e-33	NA
4. PB	A8SE59	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.58e-25	4.31e-19	NA
4. PB	Q329S3	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A0LDA2	ATP synthase subunit alpha	0.00e+00	1.70e-25	4.81e-21	NA
4. PB	B7GMF5	ATP synthase subunit alpha	0.00e+00	1.16e-28	4.17e-24	NA
4. PB	Q3J6N1	ATP synthase subunit beta	0.00e+00	3.09e-63	0.0	NA
4. PB	A9BCD9	ATP synthase subunit alpha	0.00e+00	3.10e-28	4.45e-24	NA
4. PB	A1V8T1	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	Q5PKX0	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	B5EYZ8	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q8G7B1	ATP synthase subunit alpha	0.00e+00	3.98e-20	4.84e-17	NA
4. PB	A9WNC8	ATP synthase subunit beta	0.00e+00	5.69e-65	0.0	NA
4. PB	A5I557	V-type ATP synthase alpha chain	1.60e-13	1.56e-16	2.77e-31	NA
4. PB	B1W0A3	ATP synthase subunit beta	0.00e+00	3.47e-71	0.0	NA
4. PB	Q5HMB7	ATP synthase subunit alpha	0.00e+00	2.00e-26	1.23e-23	NA
4. PB	O06504	V-type ATP synthase alpha chain	0.00e+00	5.86e-14	1.08e-28	NA
4. PB	Q3A944	ATP synthase subunit alpha	0.00e+00	1.19e-28	2.20e-22	NA
4. PB	O98766	ATP synthase subunit beta, chloroplastic	NA	6.61e-67	0.0	NA
4. PB	Q7ARI8	Type 3 secretion system ATPase	0.00e+00	2.77e-33	2.00e-46	NA
4. PB	A3DIM7	ATP synthase subunit alpha	0.00e+00	2.40e-26	2.72e-22	NA
4. PB	Q3B406	ATP synthase subunit beta 2	0.00e+00	8.79e-66	1.09e-158	NA
4. PB	A1VFJ3	ATP synthase subunit alpha	0.00e+00	2.96e-23	8.59e-20	NA
4. PB	Q50329	ATP synthase subunit alpha	0.00e+00	3.27e-29	4.34e-25	NA
4. PB	A0PUK2	ATP synthase subunit alpha	0.00e+00	2.30e-21	1.31e-23	NA
4. PB	B2K845	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	A3QJR0	ATP synthase subunit beta	0.00e+00	1.82e-66	0.0	NA
4. PB	Q4JUJ8	ATP synthase subunit alpha	0.00e+00	6.24e-21	2.19e-21	NA
4. PB	Q3B1F4	ATP synthase subunit alpha 2	0.00e+00	4.57e-27	5.38e-17	NA
4. PB	A5FZ52	ATP synthase subunit alpha	0.00e+00	1.02e-24	1.57e-22	NA
4. PB	A2RMI2	ATP synthase subunit beta	0.00e+00	8.62e-77	0.0	NA
4. PB	Q4UK16	ATP synthase subunit alpha	0.00e+00	1.04e-27	5.37e-26	NA
4. PB	Q07YM0	ATP synthase subunit alpha 1	0.00e+00	1.18e-31	2.10e-27	NA
4. PB	Q180W8	ATP synthase subunit alpha	0.00e+00	9.83e-31	3.01e-24	NA
4. PB	Q9GS23	ATP synthase subunit alpha, mitochondrial	0.00e+00	4.49e-18	1.26e-13	NA
4. PB	P68542	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.88e-28	1.71e-22	NA
4. PB	Q5R5V5	V-type proton ATPase subunit B, brain isoform	0.00e+00	1.27e-15	2.62e-33	NA
4. PB	P42005	ATP synthase subunit alpha	0.00e+00	1.09e-26	1.24e-21	NA
4. PB	P63675	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	A4QKR6	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.97e-26	6.25e-19	NA
4. PB	A5E948	ATP synthase subunit alpha	0.00e+00	2.02e-25	1.41e-21	NA
4. PB	Q3SF64	ATP synthase subunit alpha	0.00e+00	2.96e-23	2.55e-22	NA
4. PB	B9JTR4	ATP synthase subunit alpha	0.00e+00	3.68e-25	3.01e-22	NA
4. PB	Q31DM0	ATP synthase subunit beta	0.00e+00	9.43e-67	0.0	NA
4. PB	Q4J8L8	V-type ATP synthase beta chain	0.00e+00	1.03e-22	1.06e-39	NA
4. PB	Q05825	ATP synthase subunit beta, mitochondrial	0.00e+00	1.20e-43	0.0	NA
4. PB	P11574	V-type proton ATPase subunit B1	0.00e+00	3.18e-20	6.31e-31	NA
4. PB	Q15MU2	ATP synthase subunit alpha 2	0.00e+00	8.99e-25	2.80e-24	NA
4. PB	Q25691	V-type proton ATPase subunit B	0.00e+00	2.35e-20	6.01e-32	NA
4. PB	B4SJR9	ATP synthase subunit beta	0.00e+00	4.27e-64	0.0	NA
4. PB	Q1J8S4	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	Q90647	V-type proton ATPase catalytic subunit A	5.62e-14	1.75e-16	1.90e-32	NA
4. PB	P31400	V-type proton ATPase catalytic subunit A	3.87e-14	1.78e-16	5.14e-32	NA
4. PB	Q0C0Z8	ATP synthase subunit alpha	0.00e+00	2.11e-23	2.31e-24	NA
4. PB	Q6GEX0	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	P0ABB0	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	P08449	ATP synthase subunit alpha	0.00e+00	1.03e-27	2.86e-20	NA
4. PB	B7KUA4	ATP synthase subunit alpha	0.00e+00	1.19e-26	1.66e-21	NA
4. PB	B0KRB0	ATP synthase subunit alpha	0.00e+00	1.25e-24	2.23e-23	NA
4. PB	Q9ZLS9	Transcription termination factor Rho	1.65e-08	1.46e-05	1.59e-05	NA
4. PB	A6U3J0	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	A5CQ58	ATP synthase subunit alpha	0.00e+00	4.35e-22	1.60e-23	NA
4. PB	Q0RDB2	ATP synthase subunit alpha	0.00e+00	7.65e-22	3.13e-20	NA
4. PB	Q6LKZ6	ATP synthase subunit beta 2	0.00e+00	6.24e-68	0.0	NA
4. PB	Q06RE6	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.51e-24	9.94e-22	NA
4. PB	Q92G86	ATP synthase subunit alpha	0.00e+00	1.01e-26	1.96e-26	NA
4. PB	Q4AAV9	ATP synthase subunit alpha	0.00e+00	2.15e-26	4.87e-26	NA
4. PB	B8CVU5	ATP synthase subunit beta	0.00e+00	5.69e-66	0.0	NA
4. PB	C4ZZ12	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q5KUJ1	ATP synthase subunit alpha	0.00e+00	1.14e-27	1.52e-23	NA
4. PB	P13548	V-type proton ATPase catalytic subunit A	4.82e-14	1.56e-16	3.90e-33	NA
4. PB	A9VSA5	ATP synthase subunit alpha	0.00e+00	1.03e-27	3.05e-22	NA
4. PB	Q72J72	V-type ATP synthase alpha chain	7.55e-15	5.56e-18	7.71e-35	NA
4. PB	A4J9A1	ATP synthase subunit alpha	0.00e+00	5.75e-26	1.49e-21	NA
4. PB	Q20EV9	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.46e-31	1.27e-19	NA
4. PB	B0Z4W6	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.50e-26	1.17e-18	NA
4. PB	B8GRB8	ATP synthase subunit beta	0.00e+00	1.01e-57	0.0	NA
4. PB	Q4K3A7	ATP synthase subunit alpha	0.00e+00	8.24e-25	2.49e-22	NA
4. PB	P56466	Transcription termination factor Rho	1.50e-08	1.23e-05	1.68e-05	NA
4. PB	Q3ZZT9	ATP synthase subunit alpha	0.00e+00	5.35e-26	1.23e-21	NA
4. PB	B3EDQ7	ATP synthase subunit beta	0.00e+00	2.09e-71	0.0	NA
4. PB	Q98QB7	ATP synthase subunit alpha 2	0.00e+00	1.04e-18	2.73e-14	NA
4. PB	Q9Z993	V-type ATP synthase alpha chain	0.00e+00	1.21e-14	1.55e-23	NA
4. PB	Q9SZN1	V-type proton ATPase subunit B2	0.00e+00	8.16e-20	7.88e-32	NA
4. PB	Q92HL2	Transcription termination factor Rho	2.83e-08	1.25e-05	1.45e-04	NA
4. PB	A5G9D6	ATP synthase subunit alpha	0.00e+00	3.48e-27	1.65e-23	NA
4. PB	A6UT36	V-type ATP synthase beta chain	0.00e+00	1.36e-21	1.74e-31	NA
4. PB	A4XAW2	ATP synthase subunit beta	0.00e+00	1.61e-68	0.0	NA
4. PB	Q9TL16	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.54e-28	7.45e-20	NA
4. PB	A1AXU4	ATP synthase subunit alpha	0.00e+00	7.55e-25	2.37e-25	NA
4. PB	A4XAW4	ATP synthase subunit alpha	0.00e+00	6.88e-21	2.23e-21	NA
4. PB	B3DTV0	ATP synthase subunit beta	0.00e+00	8.97e-70	0.0	NA
4. PB	B2TP90	V-type ATP synthase beta chain	0.00e+00	5.06e-20	1.55e-32	NA
4. PB	P0C2Z6	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.42e-25	1.01e-20	NA
4. PB	A4VS62	ATP synthase subunit beta	0.00e+00	4.38e-67	0.0	NA
4. PB	Q4L7Y6	ATP synthase subunit alpha	0.00e+00	3.54e-27	5.02e-23	NA
4. PB	Q1JCL5	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	B8H5I2	ATP synthase subunit alpha	0.00e+00	8.81e-26	1.56e-19	NA
4. PB	Q62EB7	ATP synthase subunit beta 2	0.00e+00	1.32e-31	2.00e-155	NA
4. PB	Q2GGP9	ATP synthase subunit beta	0.00e+00	2.47e-56	0.0	NA
4. PB	A8W3H5	ATP synthase subunit alpha, plastid	0.00e+00	9.13e-26	1.75e-20	NA
4. PB	Q9A0I9	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	B0BBT9	V-type ATP synthase alpha chain	0.00e+00	7.62e-14	1.18e-23	NA
4. PB	A2RFC4	ATP synthase subunit alpha	0.00e+00	5.50e-28	4.39e-20	NA
4. PB	Q8S8Y3	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.79e-25	4.59e-19	NA
4. PB	A8AUJ7	V-type ATP synthase alpha chain	0.00e+00	4.55e-16	8.23e-37	NA
4. PB	P55717	Type 3 secretion system ATPase	0.00e+00	8.43e-31	6.63e-34	NA
4. PB	A9AAQ4	V-type ATP synthase alpha chain	1.61e-14	3.03e-17	6.23e-31	NA
4. PB	B9K814	V-type ATP synthase beta chain	0.00e+00	1.40e-23	6.21e-35	NA
4. PB	Q2YUJ9	ATP synthase subunit alpha	0.00e+00	4.41e-28	3.75e-25	NA
4. PB	Q663Q6	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	Q9ZD24	Transcription termination factor Rho	2.60e-08	1.10e-05	1.66e-04	NA
4. PB	Q8G7B3	ATP synthase subunit beta	0.00e+00	8.97e-70	0.0	NA
4. PB	Q9UWW8	V-type ATP synthase beta chain	0.00e+00	8.77e-21	1.69e-39	NA
4. PB	B2TJZ8	ATP synthase subunit alpha	0.00e+00	8.80e-29	9.47e-26	NA
4. PB	A7HT50	ATP synthase subunit alpha	0.00e+00	7.05e-27	1.26e-22	NA
4. PB	Q6LLG6	ATP synthase subunit alpha 1	0.00e+00	1.27e-24	7.30e-25	NA
4. PB	Q5LNN9	ATP synthase subunit alpha	0.00e+00	7.64e-26	3.32e-20	NA
4. PB	P31411	V-type proton ATPase subunit B	0.00e+00	1.26e-23	1.91e-29	NA
4. PB	B8H363	Flagellum-specific ATP synthase	0.00e+00	1.02e-36	5.56e-31	NA
4. PB	B9IRT9	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	C3KYJ1	ATP synthase subunit alpha	0.00e+00	1.21e-27	2.36e-24	NA
4. PB	B4U989	ATP synthase subunit alpha	0.00e+00	6.10e-27	6.26e-27	NA
4. PB	Q6FFK0	ATP synthase subunit beta	0.00e+00	1.10e-61	0.0	NA
4. PB	C3MQL4	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	A2RC98	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	B5RFW1	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	P31408	V-type proton ATPase subunit B, brain isoform	0.00e+00	1.80e-15	2.62e-33	NA
4. PB	Q2WGJ0	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.91e-23	9.18e-14	NA
4. PB	B0B7M4	V-type ATP synthase alpha chain	0.00e+00	7.62e-14	1.18e-23	NA
4. PB	A2BKX6	V-type ATP synthase alpha chain	2.56e-14	1.99e-17	2.32e-32	NA
4. PB	A0JY64	ATP synthase subunit beta	0.00e+00	2.97e-65	0.0	NA
4. PB	P30158	ATP synthase subunit beta, chloroplastic	0.00e+00	6.51e-75	0.0	NA
4. PB	Q7P095	ATP synthase subunit beta	0.00e+00	3.97e-60	0.0	NA
4. PB	Q8PGG7	ATP synthase subunit beta	0.00e+00	1.38e-64	0.0	NA
4. PB	A6W3S8	ATP synthase subunit beta 2	0.00e+00	1.42e-64	0.0	NA
4. PB	B5FN35	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	B7GTZ1	ATP synthase subunit alpha	0.00e+00	2.95e-21	2.70e-17	NA
4. PB	P63674	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	Q0SYU2	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	B4TAX4	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q0W362	V-type ATP synthase beta chain	0.00e+00	4.58e-22	6.15e-28	NA
4. PB	A7Z9Q0	ATP synthase subunit beta	0.00e+00	1.74e-76	0.0	NA
4. PB	O03085	ATP synthase subunit beta, chloroplastic (Fragment)	NA	7.81e-73	0.0	NA
4. PB	Q9PE85	ATP synthase subunit beta	0.00e+00	2.14e-66	0.0	NA
4. PB	B3EL39	ATP synthase subunit alpha	0.00e+00	2.00e-26	4.00e-18	NA
4. PB	Q97QA9	V-type ATP synthase beta chain	0.00e+00	2.90e-21	1.31e-27	NA
4. PB	Q2FQE9	V-type ATP synthase alpha chain 3	2.99e-14	7.94e-15	8.14e-30	NA
4. PB	Q8DDH0	ATP synthase subunit alpha	0.00e+00	1.27e-24	1.52e-27	NA
4. PB	A6VF34	ATP synthase subunit alpha	0.00e+00	2.18e-24	3.30e-24	NA
4. PB	Q2T873	ATP synthase subunit alpha 2	0.00e+00	2.57e-13	3.92e-18	NA
4. PB	Q2FL43	V-type ATP synthase alpha chain 2	6.99e-15	6.18e-16	3.57e-37	NA
4. PB	B2IQX2	ATP synthase subunit alpha	0.00e+00	6.85e-30	3.50e-19	NA
4. PB	B7KKR4	ATP synthase subunit alpha	0.00e+00	1.21e-26	1.21e-22	NA
4. PB	A3PIB7	ATP synthase subunit alpha 1	0.00e+00	9.63e-26	3.13e-18	NA
4. PB	B1MW87	ATP synthase subunit alpha	0.00e+00	9.53e-28	1.02e-19	NA
4. PB	B7J127	V-type ATP synthase alpha chain	0.00e+00	4.13e-15	2.29e-21	NA
4. PB	Q0TPW8	V-type ATP synthase beta chain	0.00e+00	1.27e-20	6.38e-34	NA
4. PB	Q9JXQ0	ATP synthase subunit alpha	0.00e+00	3.14e-25	9.95e-22	NA
4. PB	Q48333	V-type ATP synthase beta chain	0.00e+00	1.72e-21	3.49e-31	NA
4. PB	A4GAG9	ATP synthase subunit beta	0.00e+00	4.11e-66	0.0	NA
4. PB	Q65DX2	ATP synthase subunit alpha	0.00e+00	4.78e-30	1.21e-24	NA
4. PB	A4ITJ1	ATP synthase subunit alpha	0.00e+00	7.04e-29	7.41e-23	NA
4. PB	B1KXT5	V-type ATP synthase beta chain	0.00e+00	7.85e-19	2.58e-33	NA
4. PB	Q6KI79	ATP synthase subunit alpha	0.00e+00	4.62e-25	8.15e-18	NA
4. PB	A9M123	ATP synthase subunit beta	0.00e+00	7.02e-59	0.0	NA
4. PB	Q8RG42	Transcription termination factor Rho	1.62e-10	9.50e-14	3.80e-04	NA
4. PB	Q09G61	ATP synthase subunit alpha, chloroplastic	0.00e+00	9.98e-25	2.73e-19	NA
4. PB	Q98QU3	ATP synthase subunit alpha 1	0.00e+00	1.35e-23	9.70e-23	NA
4. PB	Q7MGH8	ATP synthase subunit alpha	0.00e+00	9.13e-26	1.62e-27	NA
4. PB	Q5X2Q3	ATP synthase subunit alpha 1	0.00e+00	5.78e-27	6.54e-21	NA
4. PB	A5CQ60	ATP synthase subunit beta	0.00e+00	1.30e-70	0.0	NA
4. PB	A0T0F1	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.40e-26	1.63e-17	NA
4. PB	Q9P997	V-type ATP synthase alpha chain	2.30e-08	4.80e-08	1.84e-23	NA
4. PB	P16140	V-type proton ATPase subunit B	0.00e+00	5.48e-21	8.93e-33	NA
4. PB	P83484	ATP synthase subunit beta-2, mitochondrial	0.00e+00	1.12e-18	0.0	NA
4. PB	Q3M9W0	ATP synthase subunit alpha	0.00e+00	1.21e-27	8.04e-27	NA
4. PB	P0AG30	Transcription termination factor Rho	3.86e-07	1.96e-08	0.005	NA
4. PB	B2J058	ATP synthase subunit alpha	0.00e+00	1.25e-28	1.30e-27	NA
4. PB	Q0TNC4	ATP synthase subunit beta	0.00e+00	2.00e-74	0.0	NA
4. PB	Q2NF88	V-type ATP synthase beta chain	0.00e+00	2.69e-24	9.82e-37	NA
4. PB	B8CZG7	V-type ATP synthase beta chain	0.00e+00	4.81e-22	3.13e-32	NA
4. PB	Q2IQ94	V-type ATP synthase beta chain	0.00e+00	4.30e-23	5.72e-32	NA
4. PB	Q2A1I2	ATP synthase subunit beta	0.00e+00	1.82e-67	0.0	NA
4. PB	Q8A9U7	ATP synthase subunit alpha	0.00e+00	1.23e-25	1.08e-20	NA
4. PB	A1WF58	ATP synthase subunit beta	0.00e+00	1.73e-65	0.0	NA
4. PB	Q5P9M4	ATP synthase subunit alpha	0.00e+00	1.61e-25	1.03e-24	NA
4. PB	O06505	V-type ATP synthase beta chain	0.00e+00	1.27e-19	1.65e-37	NA
4. PB	P05494	ATP synthase subunit alpha, mitochondrial	0.00e+00	4.83e-28	4.69e-22	NA
4. PB	Q00820	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.45e-27	3.48e-21	NA
4. PB	Q98QB6	ATP synthase subunit beta 2	0.00e+00	9.96e-57	4.35e-121	NA
4. PB	A8LJR6	ATP synthase subunit alpha 2	0.00e+00	2.15e-26	1.03e-17	NA
4. PB	Q1I2I7	ATP synthase subunit beta	0.00e+00	1.60e-65	0.0	NA
4. PB	O83540	V-type ATP synthase beta chain 2	0.00e+00	1.03e-21	3.95e-31	NA
4. PB	A4WN96	V-type ATP synthase alpha chain	0.00e+00	8.22e-19	3.78e-33	NA
4. PB	B2GLY8	ATP synthase subunit alpha	0.00e+00	9.35e-23	9.07e-18	NA
4. PB	Q19626	Probable V-type proton ATPase subunit B	0.00e+00	1.53e-18	6.44e-34	NA
4. PB	A7H1H9	ATP synthase subunit alpha	0.00e+00	2.02e-27	6.46e-24	NA
4. PB	A1WZT1	ATP synthase subunit beta	0.00e+00	1.37e-62	0.0	NA
4. PB	O57729	V-type ATP synthase beta chain	0.00e+00	5.87e-22	1.76e-37	NA
4. PB	Q0SSI2	V-type ATP synthase alpha chain	1.31e-13	4.68e-16	7.01e-32	NA
4. PB	A6BM08	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.65e-27	2.31e-20	NA
4. PB	Q3SF66	ATP synthase subunit beta	0.00e+00	2.82e-65	0.0	NA
4. PB	A8ZU99	ATP synthase subunit alpha	0.00e+00	2.80e-27	3.12e-16	NA
4. PB	Q1BRB0	ATP synthase subunit beta	0.00e+00	7.63e-69	0.0	NA
4. PB	Q18FB8	V-type ATP synthase beta chain	0.00e+00	2.72e-21	1.22e-29	NA
4. PB	P11592	V-type proton ATPase catalytic subunit A	1.59e-13	3.83e-19	3.41e-29	NA
4. PB	P50001	ATP synthase subunit alpha	0.00e+00	4.73e-26	7.43e-17	NA
4. PB	B0TQF4	ATP synthase subunit beta	0.00e+00	7.45e-65	0.0	NA
4. PB	A7IAU7	V-type ATP synthase beta chain	0.00e+00	7.96e-21	1.27e-31	NA
4. PB	Q43432	V-type proton ATPase subunit B 1	0.00e+00	5.93e-20	4.93e-30	NA
4. PB	B1IX04	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q97PT4	ATP synthase subunit alpha	0.00e+00	3.53e-30	1.29e-18	NA
4. PB	A7ZC35	ATP synthase subunit alpha	0.00e+00	7.44e-27	1.18e-23	NA
4. PB	A5IUQ0	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	Q1GEU6	ATP synthase subunit alpha	0.00e+00	7.11e-28	8.56e-21	NA
4. PB	P63678	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	NA
4. PB	P0DA06	V-type ATP synthase alpha chain	0.00e+00	9.89e-13	1.74e-33	NA
4. PB	A8MJW1	ATP synthase subunit alpha	0.00e+00	1.10e-28	1.01e-22	NA
4. PB	P62814	V-type proton ATPase subunit B, brain isoform	0.00e+00	7.04e-16	8.13e-33	NA
4. PB	A1UY34	ATP synthase subunit beta 2	0.00e+00	1.32e-31	2.00e-155	NA
4. PB	Q85X67	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.23e-25	6.89e-24	NA
4. PB	Q12GQ0	ATP synthase subunit beta	0.00e+00	2.55e-60	0.0	NA
4. PB	Q8YJ37	ATP synthase subunit alpha	0.00e+00	8.50e-26	1.08e-20	NA
4. PB	P37399	ATP synthase subunit beta, mitochondrial	0.00e+00	7.07e-20	0.0	NA
4. PB	A7IH29	ATP synthase subunit alpha	0.00e+00	1.90e-26	5.90e-23	NA
4. PB	Q9K4D5	ATP synthase subunit alpha	0.00e+00	2.67e-26	1.49e-17	NA
4. PB	Q87KA6	ATP synthase subunit alpha	0.00e+00	6.80e-25	3.33e-27	NA
4. PB	P52155	Transcription termination factor Rho	2.24e-08	5.43e-08	7.80e-04	NA
4. PB	Q21CY5	ATP synthase subunit alpha	0.00e+00	4.74e-27	6.66e-22	NA
4. PB	B2Y1W2	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.03e-25	5.13e-23	NA
4. PB	Q1JIX4	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	Q6AG58	ATP synthase subunit beta	0.00e+00	1.16e-70	0.0	NA
4. PB	C1CSD0	ATP synthase subunit alpha	0.00e+00	3.53e-30	1.29e-18	NA
4. PB	Q2MIK2	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.43e-25	7.16e-19	NA
4. PB	A7GV58	ATP synthase subunit alpha	0.00e+00	7.24e-28	1.48e-22	NA
4. PB	Q5F4Z0	ATP synthase subunit beta	0.00e+00	9.57e-59	0.0	NA
4. PB	P22068	ATP synthase subunit beta, mitochondrial	0.00e+00	2.73e-28	0.0	NA
4. PB	B2S1S8	V-type ATP synthase alpha chain	0.00e+00	3.63e-15	2.19e-20	NA
4. PB	B1LVH1	ATP synthase subunit alpha	0.00e+00	1.23e-25	3.77e-19	NA
4. PB	Q9A1Q3	V-type ATP synthase alpha chain	0.00e+00	9.63e-13	1.45e-33	NA
4. PB	C3P1F6	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	B0Z4N2	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.81e-26	9.15e-19	NA
4. PB	Q9MRV8	ATP synthase subunit beta, chloroplastic	NA	5.10e-65	0.0	NA
4. PB	B8JCV2	ATP synthase subunit alpha	0.00e+00	2.00e-26	6.33e-25	NA
4. PB	B0THN4	ATP synthase subunit alpha	0.00e+00	1.34e-24	5.43e-27	NA
4. PB	Q0W363	V-type ATP synthase alpha chain	6.66e-15	6.89e-17	1.46e-28	NA
4. PB	P19483	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.07e-15	5.72e-18	NA
4. PB	C5BF38	ATP synthase subunit alpha	0.00e+00	5.36e-23	2.99e-23	NA
4. PB	B8E137	V-type ATP synthase beta chain	0.00e+00	1.27e-20	3.01e-31	NA
4. PB	Q06J68	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.82e-29	1.23e-18	NA
4. PB	Q26976	V-type proton ATPase subunit B	0.00e+00	4.91e-19	1.78e-31	NA
4. PB	Q0P3K5	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.42e-27	1.08e-17	NA
4. PB	P9WPU6	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	C5C1U6	ATP synthase subunit alpha	0.00e+00	5.48e-21	6.06e-22	NA
4. PB	Q2FWE8	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	Q162S7	ATP synthase subunit alpha	0.00e+00	8.38e-25	2.35e-22	NA
4. PB	O16109	V-type proton ATPase catalytic subunit A	3.66e-14	1.29e-16	5.30e-32	NA
4. PB	P37809	ATP synthase subunit beta	0.00e+00	3.49e-76	0.0	NA
4. PB	B1KSS6	ATP synthase subunit alpha	0.00e+00	3.61e-27	2.23e-24	NA
4. PB	P38527	Transcription termination factor Rho	1.40e-08	9.77e-09	2.60e-06	NA
4. PB	Q48VL3	V-type ATP synthase alpha chain	0.00e+00	7.99e-13	1.34e-33	NA
4. PB	A2BT25	ATP synthase subunit alpha	0.00e+00	1.66e-29	1.58e-24	NA
4. PB	O32466	V-type ATP synthase alpha chain	0.00e+00	2.62e-15	1.35e-28	NA
4. PB	P05022	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.85e-26	1.15e-20	NA
4. PB	Q57670	V-type ATP synthase alpha chain	1.54e-14	1.04e-17	1.63e-29	NA
4. PB	P12405	ATP synthase subunit alpha	0.00e+00	7.51e-28	8.51e-27	NA
4. PB	Q7UH05	ATP synthase subunit alpha 1	0.00e+00	6.73e-28	7.48e-27	NA
4. PB	B7HY67	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	Q4QN62	ATP synthase subunit alpha	0.00e+00	2.50e-25	1.90e-23	NA
4. PB	Q2YLI5	ATP synthase subunit alpha	0.00e+00	1.19e-25	9.13e-21	NA
4. PB	P26854	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.56e-27	5.23e-21	NA
4. PB	Q814W0	ATP synthase subunit alpha	0.00e+00	1.28e-27	4.74e-22	NA
4. PB	Q2PMS8	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.05e-26	2.67e-19	NA
4. PB	Q9ZJJ3	Flagellum-specific ATP synthase	0.00e+00	2.52e-37	9.14e-40	NA
4. PB	Q630U1	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	A1KW13	ATP synthase subunit alpha	0.00e+00	3.03e-25	1.46e-21	NA
4. PB	Q12WL0	V-type ATP synthase beta chain	0.00e+00	2.31e-22	1.00e-29	NA
4. PB	A6W7G9	ATP synthase subunit beta	0.00e+00	2.60e-65	0.0	NA
4. PB	P47641	ATP synthase subunit alpha	0.00e+00	6.78e-29	5.43e-25	NA
4. PB	Q06FX6	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.25e-26	1.54e-19	NA
4. PB	Q65Q07	ATP synthase subunit beta	0.00e+00	1.39e-63	0.0	NA
4. PB	B8IN03	ATP synthase subunit alpha	0.00e+00	1.80e-26	4.72e-21	NA
4. PB	Q0VKX2	ATP synthase subunit alpha	0.00e+00	1.39e-24	9.36e-25	NA
4. PB	B8DRD0	ATP synthase subunit alpha	0.00e+00	1.27e-24	3.77e-22	NA
4. PB	B9DME3	ATP synthase subunit beta	0.00e+00	2.65e-72	0.0	NA
4. PB	A4FXD3	V-type ATP synthase beta chain	0.00e+00	1.47e-23	4.87e-30	NA
4. PB	Q97CQ0	V-type ATP synthase alpha chain	1.18e-07	1.54e-09	8.76e-23	NA
4. PB	P30392	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.40e-28	1.16e-19	NA
4. PB	Q06H12	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.25e-27	1.77e-19	NA
4. PB	Q3A076	ATP synthase subunit alpha 2	0.00e+00	2.85e-27	1.42e-26	NA
4. PB	Q73X57	ATP synthase subunit alpha	0.00e+00	4.98e-20	1.13e-22	NA
4. PB	Q5Z0Y3	ATP synthase subunit alpha	0.00e+00	4.43e-21	2.13e-16	NA
4. PB	B2UZJ8	ATP synthase subunit alpha	0.00e+00	5.22e-29	1.14e-25	NA
4. PB	Q5WB78	ATP synthase subunit beta	0.00e+00	9.14e-77	0.0	NA
4. PB	A6H5F1	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.24e-25	1.23e-18	NA
4. PB	Q5SCX6	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.08e-26	3.97e-21	NA
4. PB	Q9A2V9	ATP synthase subunit beta	0.00e+00	1.92e-21	0.0	NA
4. PB	Q1IWP3	V-type ATP synthase alpha chain	2.49e-14	1.87e-18	4.54e-33	NA
4. PB	Q1JDX0	V-type ATP synthase alpha chain	0.00e+00	1.62e-12	2.44e-33	NA
4. PB	Q9MRR9	ATP synthase subunit beta, chloroplastic	NA	2.53e-65	0.0	NA
4. PB	Q72XE6	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	Q8WI30	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.18e-24	1.68e-21	NA
4. PB	P9WPU5	ATP synthase subunit beta	0.00e+00	1.14e-66	0.0	NA
4. PB	Q831A3	ATP synthase subunit alpha	0.00e+00	3.75e-26	3.55e-19	NA
4. PB	P57122	ATP synthase subunit alpha	0.00e+00	2.82e-26	1.29e-24	NA
4. PB	C3K1E8	ATP synthase subunit alpha	0.00e+00	8.53e-25	8.93e-25	NA
4. PB	Q27331	V-type proton ATPase catalytic subunit A isoform 2	3.89e-14	2.38e-17	1.01e-31	NA
4. PB	Q8CNJ5	ATP synthase subunit alpha	0.00e+00	2.00e-26	1.23e-23	NA
4. PB	A0PZC6	V-type ATP synthase alpha chain	0.00e+00	4.13e-15	1.85e-35	NA
4. PB	B8HP55	ATP synthase subunit beta	0.00e+00	2.57e-73	0.0	NA
4. PB	B4RS83	ATP synthase subunit alpha	0.00e+00	8.97e-24	1.03e-25	NA
4. PB	Q9YF35	V-type ATP synthase alpha chain	2.36e-14	2.57e-16	2.37e-32	NA
4. PB	B1IJM7	V-type ATP synthase beta chain	0.00e+00	7.85e-19	2.58e-33	NA
4. PB	B0UWG7	ATP synthase subunit alpha	0.00e+00	1.52e-24	1.46e-25	NA
4. PB	P92549	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.04e-28	8.47e-24	NA
4. PB	A7M8Y9	ATP synthase subunit alpha, plastid	0.00e+00	2.92e-26	1.86e-20	NA
4. PB	Q2J3I2	ATP synthase subunit alpha	0.00e+00	2.48e-26	2.03e-22	NA
4. PB	Q87TT2	ATP synthase subunit alpha	0.00e+00	5.17e-24	9.81e-22	NA
4. PB	D1AWS1	Transcription termination factor Rho	1.30e-08	3.72e-09	0.002	NA
4. PB	B1ICT1	ATP synthase subunit alpha	0.00e+00	7.68e-30	1.48e-18	NA
4. PB	P52607	Flagellum-specific ATP synthase	0.00e+00	2.91e-36	4.27e-47	NA
4. PB	Q0SP70	V-type ATP synthase alpha chain	0.00e+00	1.88e-15	4.02e-21	NA
4. PB	Q3JXV8	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	P31405	V-type proton ATPase catalytic subunit A	3.89e-13	5.83e-16	1.82e-33	NA
4. PB	Q9RWG8	V-type ATP synthase alpha chain	8.22e-15	5.15e-18	1.20e-32	NA
4. PB	Q1GQS7	ATP synthase subunit alpha	0.00e+00	2.46e-25	1.99e-21	NA
4. PB	B1LL61	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q603U2	ATP synthase subunit alpha 2	0.00e+00	5.28e-27	2.16e-15	NA
4. PB	A0ZZ20	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.08e-26	2.49e-20	NA
4. PB	C1CXU3	V-type ATP synthase alpha chain	1.07e-14	7.46e-16	7.10e-32	NA
4. PB	Q88UU1	ATP synthase subunit alpha	0.00e+00	1.17e-25	9.77e-21	NA
4. PB	A4IW24	ATP synthase subunit beta	0.00e+00	9.17e-67	0.0	NA
4. PB	Q9XPJ9	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.53e-25	1.14e-17	NA
4. PB	Q7VPP2	ATP synthase subunit alpha	0.00e+00	1.97e-23	1.65e-25	NA
4. PB	A0K2Y3	ATP synthase subunit beta	0.00e+00	7.63e-69	0.0	NA
4. PB	Q5JIR3	V-type ATP synthase alpha chain	0.00e+00	1.05e-14	1.11e-28	NA
4. PB	C0RF52	ATP synthase subunit alpha	0.00e+00	8.50e-26	1.08e-20	NA
4. PB	P31406	V-type proton ATPase catalytic subunit A	1.26e-12	1.21e-18	1.66e-27	NA
4. PB	A5CVI6	ATP synthase subunit beta	0.00e+00	6.18e-66	0.0	NA
4. PB	Q82XP8	ATP synthase subunit beta	0.00e+00	1.57e-68	0.0	NA
4. PB	A4JA35	ATP synthase subunit beta	0.00e+00	4.73e-68	0.0	NA
4. PB	A4SGM9	ATP synthase subunit alpha	0.00e+00	1.42e-26	6.57e-18	NA
4. PB	O29101	V-type ATP synthase alpha chain	1.07e-14	7.04e-16	3.71e-31	NA
4. PB	B1HM54	ATP synthase subunit alpha	0.00e+00	8.17e-29	2.94e-24	NA
4. PB	Q9UXU8	V-type ATP synthase beta chain	0.00e+00	3.03e-20	4.51e-38	NA
4. PB	Q2MIB5	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.43e-25	7.16e-19	NA
4. PB	P80153	Type 3 secretion system ATPase	0.00e+00	4.83e-33	1.83e-43	NA
4. PB	B5FCZ3	ATP synthase subunit alpha	0.00e+00	4.16e-25	1.87e-27	NA
4. PB	Q14K08	ATP synthase subunit alpha	0.00e+00	9.71e-28	1.69e-25	NA
4. PB	A0R202	ATP synthase subunit alpha	0.00e+00	2.90e-21	2.25e-21	NA
4. PB	P00830	ATP synthase subunit beta, mitochondrial	0.00e+00	2.68e-36	0.0	NA
4. PB	A2C6X5	ATP synthase subunit alpha	0.00e+00	1.57e-28	7.74e-21	NA
4. PB	P0AG33	Transcription termination factor Rho	3.73e-07	1.96e-08	0.005	NA
4. PB	Q332Y4	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.62e-25	3.80e-18	NA
4. PB	Q6LYE6	V-type ATP synthase beta chain	0.00e+00	1.12e-23	1.67e-29	NA
4. PB	A4QK90	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.35e-26	7.83e-19	NA
4. PB	A4QJR8	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.97e-26	6.94e-19	NA
4. PB	P12112	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.16e-25	7.16e-21	NA
4. PB	Q1MRB9	ATP synthase subunit alpha	0.00e+00	1.25e-27	1.17e-19	NA
4. PB	Q2J6N1	ATP synthase subunit alpha	0.00e+00	9.17e-22	3.92e-22	NA
4. PB	B7HFK4	ATP synthase subunit alpha	0.00e+00	1.94e-27	2.91e-22	NA
4. PB	Q9K6H3	ATP synthase subunit alpha	0.00e+00	1.02e-29	1.57e-24	NA
4. PB	P0ABB1	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	B3PQ70	ATP synthase subunit alpha	0.00e+00	4.73e-26	1.59e-21	NA
4. PB	Q0I5X1	ATP synthase subunit alpha	0.00e+00	1.52e-24	1.46e-25	NA
4. PB	Q2S6N9	ATP synthase subunit alpha 2	0.00e+00	7.31e-27	1.47e-24	NA
4. PB	A0LSL4	ATP synthase subunit alpha	0.00e+00	3.69e-22	3.08e-21	NA
4. PB	Q1JIX5	V-type ATP synthase alpha chain	0.00e+00	1.22e-12	2.33e-33	NA
4. PB	Q73M28	V-type ATP synthase alpha chain	0.00e+00	4.82e-17	1.56e-19	NA
4. PB	Q6CFT7	ATP synthase subunit beta, mitochondrial	0.00e+00	9.34e-37	0.0	NA
4. PB	A6MMS9	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.21e-25	2.39e-19	NA
4. PB	Q0BK84	ATP synthase subunit beta	0.00e+00	1.82e-67	0.0	NA
4. PB	Q43433	V-type proton ATPase subunit B 2 (Fragment)	0.00e+00	7.45e-03	1.59e-29	NA
4. PB	C3PFR3	ATP synthase subunit alpha	0.00e+00	2.23e-21	3.83e-25	NA
4. PB	Q8KDL4	ATP synthase subunit beta 1	0.00e+00	5.72e-59	1.87e-155	NA
4. PB	Q01915	ATP synthase subunit alpha, mitochondrial	0.00e+00	3.73e-29	2.24e-22	NA
4. PB	B6YR06	ATP synthase subunit alpha	0.00e+00	2.25e-27	2.68e-24	NA
4. PB	Q83HY2	ATP synthase subunit alpha	0.00e+00	1.30e-26	1.38e-18	NA
4. PB	Q26975	V-type proton ATPase catalytic subunit A	3.32e-14	2.81e-17	9.39e-34	NA
4. PB	B9KH09	ATP synthase subunit alpha	0.00e+00	1.61e-25	1.03e-24	NA
4. PB	A1R7V5	ATP synthase subunit alpha	0.00e+00	9.96e-22	2.37e-21	NA
4. PB	Q2FWF0	ATP synthase subunit beta	0.00e+00	8.44e-75	0.0	NA
4. PB	A7IAU8	V-type ATP synthase alpha chain	1.14e-14	7.04e-19	4.93e-31	NA
4. PB	A5U207	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	A8AUJ8	V-type ATP synthase beta chain	0.00e+00	5.77e-22	1.90e-31	NA
4. PB	Q1QSD0	ATP synthase subunit beta	0.00e+00	5.25e-63	0.0	NA
4. PB	B0Z5D4	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.81e-26	9.15e-19	NA
4. PB	A1A3C7	ATP synthase subunit alpha	0.00e+00	1.54e-20	1.62e-18	NA
4. PB	Q8ZYR1	V-type ATP synthase alpha chain	0.00e+00	9.75e-19	1.80e-32	NA
4. PB	Q3ZJ00	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.35e-28	5.39e-19	NA
4. PB	C1F3N8	ATP synthase subunit alpha	0.00e+00	2.54e-20	1.38e-24	NA
4. PB	A8F3K0	ATP synthase subunit alpha	0.00e+00	1.30e-26	1.47e-22	NA
4. PB	Q5JIR2	V-type ATP synthase beta chain	0.00e+00	1.15e-20	1.27e-36	NA
4. PB	Q02BU1	ATP synthase subunit beta	0.00e+00	1.06e-71	0.0	NA
4. PB	A7Y3A4	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.71e-25	1.75e-20	NA
4. PB	C3LFI1	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	Q8SQU9	V-type proton ATPase catalytic subunit A	4.52e-14	5.04e-17	2.43e-29	NA
4. PB	A7FQH7	ATP synthase subunit alpha	0.00e+00	1.21e-27	2.36e-24	NA
4. PB	B8J437	ATP synthase subunit alpha	0.00e+00	1.11e-26	1.68e-21	NA
4. PB	Q06735	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.08e-28	1.40e-22	NA
4. PB	P72245	ATP synthase subunit alpha	0.00e+00	8.76e-27	2.51e-21	NA
4. PB	B1KXT6	V-type ATP synthase alpha chain	3.94e-13	2.58e-15	2.77e-32	NA
4. PB	Q9HM64	V-type ATP synthase beta chain	0.00e+00	3.34e-22	1.59e-39	NA
4. PB	P21281	V-type proton ATPase subunit B, brain isoform	0.00e+00	6.94e-16	2.38e-33	NA
4. PB	Q2N8Z5	ATP synthase subunit alpha	0.00e+00	7.38e-26	5.75e-19	NA
4. PB	C6E9F3	ATP synthase subunit alpha	0.00e+00	1.06e-27	9.85e-21	NA
4. PB	B2SEY1	ATP synthase subunit beta	0.00e+00	3.82e-67	0.0	NA
4. PB	P56294	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.80e-29	1.93e-21	NA
4. PB	Q8KAC9	ATP synthase subunit beta 2	0.00e+00	1.49e-73	0.0	NA
4. PB	Q891P2	V-type ATP synthase beta chain 2	0.00e+00	1.12e-20	2.37e-35	NA
4. PB	A6GVV9	ATP synthase subunit beta	0.00e+00	2.28e-57	0.0	NA
4. PB	P42468	ATP synthase subunit beta	0.00e+00	2.51e-68	0.0	NA
4. PB	Q3IK48	ATP synthase subunit alpha	0.00e+00	1.89e-25	3.76e-25	NA
4. PB	Q4FQ37	ATP synthase subunit beta	0.00e+00	1.48e-60	0.0	NA
4. PB	Q896K3	V-type ATP synthase beta chain 1	0.00e+00	5.58e-22	2.16e-32	NA
4. PB	Q9XW92	V-type proton ATPase catalytic subunit A	3.05e-14	5.26e-15	5.37e-33	NA
4. PB	Q57669	V-type ATP synthase beta chain	0.00e+00	2.34e-24	4.34e-34	NA
4. PB	Q8E8B8	ATP synthase subunit alpha	0.00e+00	1.45e-23	5.11e-25	NA
4. PB	Q822J8	V-type ATP synthase alpha chain	0.00e+00	7.29e-15	1.07e-22	NA
4. PB	Q0AEI9	ATP synthase subunit alpha 2	0.00e+00	1.04e-27	3.77e-20	NA
4. PB	Q8YAM8	ATP synthase subunit alpha 1	0.00e+00	1.35e-27	2.34e-13	NA
4. PB	Q49L13	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.74e-27	8.42e-19	NA
4. PB	B2I100	ATP synthase subunit alpha	0.00e+00	2.26e-23	1.06e-22	NA
4. PB	A1RSF1	V-type ATP synthase alpha chain	0.00e+00	2.43e-18	4.46e-32	NA
4. PB	A6TK63	ATP synthase subunit alpha	0.00e+00	4.33e-29	3.42e-21	NA
4. PB	P05492	ATP synthase subunit alpha, mitochondrial	0.00e+00	3.66e-28	2.40e-21	NA
4. PB	Q3J9F3	V-type ATP synthase alpha chain	0.00e+00	2.20e-15	4.63e-24	NA
4. PB	Q46FH3	V-type ATP synthase alpha chain	1.55e-15	1.76e-17	1.23e-32	NA
4. PB	Q0BQE6	ATP synthase subunit alpha	0.00e+00	8.45e-27	2.33e-21	NA
4. PB	A4Y187	ATP synthase subunit beta	0.00e+00	1.24e-64	0.0	NA
4. PB	P0AG31	Transcription termination factor Rho	4.00e-07	1.96e-08	0.005	NA
4. PB	A3NF40	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	Q2GHX3	ATP synthase subunit alpha	0.00e+00	1.63e-29	2.81e-26	NA
4. PB	A1BJF5	ATP synthase subunit alpha	0.00e+00	3.49e-26	1.71e-18	NA
4. PB	A3CK48	V-type ATP synthase alpha chain	0.00e+00	1.58e-15	8.81e-37	NA
4. PB	Q9TM26	ATP synthase subunit alpha, chloroplastic	0.00e+00	9.02e-28	1.25e-23	NA
4. PB	Q9PK85	V-type ATP synthase alpha chain	0.00e+00	3.82e-14	7.88e-24	NA
4. PB	P0C522	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.05e-27	4.10e-22	NA
4. PB	B4RD45	ATP synthase subunit alpha	0.00e+00	6.75e-26	4.05e-19	NA
4. PB	A8GPZ6	ATP synthase subunit alpha	0.00e+00	5.57e-27	9.89e-27	NA
4. PB	Q1B551	ATP synthase subunit alpha	0.00e+00	1.14e-18	2.38e-21	NA
4. PB	B0UE41	ATP synthase subunit alpha	0.00e+00	1.64e-26	6.50e-22	NA
4. PB	A9A2Q9	V-type ATP synthase beta chain	0.00e+00	5.30e-21	1.94e-37	NA
4. PB	A9M121	ATP synthase subunit alpha	0.00e+00	2.78e-25	1.86e-21	NA
4. PB	Q5XE50	V-type ATP synthase alpha chain	0.00e+00	9.63e-13	1.45e-33	NA
4. PB	Q4A604	ATP synthase subunit beta	0.00e+00	5.89e-76	0.0	NA
4. PB	Q313V8	ATP synthase subunit alpha	0.00e+00	2.13e-25	2.78e-21	NA
4. PB	A8L3W3	ATP synthase subunit alpha	0.00e+00	4.02e-21	1.30e-20	NA
4. PB	P0DA02	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	B1ZEE9	ATP synthase subunit alpha	0.00e+00	4.03e-26	1.16e-20	NA
4. PB	Q57B86	ATP synthase subunit alpha	0.00e+00	1.19e-25	9.13e-21	NA
4. PB	A6UP54	V-type ATP synthase alpha chain	1.23e-14	2.53e-16	1.46e-29	NA
4. PB	Q3SVJ4	ATP synthase subunit alpha	0.00e+00	2.41e-25	6.65e-24	NA
4. PB	P68541	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.88e-28	1.71e-22	NA
4. PB	Q7NCS3	ATP synthase subunit alpha	0.00e+00	4.84e-23	7.89e-21	NA
4. PB	A1KI96	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	B2HQK4	ATP synthase subunit alpha	0.00e+00	1.48e-21	9.48e-24	NA
4. PB	Q8TIJ0	V-type ATP synthase beta chain	0.00e+00	2.41e-23	7.04e-29	NA
4. PB	Q1JDW9	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	A0B9K2	V-type ATP synthase alpha chain	1.42e-14	2.58e-19	5.51e-32	NA
4. PB	A1A3C5	ATP synthase subunit beta	0.00e+00	2.71e-64	0.0	NA
4. PB	Q14K06	ATP synthase subunit beta	0.00e+00	9.17e-67	0.0	NA
4. PB	Q5HE95	ATP synthase subunit alpha	0.00e+00	3.28e-28	6.84e-25	NA
4. PB	B0U598	ATP synthase subunit beta	0.00e+00	1.46e-66	0.0	NA
4. PB	Q7YJY4	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.88e-26	4.11e-19	NA
4. PB	A3MXY7	V-type ATP synthase alpha chain	0.00e+00	1.38e-17	7.96e-33	NA
4. PB	Q0AJB0	ATP synthase subunit beta 1	0.00e+00	2.46e-67	0.0	NA
4. PB	Q1JMJ1	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	Q6YXK3	ATP synthase subunit alpha, chloroplastic	0.00e+00	6.56e-25	1.28e-22	NA
4. PB	Q89A22	Transcription termination factor Rho	2.25e-08	7.80e-08	0.038	NA
4. PB	Q1JHN7	ATP synthase subunit alpha	0.00e+00	5.50e-28	4.39e-20	NA
4. PB	P18260	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.19e-27	2.29e-20	NA
4. PB	Q2NF87	V-type ATP synthase alpha chain	2.16e-14	6.03e-17	3.90e-30	NA
4. PB	B6JD06	ATP synthase subunit alpha	0.00e+00	6.75e-26	1.58e-21	NA
4. PB	P00827	ATP synthase subunit beta, chloroplastic	0.00e+00	2.19e-69	0.0	NA
4. PB	Q3J9F4	V-type ATP synthase beta chain	0.00e+00	3.07e-22	3.34e-36	NA
4. PB	A2SST5	V-type ATP synthase alpha chain	9.10e-15	1.80e-15	1.40e-28	NA
4. PB	Q6LKZ8	ATP synthase subunit alpha 2	0.00e+00	4.02e-25	8.16e-25	NA
4. PB	P27179	ATP synthase subunit alpha	0.00e+00	3.61e-27	8.41e-23	NA
4. PB	Q9Z689	ATP synthase subunit alpha	0.00e+00	2.75e-27	2.42e-25	NA
4. PB	B4F0E5	ATP synthase subunit alpha	0.00e+00	1.11e-24	8.08e-25	NA
4. PB	Q0AJB2	ATP synthase subunit alpha 1	0.00e+00	3.69e-23	6.62e-26	NA
4. PB	A7H019	ATP synthase subunit alpha	0.00e+00	5.38e-27	1.53e-23	NA
4. PB	A0RL97	ATP synthase subunit alpha	0.00e+00	3.24e-27	5.07e-22	NA
4. PB	P0C520	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.05e-27	4.10e-22	NA
4. PB	Q1WUC8	ATP synthase subunit alpha	0.00e+00	3.01e-27	6.91e-22	NA
4. PB	A1QYP3	V-type ATP synthase alpha chain	0.00e+00	8.52e-15	2.04e-19	NA
4. PB	A9AJG4	ATP synthase subunit beta	0.00e+00	2.19e-69	0.0	NA
4. PB	C1AMV2	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	B1IJM8	V-type ATP synthase alpha chain	1.53e-13	9.95e-15	2.91e-32	NA
4. PB	A5IYE3	ATP synthase subunit alpha	0.00e+00	1.30e-24	7.49e-23	NA
4. PB	Q6MAK5	ATP synthase subunit alpha	0.00e+00	2.66e-31	3.20e-21	NA
4. PB	Q9MU30	ATP synthase subunit beta, chloroplastic	NA	9.03e-66	0.0	NA
4. PB	C3NGV1	V-type ATP synthase alpha chain	4.35e-14	2.43e-18	1.33e-32	NA
4. PB	B7NF50	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A6L8N5	ATP synthase subunit alpha	0.00e+00	1.51e-27	1.11e-21	NA
4. PB	A0RR28	ATP synthase subunit alpha	0.00e+00	4.33e-28	2.18e-24	NA
4. PB	A2S6J8	ATP synthase subunit beta	0.00e+00	6.51e-65	0.0	NA
4. PB	Q72J73	V-type ATP synthase beta chain	0.00e+00	1.63e-21	2.46e-33	NA
4. PB	B3EU98	ATP synthase subunit alpha	0.00e+00	2.46e-23	1.98e-18	NA
4. PB	Q83AF7	ATP synthase subunit alpha	0.00e+00	5.32e-25	3.82e-27	NA
4. PB	A3DHP0	V-type ATP synthase alpha chain	8.10e-15	1.18e-14	2.37e-32	NA
4. PB	A5FLS1	ATP synthase subunit beta	0.00e+00	1.88e-59	0.0	NA
4. PB	Q56403	V-type ATP synthase alpha chain	6.99e-15	3.01e-18	2.01e-34	NA
4. PB	Q2SNG7	ATP synthase subunit alpha 1	0.00e+00	3.47e-28	7.48e-18	NA
4. PB	B9KPI6	ATP synthase subunit alpha	0.00e+00	9.63e-26	3.13e-18	NA
4. PB	A8AC29	V-type ATP synthase alpha chain	0.00e+00	1.09e-17	5.15e-32	NA
4. PB	B0JWV1	ATP synthase subunit alpha	0.00e+00	7.11e-28	4.98e-23	NA
4. PB	B5Y8B6	V-type ATP synthase beta chain	0.00e+00	1.12e-19	7.07e-31	NA
4. PB	B2S7M5	ATP synthase subunit alpha	0.00e+00	1.19e-25	9.13e-21	NA
4. PB	A0B9K1	V-type ATP synthase beta chain	0.00e+00	3.32e-19	4.45e-29	NA
4. PB	Q87E90	ATP synthase subunit beta	0.00e+00	2.38e-66	0.0	NA
4. PB	A1B8N8	ATP synthase subunit alpha	0.00e+00	2.78e-28	9.31e-22	NA
4. PB	Q5X0P3	ATP synthase subunit beta	0.00e+00	9.04e-64	0.0	NA
4. PB	P40291	Type 3 secretion system ATPase	0.00e+00	2.77e-33	2.00e-46	NA
4. PB	A8AAA9	V-type ATP synthase beta chain	0.00e+00	4.84e-23	9.73e-37	NA
4. PB	Q8DLP3	ATP synthase subunit alpha	0.00e+00	9.36e-28	3.52e-23	NA
4. PB	Q9PJ21	ATP synthase subunit alpha	0.00e+00	3.95e-27	1.55e-24	NA
4. PB	Q2ST36	ATP synthase subunit alpha	0.00e+00	2.11e-24	3.46e-26	NA
4. PB	A4YKD8	ATP synthase subunit alpha	0.00e+00	2.13e-25	1.26e-21	NA
4. PB	C0HK52	ATP synthase subunit beta, mitochondrial	0.00e+00	2.81e-69	0.0	NA
4. PB	A2C4J5	ATP synthase subunit alpha	0.00e+00	1.59e-27	5.29e-21	NA
4. PB	O27036	V-type ATP synthase alpha chain	7.77e-15	1.58e-17	6.04e-30	NA
4. PB	A8GTS8	ATP synthase subunit alpha	0.00e+00	6.21e-27	3.51e-26	NA
4. PB	B1W0A5	ATP synthase subunit alpha	0.00e+00	4.10e-26	4.58e-18	NA
4. PB	Q6LYE7	V-type ATP synthase alpha chain	8.99e-15	7.89e-18	5.15e-31	NA
4. PB	P15313	V-type proton ATPase subunit B, kidney isoform	0.00e+00	1.12e-18	2.88e-32	NA
4. PB	B0RED6	ATP synthase subunit alpha	0.00e+00	3.63e-22	2.10e-23	NA
4. PB	Q9HT20	ATP synthase subunit beta	0.00e+00	1.63e-63	0.0	NA
4. PB	A1TJ41	ATP synthase subunit beta	0.00e+00	4.34e-70	0.0	NA
4. PB	Q3J433	ATP synthase subunit alpha	0.00e+00	9.63e-26	3.13e-18	NA
4. PB	Q6NDD0	ATP synthase subunit alpha	0.00e+00	6.51e-26	8.46e-24	NA
4. PB	A9NBD0	ATP synthase subunit beta	0.00e+00	4.59e-70	0.0	NA
4. PB	Q09MJ3	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.44e-26	4.04e-19	NA
4. PB	A8F2U2	ATP synthase subunit alpha	0.00e+00	3.24e-27	3.17e-26	NA
4. PB	Q38680	V-type proton ATPase subunit B 2	0.00e+00	4.90e-20	5.71e-29	NA
4. PB	Q5LD82	ATP synthase subunit alpha	0.00e+00	1.34e-24	5.40e-21	NA
4. PB	B1ICC8	V-type ATP synthase beta chain	0.00e+00	4.50e-21	1.20e-27	NA
4. PB	Q5WSG6	ATP synthase subunit alpha	0.00e+00	3.31e-26	1.09e-20	NA
4. PB	Q5TTG1	V-type proton ATPase catalytic subunit A	4.56e-14	4.89e-17	1.15e-31	NA
4. PB	B4SGC7	ATP synthase subunit alpha	0.00e+00	2.62e-26	1.95e-18	NA
4. PB	B3PIS7	ATP synthase subunit beta	0.00e+00	1.50e-64	0.0	NA
4. PB	B7IQW0	ATP synthase subunit alpha	0.00e+00	2.51e-27	5.16e-22	NA
4. PB	A7FWQ7	V-type ATP synthase alpha chain	1.46e-13	1.56e-16	2.77e-31	NA
4. PB	A6L4M4	ATP synthase subunit alpha	0.00e+00	2.29e-25	5.95e-17	NA
4. PB	A7Z9Q2	ATP synthase subunit alpha	0.00e+00	4.41e-29	8.80e-25	NA
4. PB	Q38681	V-type proton ATPase subunit B 1	0.00e+00	1.38e-19	5.55e-30	NA
4. PB	A8FJR0	ATP synthase subunit alpha	0.00e+00	3.95e-27	1.55e-24	NA
4. PB	B1YC22	V-type ATP synthase alpha chain	0.00e+00	1.73e-18	1.97e-34	NA
4. PB	Q5SCV8	ATP synthase subunit beta, chloroplastic	0.00e+00	1.68e-65	0.0	NA
4. PB	Q82J82	ATP synthase subunit alpha	0.00e+00	3.19e-26	3.23e-18	NA
4. PB	P9WPU7	ATP synthase subunit alpha	0.00e+00	1.10e-21	1.13e-23	NA
4. PB	P63676	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	Q630U3	ATP synthase subunit beta	0.00e+00	1.18e-77	0.0	NA
4. PB	P08215	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.82e-25	3.23e-19	NA
4. PB	A5EXJ7	ATP synthase subunit alpha	0.00e+00	1.86e-26	2.33e-23	NA
4. PB	A9W2R3	ATP synthase subunit alpha	0.00e+00	1.19e-26	1.66e-21	NA
4. PB	B2KEX0	ATP synthase subunit alpha	0.00e+00	9.84e-29	2.19e-23	NA
4. PB	C4LJL4	ATP synthase subunit beta	0.00e+00	1.67e-73	0.0	NA
4. PB	Q1J8S5	V-type ATP synthase alpha chain	0.00e+00	9.63e-13	1.45e-33	NA
4. PB	A7G9Q7	ATP synthase subunit alpha	0.00e+00	1.37e-28	1.54e-24	NA
4. PB	B0R754	V-type ATP synthase beta chain	0.00e+00	1.50e-21	4.28e-31	NA
4. PB	A5CYE4	ATP synthase subunit alpha	0.00e+00	1.23e-27	1.64e-23	NA
4. PB	C0R2Y2	ATP synthase subunit alpha	0.00e+00	2.25e-29	4.68e-26	NA
4. PB	Q8UC74	ATP synthase subunit alpha	0.00e+00	4.90e-26	1.17e-21	NA
4. PB	Q184E3	V-type ATP synthase beta chain	0.00e+00	3.87e-22	2.26e-32	NA
4. PB	P48602	V-type proton ATPase catalytic subunit A isoform 1	3.44e-14	9.28e-17	1.45e-31	NA
4. PB	Q13SQ2	ATP synthase subunit beta 2	0.00e+00	2.25e-68	0.0	NA
4. PB	A1SS62	ATP synthase subunit alpha 1	0.00e+00	6.06e-26	1.32e-26	NA
4. PB	Q223D6	ATP synthase subunit beta 1	0.00e+00	1.45e-71	0.0	NA
4. PB	Q834X8	V-type ATP synthase beta chain	0.00e+00	4.01e-22	7.11e-27	NA
4. PB	C3MW92	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	P26465	Flagellum-specific ATP synthase	0.00e+00	7.44e-29	3.55e-31	NA
4. PB	P0CAT8	Flagellum-specific ATP synthase	0.00e+00	1.02e-36	5.56e-31	NA
4. PB	Q9SM09	V-type proton ATPase catalytic subunit A	4.60e-14	2.65e-16	1.43e-33	NA
4. PB	Q72E02	ATP synthase subunit alpha	0.00e+00	2.96e-23	8.59e-20	NA
4. PB	B3QWX7	ATP synthase subunit alpha	0.00e+00	1.74e-22	9.70e-19	NA
4. PB	Q1LTV2	ATP synthase subunit alpha	0.00e+00	1.48e-28	3.03e-25	NA
4. PB	C5A337	V-type ATP synthase beta chain	0.00e+00	2.16e-20	6.84e-37	NA
4. PB	Q9RWG7	V-type ATP synthase beta chain	0.00e+00	2.95e-21	2.15e-35	NA
4. PB	P08428	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.16e-14	3.77e-16	NA
4. PB	Q83G89	ATP synthase subunit alpha	0.00e+00	1.30e-26	1.38e-18	NA
4. PB	Q5H4Y4	ATP synthase subunit beta	0.00e+00	4.76e-64	0.0	NA
4. PB	P24459	ATP synthase subunit alpha, mitochondrial	0.00e+00	7.87e-29	2.14e-22	NA
4. PB	Q6AQ12	ATP synthase subunit alpha	0.00e+00	1.28e-29	1.50e-16	NA
4. PB	Q2JIG0	ATP synthase subunit alpha	0.00e+00	8.30e-27	8.92e-21	NA
4. PB	B1JFU1	ATP synthase subunit beta	0.00e+00	1.00e-64	0.0	NA
4. PB	A5CD07	ATP synthase subunit alpha	0.00e+00	7.42e-25	3.94e-28	NA
4. PB	C4K229	ATP synthase subunit alpha	0.00e+00	1.01e-26	1.75e-26	NA
4. PB	A7FWQ6	V-type ATP synthase beta chain	0.00e+00	9.31e-19	2.20e-33	NA
4. PB	Q8P1K6	ATP synthase subunit alpha	0.00e+00	4.66e-28	5.54e-20	NA
4. PB	A1VXI8	ATP synthase subunit alpha	0.00e+00	3.06e-27	1.75e-24	NA
4. PB	C0Q2N4	ATP synthase subunit alpha	0.00e+00	3.17e-23	1.08e-22	NA
4. PB	A1ALL5	ATP synthase subunit alpha	0.00e+00	2.10e-25	1.50e-18	NA
4. PB	Q0HD77	ATP synthase subunit alpha	0.00e+00	1.31e-23	1.40e-24	NA
4. PB	A1XFU0	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.20e-25	1.47e-19	NA
4. PB	A7NEH4	ATP synthase subunit beta	0.00e+00	1.82e-67	0.0	NA
4. PB	Q9MTX9	ATP synthase subunit beta, chloroplastic	NA	1.57e-68	0.0	NA
4. PB	B9LZ86	ATP synthase subunit alpha	0.00e+00	1.11e-26	6.26e-24	NA
4. PB	P05493	ATP synthase subunit alpha, mitochondrial	0.00e+00	1.37e-28	2.63e-22	NA
4. PB	C3N6D4	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	Q9UVJ8	V-type proton ATPase catalytic subunit A	6.12e-13	3.12e-17	1.70e-27	NA
4. PB	A1RX21	V-type ATP synthase alpha chain	1.77e-14	1.63e-17	5.42e-25	NA
4. PB	A0M6G4	ATP synthase subunit alpha	0.00e+00	9.29e-26	2.11e-18	NA
4. PB	A6T470	ATP synthase subunit beta	0.00e+00	1.58e-66	0.0	NA
4. PB	Q7UFB7	ATP synthase subunit alpha 2	0.00e+00	9.24e-27	1.76e-13	NA
4. PB	Q8KAW8	ATP synthase subunit alpha	0.00e+00	3.31e-26	5.20e-19	NA
4. PB	O50288	ATP synthase subunit alpha	0.00e+00	2.99e-28	1.73e-24	NA
4. PB	B8DWS4	ATP synthase subunit alpha	0.00e+00	7.61e-19	3.41e-19	NA
4. PB	Q2VZN0	ATP synthase subunit alpha	0.00e+00	8.06e-26	2.21e-23	NA
4. PB	Q79VG7	ATP synthase subunit alpha	0.00e+00	1.93e-23	4.25e-22	NA
4. PB	B5BIN8	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q98EV6	ATP synthase subunit alpha	0.00e+00	1.21e-26	4.00e-23	NA
4. PB	A5CVI8	ATP synthase subunit alpha	0.00e+00	4.90e-26	3.06e-22	NA
4. PB	Q47M82	ATP synthase subunit beta	0.00e+00	2.88e-73	0.0	NA
4. PB	Q39442	V-type proton ATPase catalytic subunit A	3.84e-14	1.38e-17	2.26e-34	NA
4. PB	P57178	Flagellum-specific ATP synthase	0.00e+00	3.81e-25	7.07e-38	NA
4. PB	B7HY64	ATP synthase subunit beta	0.00e+00	1.49e-77	0.0	NA
4. PB	Q38677	V-type proton ATPase catalytic subunit A isoform 2	5.19e-13	7.04e-16	3.23e-33	NA
4. PB	Q88BX2	ATP synthase subunit alpha	0.00e+00	4.09e-25	1.43e-23	NA
4. PB	Q8EWZ0	ATP synthase subunit alpha	0.00e+00	1.56e-30	5.41e-24	NA
4. PB	Q3KM54	V-type ATP synthase alpha chain	0.00e+00	5.11e-14	1.39e-23	NA
4. PB	P35110	ATP synthase subunit beta	0.00e+00	1.54e-70	0.0	NA
4. PB	A6LQH4	ATP synthase subunit alpha	0.00e+00	5.78e-30	1.34e-26	NA
4. PB	Q11DD7	ATP synthase subunit alpha	0.00e+00	6.33e-27	5.27e-21	NA
4. PB	Q12WL1	V-type ATP synthase alpha chain	1.03e-14	5.39e-18	2.48e-32	NA
4. PB	P17674	ATP synthase subunit alpha	0.00e+00	3.34e-28	6.22e-23	NA
4. PB	Q62FR5	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	B2I877	ATP synthase subunit beta	0.00e+00	2.38e-66	0.0	NA
4. PB	A1UR47	ATP synthase subunit alpha	0.00e+00	6.92e-25	4.86e-21	NA
4. PB	A8Z5R1	ATP synthase subunit alpha	0.00e+00	6.02e-28	7.02e-20	NA
4. PB	A8YUJ9	ATP synthase subunit alpha	0.00e+00	3.47e-28	7.80e-20	NA
4. PB	Q30QP9	ATP synthase subunit alpha	0.00e+00	1.26e-26	1.25e-25	NA
4. PB	Q89X72	ATP synthase subunit alpha	0.00e+00	2.08e-26	1.11e-20	NA
4. PB	Q5FRC7	ATP synthase subunit alpha 1	0.00e+00	1.13e-25	1.44e-20	NA
4. PB	P19023	ATP synthase subunit beta, mitochondrial	0.00e+00	1.47e-19	0.0	NA
4. PB	A8EV72	ATP synthase subunit alpha	0.00e+00	8.76e-27	2.02e-25	NA
4. PB	Q814W2	ATP synthase subunit beta	0.00e+00	1.63e-77	0.0	NA
4. PB	A1VPQ8	ATP synthase subunit alpha 2	0.00e+00	2.46e-27	8.58e-23	NA
4. PB	Q1CCH3	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	Q1QSC8	ATP synthase subunit alpha	0.00e+00	7.72e-27	5.15e-24	NA
4. PB	A0Q8D9	ATP synthase subunit beta	0.00e+00	1.87e-66	0.0	NA
4. PB	Q8MBG5	ATP synthase subunit beta, plastid	NA	5.74e-68	0.0	NA
4. PB	Q0A4M6	ATP synthase subunit alpha	0.00e+00	4.24e-25	1.33e-21	NA
4. PB	B2UUP2	ATP synthase subunit alpha	0.00e+00	4.02e-25	6.37e-27	NA
4. PB	Q3ITC7	V-type ATP synthase beta chain	0.00e+00	1.86e-22	7.03e-31	NA
4. PB	Q896K4	V-type ATP synthase alpha chain 1	0.00e+00	1.95e-14	1.30e-34	NA
4. PB	B0R755	V-type ATP synthase alpha chain	3.05e-14	2.20e-15	2.35e-29	NA
4. PB	B0K8E7	V-type ATP synthase beta chain	0.00e+00	1.58e-21	9.77e-33	NA
4. PB	Q7V037	ATP synthase subunit alpha	0.00e+00	5.81e-28	5.71e-24	NA
4. PB	B7K5I8	ATP synthase subunit alpha	0.00e+00	1.84e-27	7.17e-22	NA
4. PB	Q60CR6	ATP synthase subunit alpha 1	0.00e+00	1.95e-25	1.24e-22	NA
4. PB	A5III5	ATP synthase subunit alpha 2	0.00e+00	1.11e-26	2.17e-20	NA
4. PB	B9MBA3	ATP synthase subunit beta	0.00e+00	3.89e-66	0.0	NA
4. PB	A5FL34	ATP synthase subunit alpha	0.00e+00	6.36e-24	4.09e-22	NA
4. PB	A6Q4C2	ATP synthase subunit alpha	0.00e+00	1.69e-28	3.24e-29	NA
4. PB	Q39291	V-type proton ATPase catalytic subunit A	5.00e-14	1.40e-16	1.20e-34	NA
4. PB	B2G689	ATP synthase subunit alpha	0.00e+00	4.85e-29	6.05e-21	NA
4. PB	B8ZK31	V-type ATP synthase alpha chain	0.00e+00	4.89e-16	1.04e-32	NA
4. PB	Q9TM41	ATP synthase subunit beta, chloroplastic	0.00e+00	9.17e-74	0.0	NA
4. PB	Q8TIJ1	V-type ATP synthase alpha chain	1.44e-15	1.20e-14	4.61e-31	NA
4. PB	B9KES1	ATP synthase subunit alpha	0.00e+00	6.14e-28	2.61e-24	NA
4. PB	Q4FP36	ATP synthase subunit alpha	0.00e+00	3.37e-25	2.64e-23	NA
4. PB	Q9PA21	Transcription termination factor Rho	1.99e-08	4.66e-09	0.004	NA
4. PB	Q3B6W8	ATP synthase subunit beta 1	0.00e+00	1.92e-71	0.0	NA
4. PB	O67031	Transcription termination factor Rho	1.96e-08	6.82e-05	1.16e-06	NA
4. PB	Q4ULF7	Transcription termination factor Rho	2.96e-08	1.65e-05	1.69e-04	NA
4. PB	Q0SSI3	V-type ATP synthase beta chain	0.00e+00	1.27e-20	6.38e-34	NA
4. PB	P37808	ATP synthase subunit alpha	0.00e+00	6.18e-29	1.57e-25	NA
4. PB	B0K5J0	V-type ATP synthase alpha chain	3.24e-14	3.76e-14	9.35e-34	NA
4. PB	A7N6Q6	ATP synthase subunit alpha 2	0.00e+00	4.46e-25	2.73e-22	NA
4. PB	P0DA08	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	O83417	Flagellum-specific ATP synthase	0.00e+00	2.01e-36	4.59e-46	NA
4. PB	Q5L5J0	V-type ATP synthase alpha chain	0.00e+00	1.08e-14	1.48e-22	NA
4. PB	A9KK94	ATP synthase subunit alpha	0.00e+00	7.58e-29	5.61e-23	NA
4. PB	Q39ZT9	ATP synthase subunit alpha 1/3	0.00e+00	2.46e-27	3.28e-21	NA
4. PB	Q32RS8	ATP synthase subunit alpha, chloroplastic	0.00e+00	4.66e-28	1.98e-22	NA
4. PB	C5D992	ATP synthase subunit alpha	0.00e+00	2.58e-28	2.86e-24	NA
4. PB	A1VIV2	ATP synthase subunit beta 1	0.00e+00	2.02e-66	0.0	NA
4. PB	Q2NQ88	ATP synthase subunit alpha	0.00e+00	9.28e-24	9.91e-24	NA
4. PB	Q06SI2	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.53e-27	1.31e-18	NA
4. PB	A3CS71	V-type ATP synthase alpha chain	8.88e-15	1.12e-16	4.62e-31	NA
4. PB	Q2LQZ7	ATP synthase subunit alpha 1	0.00e+00	1.28e-29	5.74e-21	NA
4. PB	Q8KA42	Flagellum-specific ATP synthase	0.00e+00	1.32e-24	1.34e-35	NA
4. PB	Q5QZI4	ATP synthase subunit alpha	0.00e+00	2.50e-25	8.24e-25	NA
4. PB	Q03222	Transcription termination factor Rho	1.91e-07	2.11e-11	0.002	NA
4. PB	Q8FQ22	ATP synthase subunit alpha	0.00e+00	1.87e-23	5.00e-23	NA
4. PB	A0RXK0	V-type ATP synthase beta chain	0.00e+00	1.65e-22	5.04e-35	NA
4. PB	B8DWS2	ATP synthase subunit beta	0.00e+00	4.03e-63	0.0	NA
4. PB	P0ABB2	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	B0T338	ATP synthase subunit alpha	0.00e+00	2.04e-24	2.24e-22	NA
4. PB	Q1Q899	ATP synthase subunit beta	0.00e+00	1.02e-60	0.0	NA
4. PB	C3NEU3	V-type ATP synthase alpha chain	3.22e-14	1.48e-18	8.80e-33	NA
4. PB	P0CH92	Transcription termination factor Rho 1	2.37e-08	1.08e-07	2.97e-06	NA
4. PB	P31407	V-type proton ATPase subunit B, kidney isoform	0.00e+00	4.47e-17	1.68e-31	NA
4. PB	P49712	V-type proton ATPase subunit B	0.00e+00	6.37e-14	4.93e-33	NA
4. PB	Q8XG95	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q1KVU0	ATP synthase subunit alpha, chloroplastic	0.00e+00	6.85e-28	1.88e-19	NA
4. PB	Q9MU81	ATP synthase subunit beta, chloroplastic	NA	5.76e-67	0.0	NA
4. PB	B1YMR6	ATP synthase subunit alpha	0.00e+00	1.76e-25	1.27e-21	NA
4. PB	Q40002	V-type proton ATPase catalytic subunit A (Fragment)	3.49e-13	3.11e-16	8.70e-34	NA
4. PB	A1XGM3	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.93e-26	1.45e-20	NA
4. PB	A5HY50	ATP synthase subunit alpha	0.00e+00	1.21e-27	2.36e-24	NA
4. PB	B5EFI9	ATP synthase subunit alpha	0.00e+00	1.28e-27	9.24e-21	NA
4. PB	Q88BX4	ATP synthase subunit beta	0.00e+00	1.01e-65	0.0	NA
4. PB	Q02848	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.17e-27	3.98e-22	NA
4. PB	C7LJY3	Transcription termination factor Rho	7.85e-09	4.35e-16	2.02e-06	NA
4. PB	Q08637	V-type sodium ATPase subunit B	0.00e+00	1.20e-22	4.42e-30	NA
4. PB	Q7VJ23	ATP synthase subunit alpha	0.00e+00	4.25e-27	1.73e-23	NA
4. PB	P0DA03	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	Q2K3G8	ATP synthase subunit alpha	0.00e+00	5.14e-25	4.93e-22	NA
4. PB	Q8MA05	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.77e-26	7.37e-22	NA
4. PB	B1JRN0	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	Q4J8L9	V-type ATP synthase alpha chain	2.76e-14	2.62e-18	3.35e-32	NA
4. PB	B0Z550	ATP synthase subunit alpha, chloroplastic	0.00e+00	8.92e-27	1.18e-18	NA
4. PB	Q31DL8	ATP synthase subunit alpha	0.00e+00	6.60e-28	2.46e-25	NA
4. PB	B1VFY5	ATP synthase subunit alpha	0.00e+00	8.09e-21	1.01e-23	NA
4. PB	Q5UXY8	V-type ATP synthase alpha chain	1.94e-14	2.58e-14	5.73e-33	NA
4. PB	A5EXL4	ATP synthase subunit beta	0.00e+00	1.68e-61	0.0	NA
4. PB	P49087	V-type proton ATPase catalytic subunit A (Fragment)	6.29e-14	1.61e-15	7.78e-36	NA
4. PB	P24487	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.53e-20	4.06e-19	NA
4. PB	P45823	ATP synthase subunit beta	0.00e+00	4.87e-71	0.0	NA
4. PB	Q9A1Q2	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	Q0P3P2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.40e-68	0.0	NA
4. PB	Q2PMV0	ATP synthase subunit beta, chloroplastic	0.00e+00	4.12e-68	0.0	NA
4. PB	Q891P1	V-type ATP synthase alpha chain 2	1.70e-14	4.89e-16	2.24e-30	NA
4. PB	Q1JNS7	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	Q6NHS9	ATP synthase subunit beta	0.00e+00	4.68e-73	0.0	NA
4. PB	Q02DF4	ATP synthase subunit beta	0.00e+00	1.63e-63	0.0	NA
4. PB	B5XKP9	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	O03067	ATP synthase subunit beta, chloroplastic (Fragment)	NA	3.50e-65	0.0	NA
4. PB	P12862	ATP synthase subunit alpha, mitochondrial	0.00e+00	7.79e-28	1.63e-21	NA
4. PB	C3K1E6	ATP synthase subunit beta	0.00e+00	3.43e-63	0.0	NA
4. PB	Q68S21	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.11e-24	1.79e-18	NA
4. PB	Q1I2I5	ATP synthase subunit alpha	0.00e+00	2.30e-24	1.72e-22	NA
4. PB	A4WUM9	ATP synthase subunit alpha	0.00e+00	5.23e-25	5.63e-18	NA
4. PB	A2BKX5	V-type ATP synthase beta chain	0.00e+00	2.58e-23	5.36e-36	NA
4. PB	Q7VU46	ATP synthase subunit alpha	0.00e+00	2.21e-25	9.67e-23	NA
4. PB	Q89AZ7	Flagellum-specific ATP synthase	0.00e+00	9.28e-31	1.23e-36	NA
4. PB	Q0TAX5	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q8FYR3	ATP synthase subunit alpha	0.00e+00	2.73e-25	4.94e-20	NA
4. PB	B4TN33	ATP synthase subunit alpha	0.00e+00	4.16e-23	5.82e-23	NA
4. PB	Q5XCY2	ATP synthase subunit alpha	0.00e+00	6.60e-28	5.20e-20	NA
4. PB	P43714	ATP synthase subunit alpha	0.00e+00	3.88e-25	2.41e-23	NA
4. PB	A5UKB2	V-type ATP synthase alpha chain	2.29e-14	4.47e-19	5.08e-33	NA
4. PB	P13357	ATP synthase subunit beta	0.00e+00	2.98e-60	0.0	NA
4. PB	B0SDA5	ATP synthase subunit beta	0.00e+00	6.81e-76	0.0	NA
4. PB	B1I6J9	ATP synthase subunit alpha	0.00e+00	5.91e-28	1.82e-19	NA
4. PB	Q46J57	ATP synthase subunit alpha	0.00e+00	3.80e-28	3.06e-22	NA
4. PB	Q5XE49	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	Q619C0	Probable V-type proton ATPase subunit B	0.00e+00	3.08e-20	1.94e-34	NA
4. PB	C0MH19	ATP synthase subunit alpha	0.00e+00	5.40e-28	3.41e-19	NA
4. PB	A5IFJ9	ATP synthase subunit alpha 1	0.00e+00	6.21e-27	1.57e-19	NA
4. PB	P06283	ATP synthase subunit alpha, chloroplastic	0.00e+00	9.81e-25	6.09e-22	NA
4. PB	P40290	Type 3 secretion system ATPase	0.00e+00	2.46e-33	2.39e-46	NA
4. PB	B3CSS9	ATP synthase subunit alpha	0.00e+00	4.64e-26	1.01e-27	NA
4. PB	Q8PCZ7	ATP synthase subunit alpha	0.00e+00	7.68e-24	1.52e-23	NA
4. PB	Q1RIJ6	Transcription termination factor Rho	2.44e-08	4.66e-06	9.24e-05	NA
4. PB	Q19VA5	ATP synthase subunit alpha, chloroplastic	0.00e+00	7.51e-28	2.74e-23	NA
4. PB	Q63IW3	ATP synthase subunit beta 2	0.00e+00	3.59e-29	2.28e-156	NA
4. PB	O54249	Flagellum-specific ATP synthase	0.00e+00	3.89e-33	1.21e-35	NA
4. PB	O99015	ATP synthase subunit alpha, plastid	0.00e+00	6.37e-28	3.54e-20	NA
4. PB	B2UWY4	V-type ATP synthase alpha chain	0.00e+00	1.19e-16	6.86e-32	NA
4. PB	Q2TJ56	V-type proton ATPase catalytic subunit A	4.36e-14	1.29e-16	5.30e-32	NA
4. PB	C4XI08	ATP synthase subunit alpha	0.00e+00	6.80e-27	4.70e-18	NA
4. PB	A9WWS4	ATP synthase subunit alpha	0.00e+00	1.55e-25	1.07e-20	NA
4. PB	Q5R5H2	V-type proton ATPase catalytic subunit A	5.80e-14	5.98e-15	4.77e-32	NA
4. PB	A7ZTU6	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A1KW11	ATP synthase subunit beta	0.00e+00	7.02e-59	0.0	NA
4. PB	B0BRX4	ATP synthase subunit alpha	0.00e+00	2.29e-23	7.77e-26	NA
4. PB	Q02XA3	ATP synthase subunit alpha	0.00e+00	1.50e-26	1.58e-17	NA
4. PB	Q0ZJ35	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.65e-26	1.97e-19	NA
4. PB	P62815	V-type proton ATPase subunit B, brain isoform	0.00e+00	7.04e-16	8.13e-33	NA
4. PB	A9A2R0	V-type ATP synthase alpha chain	1.67e-15	3.44e-16	6.00e-31	NA
4. PB	A3MAR7	ATP synthase subunit beta 2	0.00e+00	1.32e-31	2.00e-155	NA
4. PB	Q927W2	ATP synthase subunit alpha 2	0.00e+00	1.37e-28	2.03e-20	NA
4. PB	Q04HT7	ATP synthase subunit alpha	0.00e+00	2.07e-28	9.83e-15	NA
4. PB	A9R5U1	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	Q3Z8Z4	ATP synthase subunit alpha	0.00e+00	5.45e-26	1.75e-20	NA
4. PB	B5Z8D2	ATP synthase subunit alpha	0.00e+00	6.80e-25	5.91e-27	NA
4. PB	P09219	ATP synthase subunit alpha	0.00e+00	2.52e-29	8.18e-22	NA
4. PB	P52612	Flagellum-specific ATP synthase	0.00e+00	8.80e-29	6.06e-29	NA
4. PB	Q2IHQ9	ATP synthase subunit alpha	0.00e+00	2.40e-26	6.45e-25	NA
4. PB	A5GCR3	V-type ATP synthase beta chain	0.00e+00	7.90e-20	1.73e-28	NA
4. PB	Q3K441	ATP synthase subunit beta	0.00e+00	1.86e-63	0.0	NA
4. PB	Q07YM7	ATP synthase subunit beta 2	0.00e+00	4.97e-66	3.51e-163	NA
4. PB	P25705	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.70e-15	8.26e-18	NA
4. PB	A8W3A9	ATP synthase subunit alpha, plastid	0.00e+00	2.26e-24	2.10e-19	NA
4. PB	B8FGT6	ATP synthase subunit alpha	0.00e+00	2.16e-29	5.77e-17	NA
4. PB	Q2LY34	ATP synthase subunit alpha 2	0.00e+00	1.40e-28	1.88e-25	NA
4. PB	A7GGL3	V-type ATP synthase beta chain	0.00e+00	7.85e-19	2.58e-33	NA
4. PB	A3P0Z0	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	Q68WL0	Transcription termination factor Rho	2.74e-08	9.81e-06	1.46e-04	NA
4. PB	A0L2T0	ATP synthase subunit alpha	0.00e+00	1.24e-23	1.42e-24	NA
4. PB	P41602	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.09e-26	1.69e-23	NA
4. PB	A2RFC2	ATP synthase subunit beta	0.00e+00	4.88e-74	0.0	NA
4. PB	Q9HTV1	Transcription termination factor Rho	1.70e-08	8.83e-08	0.005	NA
4. PB	P95787	ATP synthase subunit alpha	0.00e+00	6.06e-26	2.72e-19	NA
4. PB	C1CES2	V-type ATP synthase alpha chain	0.00e+00	4.89e-16	1.04e-32	NA
4. PB	Q8TWL6	V-type ATP synthase alpha chain	0.00e+00	3.06e-15	2.91e-35	NA
4. PB	A1SHI9	ATP synthase subunit alpha	0.00e+00	3.63e-23	2.21e-18	NA
4. PB	A8F006	ATP synthase subunit alpha	0.00e+00	6.48e-28	2.66e-23	NA
4. PB	B2UWY3	V-type ATP synthase beta chain	0.00e+00	5.06e-20	1.55e-32	NA
4. PB	A2RC97	V-type ATP synthase alpha chain	0.00e+00	2.05e-12	1.47e-33	NA
4. PB	Q042L3	ATP synthase subunit alpha	0.00e+00	1.70e-29	4.00e-22	NA
4. PB	Q74K17	ATP synthase subunit alpha	0.00e+00	2.92e-29	3.33e-22	NA
4. PB	Q83G91	ATP synthase subunit beta	0.00e+00	5.17e-74	0.0	NA
4. PB	Q03EL2	ATP synthase subunit alpha	0.00e+00	4.40e-27	2.53e-21	NA
4. PB	A5V3X3	ATP synthase subunit alpha	0.00e+00	2.78e-25	5.41e-20	NA
4. PB	Q59PT0	V-type proton ATPase subunit B	0.00e+00	1.72e-21	3.40e-34	NA
4. PB	B5XJH4	V-type ATP synthase beta chain	0.00e+00	5.23e-22	1.25e-29	NA
4. PB	P42465	ATP synthase subunit beta	0.00e+00	7.01e-71	0.0	NA
4. PB	B2A3G4	ATP synthase subunit alpha	0.00e+00	1.35e-26	3.51e-19	NA
4. PB	A1TD57	ATP synthase subunit alpha	0.00e+00	4.69e-19	4.94e-22	NA
4. PB	Q27S65	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.43e-25	7.16e-19	NA
4. PB	Q02XA5	ATP synthase subunit beta	0.00e+00	1.59e-76	0.0	NA
4. PB	A8GY42	ATP synthase subunit alpha	0.00e+00	7.73e-29	8.47e-26	NA
4. PB	Q74MJ7	V-type ATP synthase alpha chain	7.11e-15	3.51e-18	3.03e-31	NA
4. PB	Q2IQ95	V-type ATP synthase alpha chain	5.33e-15	1.09e-19	7.19e-27	NA
4. PB	B9E8E6	ATP synthase subunit beta	0.00e+00	1.50e-74	0.0	NA
4. PB	Q2FP52	V-type ATP synthase alpha chain 1	1.79e-14	4.68e-17	9.02e-32	NA
4. PB	Q6G7K5	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	P50516	V-type proton ATPase catalytic subunit A	5.85e-14	2.98e-15	4.86e-32	NA
4. PB	B1A920	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.19e-27	4.66e-18	NA
4. PB	B0SLC8	ATP synthase subunit beta	0.00e+00	6.81e-76	0.0	NA
4. PB	Q5R546	ATP synthase subunit alpha, mitochondrial	0.00e+00	5.57e-15	6.26e-18	NA
4. PB	B3EHU6	ATP synthase subunit alpha	0.00e+00	5.65e-26	6.93e-18	NA
4. PB	Q7NXP1	Transcription termination factor Rho	1.37e-08	7.55e-09	0.004	NA
4. PB	Q5GSX1	ATP synthase subunit alpha	0.00e+00	2.27e-28	9.93e-25	NA
4. PB	Q1R4K0	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	A0AFQ9	ATP synthase subunit alpha 1	0.00e+00	4.40e-26	2.65e-13	NA
4. PB	Q5NIK3	ATP synthase subunit beta	0.00e+00	9.17e-67	0.0	NA
4. PB	A0M791	ATP synthase subunit beta	0.00e+00	8.70e-63	0.0	NA
4. PB	B5YXD8	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q2STE9	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	Q32RL1	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.54e-24	2.60e-21	NA
4. PB	P56757	ATP synthase subunit alpha, chloroplastic	0.00e+00	9.13e-26	8.81e-19	NA
4. PB	Q6MS92	ATP synthase subunit alpha	0.00e+00	5.54e-23	2.88e-22	NA
4. PB	Q3J6M9	ATP synthase subunit alpha	0.00e+00	1.82e-25	3.54e-19	NA
4. PB	B4UH38	V-type ATP synthase beta chain	0.00e+00	2.50e-23	1.00e-31	NA
4. PB	A1U7H6	ATP synthase subunit alpha	0.00e+00	8.54e-28	1.44e-23	NA
4. PB	Q83AF5	ATP synthase subunit beta	0.00e+00	7.80e-70	0.0	NA
4. PB	Q07405	ATP synthase subunit alpha	0.00e+00	1.34e-24	2.93e-22	NA
4. PB	A3DNQ6	V-type ATP synthase alpha chain	1.75e-13	8.77e-15	2.79e-36	NA
4. PB	A6VWQ6	ATP synthase subunit alpha 1	0.00e+00	1.19e-29	1.71e-31	NA
4. PB	Q63PI0	ATP synthase subunit beta 1	0.00e+00	1.03e-69	0.0	NA
4. PB	P45825	ATP synthase subunit alpha	0.00e+00	2.82e-22	8.75e-24	NA
4. PB	P35381	ATP synthase subunit alpha, mitochondrial	0.00e+00	3.28e-14	7.95e-19	NA
4. PB	Q6A8C5	ATP synthase subunit alpha	0.00e+00	2.55e-22	4.24e-20	NA
4. PB	Q3AUA7	ATP synthase subunit alpha	0.00e+00	4.17e-26	2.13e-18	NA
4. PB	B0BZL2	ATP synthase subunit alpha 1	0.00e+00	5.99e-27	3.91e-23	NA
4. PB	Q9I4N1	Flagellum-specific ATP synthase	0.00e+00	3.08e-34	6.96e-38	NA
4. PB	Q17Y80	ATP synthase subunit alpha	0.00e+00	6.99e-26	6.02e-27	NA
4. PB	A2SC70	ATP synthase subunit beta	0.00e+00	1.58e-66	0.0	NA
4. PB	P0DA09	V-type ATP synthase beta chain	0.00e+00	6.07e-22	1.19e-30	NA
4. PB	A5UA09	ATP synthase subunit alpha	0.00e+00	8.09e-25	2.72e-23	NA
4. PB	B6YV15	V-type ATP synthase beta chain	0.00e+00	2.42e-20	4.61e-36	NA
4. PB	Q5AJB1	V-type proton ATPase catalytic subunit A	8.56e-13	1.30e-17	8.69e-27	NA
4. PB	A9LYH0	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.48e-26	1.03e-19	NA
4. PB	Q8RC17	ATP synthase subunit alpha	0.00e+00	5.26e-26	2.16e-22	NA
4. PB	C3MQL5	V-type ATP synthase alpha chain	3.73e-14	1.87e-18	1.50e-32	NA
4. PB	B0BVB8	ATP synthase subunit alpha	0.00e+00	6.21e-27	3.51e-26	NA
4. PB	P22550	V-type proton ATPase subunit B	0.00e+00	1.08e-21	3.60e-34	NA
4. PB	B0RED4	ATP synthase subunit beta	0.00e+00	5.30e-71	0.0	NA
4. PB	B8JE35	V-type ATP synthase alpha chain	6.00e-15	1.51e-19	5.09e-27	NA
4. PB	Q2YCA3	ATP synthase subunit beta 1	0.00e+00	4.88e-64	0.0	NA
4. PB	Q4ZL22	ATP synthase subunit alpha	0.00e+00	4.43e-24	9.20e-22	NA
4. PB	Q61VZ4	V-type proton ATPase catalytic subunit A	2.36e-14	8.89e-15	3.77e-33	NA
4. PB	Q6G1W7	ATP synthase subunit alpha	0.00e+00	8.97e-24	5.08e-18	NA
4. PB	A8YY72	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	Q92LK6	ATP synthase subunit alpha	0.00e+00	2.21e-25	3.10e-21	NA
4. PB	Q2JSW1	ATP synthase subunit alpha	0.00e+00	1.25e-29	6.30e-21	NA
4. PB	Q6MGM5	ATP synthase subunit alpha	0.00e+00	2.09e-29	4.70e-22	NA
4. PB	Q5HX61	ATP synthase subunit alpha	0.00e+00	3.95e-27	1.55e-24	NA
4. PB	O29100	V-type ATP synthase beta chain	0.00e+00	9.82e-21	4.18e-31	NA
4. PB	P06576	ATP synthase subunit beta, mitochondrial	0.00e+00	3.73e-24	0.0	NA
4. PB	Q40079	V-type proton ATPase subunit B 2	0.00e+00	2.43e-19	3.24e-31	NA
4. PB	B9IRT7	ATP synthase subunit beta	0.00e+00	1.49e-77	0.0	NA
4. PB	Q8Z9S4	ATP synthase subunit alpha	0.00e+00	7.38e-23	4.21e-24	NA
4. PB	P57652	Transcription termination factor Rho	2.17e-08	2.31e-08	0.005	NA
4. PB	P54647	V-type proton ATPase catalytic subunit A	5.05e-14	1.04e-15	9.96e-37	NA
4. PB	Q3C1H4	ATP synthase subunit alpha, chloroplastic	0.00e+00	5.81e-25	3.13e-18	NA
4. PB	B5RQS2	V-type ATP synthase alpha chain	0.00e+00	6.79e-17	8.10e-21	NA
4. PB	A5WBA5	ATP synthase subunit alpha	0.00e+00	7.16e-25	8.28e-24	NA
4. PB	Q1GAW7	ATP synthase subunit alpha	0.00e+00	2.02e-27	1.10e-20	NA
4. PB	O51121	V-type ATP synthase alpha chain	0.00e+00	1.47e-15	2.00e-21	NA
4. PB	Q9ZK79	ATP synthase subunit alpha	0.00e+00	3.73e-24	1.04e-26	NA
4. PB	Q5FGY3	ATP synthase subunit beta	0.00e+00	1.11e-62	0.0	NA
4. PB	A4QK03	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.68e-25	6.42e-19	NA
4. PB	B6I3X1	ATP synthase subunit alpha	0.00e+00	8.59e-23	6.71e-24	NA
4. PB	Q9UWW6	V-type ATP synthase alpha chain	2.96e-14	4.28e-18	2.85e-32	NA
4. PB	B9E8E8	ATP synthase subunit alpha	0.00e+00	4.74e-28	1.84e-24	NA
4. PB	B1MLW0	ATP synthase subunit alpha	0.00e+00	3.09e-21	8.07e-24	NA
4. PB	Q9YF36	V-type ATP synthase beta chain	0.00e+00	9.64e-25	1.40e-33	NA
4. PB	P41168	ATP synthase subunit beta	0.00e+00	3.19e-70	0.0	NA
4. PB	A8G7M6	ATP synthase subunit alpha	0.00e+00	3.54e-24	3.66e-24	NA
4. PB	B0K5I9	V-type ATP synthase beta chain	0.00e+00	1.26e-21	4.95e-33	NA
4. PB	O83541	V-type ATP synthase alpha chain 2	1.42e-13	2.61e-16	2.10e-27	NA
4. PB	P31404	V-type proton ATPase catalytic subunit A	4.75e-14	2.77e-15	5.45e-32	NA
4. PB	Q3BAQ7	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.29e-27	5.32e-20	NA
4. PB	Q48332	V-type ATP synthase alpha chain	1.77e-14	2.33e-15	8.43e-32	NA
4. PB	P52153	Transcription termination factor Rho	2.21e-08	9.83e-07	1.49e-07	NA
4. PB	A4QJC2	ATP synthase subunit beta, chloroplastic	0.00e+00	1.78e-65	0.0	NA
4. PB	P09469	V-type proton ATPase catalytic subunit A	4.52e-14	1.12e-16	9.82e-35	NA
4. PB	C6A5E8	V-type ATP synthase alpha chain	0.00e+00	4.02e-15	1.01e-30	NA
4. PB	A1T0Y9	ATP synthase subunit beta 2	0.00e+00	3.10e-64	0.0	NA
4. PB	B2GAU3	ATP synthase subunit alpha	0.00e+00	4.49e-27	1.03e-20	NA
4. PB	O78475	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.23e-25	6.05e-25	NA
4. PB	B5YFA1	V-type ATP synthase beta chain	0.00e+00	1.57e-20	2.87e-31	NA
4. PB	Q0BJL5	ATP synthase subunit beta	0.00e+00	2.81e-69	0.0	NA
4. PB	Q85AU2	ATP synthase subunit alpha, chloroplastic	0.00e+00	2.48e-26	8.48e-22	NA
4. PB	A7GGL4	V-type ATP synthase alpha chain	1.68e-13	6.24e-15	2.73e-32	NA
4. PB	B4U2D9	ATP synthase subunit alpha	0.00e+00	5.40e-28	3.41e-19	NA
4. PB	Q0G9X7	ATP synthase subunit alpha, chloroplastic	0.00e+00	3.86e-24	1.49e-18	NA
4. PB	A6QB61	ATP synthase subunit alpha	0.00e+00	1.30e-28	1.04e-28	NA
4. PB	Q05372	ATP synthase subunit alpha	0.00e+00	1.40e-26	5.38e-24	NA
4. PB	Q5GRU7	ATP synthase subunit beta	0.00e+00	4.63e-64	0.0	NA
4. PB	Q7MA20	ATP synthase subunit alpha	0.00e+00	5.85e-26	1.85e-23	NA
4. PB	B4SAN6	ATP synthase subunit beta	0.00e+00	8.07e-71	0.0	NA
4. PB	C3NGV2	V-type ATP synthase beta chain	0.00e+00	1.15e-20	7.94e-40	NA
4. PB	P80021	ATP synthase subunit alpha, mitochondrial	0.00e+00	2.77e-15	5.57e-18	NA
4. PB	B5YI22	ATP synthase subunit alpha	0.00e+00	1.21e-25	5.25e-26	NA
4. PB	Q2FF22	ATP synthase subunit alpha	0.00e+00	3.28e-28	4.12e-25	NA
4. PB	P22663	V-type ATP synthase beta chain	0.00e+00	6.90e-23	1.18e-30	NA
4. PB	Q05FY1	ATP synthase subunit beta	0.00e+00	2.58e-62	0.0	NA
4. PB	A4QKH7	ATP synthase subunit alpha, chloroplastic	0.00e+00	7.64e-26	7.16e-19	NA
4. PB	B7JB86	ATP synthase subunit alpha	0.00e+00	1.25e-24	9.19e-25	NA
4. PB	A5A6H5	ATP synthase subunit alpha, mitochondrial	0.00e+00	6.70e-15	8.26e-18	NA
4. PB	Q4A8W1	ATP synthase subunit alpha	0.00e+00	2.35e-26	1.05e-26	NA
4. PB	A3PET9	ATP synthase subunit alpha	0.00e+00	2.05e-29	1.73e-24	NA
4. PB	Q5WSG8	ATP synthase subunit beta	0.00e+00	9.04e-64	0.0	NA
4. PB	Q3AHK5	ATP synthase subunit alpha	0.00e+00	8.54e-28	4.00e-23	NA
4. PB	Q6FFK2	ATP synthase subunit alpha	0.00e+00	6.17e-26	9.18e-24	NA
4. PB	Q2FL44	V-type ATP synthase beta chain 2	0.00e+00	1.08e-21	1.32e-31	NA
4. PB	Q9CER8	ATP synthase subunit alpha	0.00e+00	9.08e-27	2.05e-18	NA
4. PB	Q68VU6	ATP synthase subunit alpha	0.00e+00	1.98e-27	2.08e-24	NA
4. PB	A6MMJ2	ATP synthase subunit alpha, chloroplastic	0.00e+00	1.90e-26	2.66e-20	NA
5. P	Q0CEZ9	mRNA cleavage and polyadenylation factor clp1	5.50e-01	2.06e-02	NA	NA
5. P	Q4WVA5	mRNA cleavage and polyadenylation factor clp1	2.04e-01	5.84e-03	NA	NA
5. P	Q9FC33	Transcription termination factor Rho	1.15e-08	3.10e-07	NA	NA
5. P	A6S936	mRNA cleavage and polyadenylation factor clp1	1.40e-01	2.36e-02	NA	NA
5. P	Q4P9Z3	mRNA cleavage and polyadenylation factor CLP1	4.01e-01	7.99e-03	NA	NA
5. P	A7TH62	mRNA cleavage and polyadenylation factor CLP1	1.50e-01	4.73e-03	NA	NA
5. P	A1DE49	mRNA cleavage and polyadenylation factor clp1	1.80e-01	1.90e-03	NA	NA
5. P	Q4R7R3	Polyribonucleotide 5'-hydroxyl-kinase Clp1	1.15e-01	2.81e-02	NA	NA
5. P	A1CB93	mRNA cleavage and polyadenylation factor clp1	1.88e-01	4.29e-03	NA	NA
5. P	Q08685	mRNA cleavage and polyadenylation factor CLP1	1.81e-01	2.59e-02	NA	NA
5. P	Q7SAB7	mRNA cleavage and polyadenylation factor clp1	1.74e-01	5.64e-03	NA	NA
5. P	Q92989	Polyribonucleotide 5'-hydroxyl-kinase Clp1	9.59e-02	2.81e-02	NA	NA
5. P	B0Y0Y6	mRNA cleavage and polyadenylation factor clp1	1.80e-01	5.59e-03	NA	NA
5. P	B4QEE3	Protein CLP1 homolog	9.63e-02	4.22e-02	NA	NA
5. P	C5BVA6	Proteasome-associated ATPase	7.24e-03	7.32e-03	NA	NA
5. P	A3LNJ3	mRNA cleavage and polyadenylation factor CLP1	1.10e-01	3.14e-02	NA	NA
5. P	Q9SK02	DNA repair protein RAD51 homolog 2	2.23e-05	2.79e-02	NA	NA
5. P	Q2UEA6	mRNA cleavage and polyadenylation factor clp1	1.62e-01	5.16e-03	NA	NA
5. P	Q0U2G5	mRNA cleavage and polyadenylation factor CLP1	2.26e-01	1.74e-02	NA	NA
5. P	Q6CTU5	mRNA cleavage and polyadenylation factor CLP1	8.00e-02	1.39e-02	NA	NA
5. P	C7R400	Proteasome-associated ATPase	8.18e-03	2.81e-02	NA	NA
5. P	P44619	Transcription termination factor Rho	1.46e-08	4.63e-08	NA	NA
5. P	Q5ZJL4	Polyribonucleotide 5'-hydroxyl-kinase Clp1	9.58e-02	2.77e-02	NA	NA
5. P	B3MGZ0	Protein CLP1 homolog	9.83e-02	2.44e-02	NA	NA
5. P	Q59ST8	mRNA cleavage and polyadenylation factor CLP1	1.03e-01	4.98e-02	NA	NA
5. P	A6ZP88	mRNA cleavage and polyadenylation factor CLP1	1.34e-01	2.59e-02	NA	NA
5. P	A8PB32	Protein CLP1 homolog	1.05e-01	3.56e-03	NA	NA
5. P	B4GGT6	Protein CLP1 homolog	9.95e-02	3.44e-02	NA	NA
5. P	Q1DKL9	mRNA cleavage and polyadenylation factor CLP1	2.87e-01	2.74e-02	NA	NA
5. P	B4HQJ2	Protein CLP1 homolog	9.75e-02	2.91e-02	NA	NA
5. P	Q06447	Transcription termination factor Rho	2.30e-08	7.72e-08	NA	NA
5. P	A2VE01	Polyribonucleotide 5'-hydroxyl-kinase Clp1	9.86e-02	2.89e-02	NA	NA
5. P	Q28ZT4	Protein CLP1 homolog	9.52e-02	2.48e-02	NA	NA
5. P	Q7K284	Protein CLP1 homolog	9.91e-02	3.67e-02	NA	NA
5. P	A4QQE0	mRNA cleavage and polyadenylation factor CLP1	1.59e-01	4.29e-03	NA	NA
5. P	P52152	Transcription termination factor Rho	3.19e-07	5.25e-08	NA	NA
5. P	A5DJW8	mRNA cleavage and polyadenylation factor CLP1	4.34e-01	1.73e-02	NA	NA
7. B	A1UY41	ATP synthase subunit alpha 2	0.00e+00	NA	3.33e-19	NA
7. B	P33561	Transcription termination factor Rho	1.02e-07	NA	4.35e-04	NA
7. B	P83505	ATP synthase subunit beta, chloroplastic (Fragments)	9.86e-01	NA	3.39e-04	NA
7. B	O83281	Transcription termination factor Rho	1.12e-06	NA	8.52e-04	NA
7. B	Q8TUT0	V-type ATP synthase beta chain	6.60e-04	NA	3.22e-14	NA
7. B	P17255	V-type proton ATPase catalytic subunit A	7.28e-04	NA	6.65e-18	NA
7. B	P9WHF3	Transcription termination factor Rho	2.06e-06	NA	1.77e-06	NA
7. B	C9RLJ9	Transcription termination factor Rho	1.02e-06	NA	8.29e-11	NA
7. B	A3NN58	ATP synthase subunit alpha 2	0.00e+00	NA	3.05e-19	NA
7. B	Q24751	ATP synthase subunit beta, mitochondrial (Fragment)	0.00e+00	NA	1.60e-73	NA
7. B	P38078	V-type proton ATPase catalytic subunit A	4.32e-04	NA	1.54e-19	NA
7. B	Q8U4A6	V-type ATP synthase alpha chain	8.01e-05	NA	1.97e-23	NA
7. B	P85446	ATP synthase subunit beta, mitochondrial (Fragments)	3.32e-01	NA	9.89e-11	NA
7. B	B2UR37	Transcription termination factor Rho	3.35e-08	NA	2.30e-05	NA
7. B	O57728	V-type ATP synthase alpha chain	1.21e-04	NA	2.89e-24	NA
7. B	Q63IX0	ATP synthase subunit alpha 2	0.00e+00	NA	3.79e-19	NA
7. B	Q62EB0	ATP synthase subunit alpha 2	0.00e+00	NA	3.33e-19	NA
7. B	O03073	ATP synthase subunit beta, chloroplastic (Fragment)	NA	NA	9.27e-97	NA
7. B	O03070	ATP synthase subunit beta, chloroplastic (Fragment)	NA	NA	1.19e-93	NA
7. B	P66029	Transcription termination factor Rho	2.13e-06	NA	1.77e-06	NA
7. B	Q3JJP7	ATP synthase subunit alpha 2	0.00e+00	NA	3.78e-19	NA
7. B	Q07233	ATP synthase subunit beta, mitochondrial (Fragment)	0.00e+00	NA	3.22e-86	NA
7. B	A3MAS4	ATP synthase subunit alpha 2	0.00e+00	NA	3.33e-19	NA
7. B	Q7UGV0	Transcription termination factor Rho	4.78e-08	NA	6.03e-05	NA
7. B	P85088	ATP synthase subunit beta, mitochondrial (Fragments)	4.37e-01	NA	2.28e-16	NA
7. B	Q9PR12	ATP synthase subunit alpha	0.00e+00	NA	3.50e-24	NA
7. B	Q9UXU7	V-type ATP synthase alpha chain	5.39e-04	NA	1.41e-23	NA
7. B	P43395	ATP synthase subunit beta, mitochondrial (Fragment)	2.22e-16	NA	6.03e-65	NA
7. B	P21933	ATP synthase subunit beta (Fragment)	8.08e-08	NA	1.00e-39	NA
7. B	B1AIC1	ATP synthase subunit alpha	0.00e+00	NA	3.50e-24	NA
7. B	O03077	ATP synthase subunit beta, chloroplastic (Fragment)	NA	NA	1.05e-98	NA
7. B	P9WHF2	Transcription termination factor Rho	1.17e-05	NA	1.77e-06	NA
7. B	P45835	Transcription termination factor Rho	2.26e-06	NA	7.20e-06	NA
7. B	O03063	ATP synthase subunit beta, chloroplastic (Fragment)	NA	NA	2.86e-133	NA
7. B	C1A5H8	Transcription termination factor Rho	8.51e-05	NA	0.038	NA