Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54960.1
JCVISYN3A_0791

F0F1 ATP synthase subunit gamma.
M. mycoides homolog: Q6MS93.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 20
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 764
Unique PROST Homologs: 0
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 1

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: atpG; ATP synthase gamma chain
Zhang et al. [4]: GO:0042777|plasma membrane ATP synthesis coupled proton transport
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P29710 (ATP synthase gamma chain, sodium ion specific) with a FATCAT P-Value: 0 and RMSD of 1.58 angstrom. The sequence alignment identity is 35.2%.
Structural alignment shown in left. Query protein AVX54960.1 colored as red in alignment, homolog P29710 colored as blue. Query protein AVX54960.1 is also shown in right top, homolog P29710 showed in right bottom. They are colored based on secondary structures. 

  AVX54960.1 MPNLKGLKTEILSVKNISKITNAMQLVASAKLRKISKKVIDTHNYVSEVYSLFND-IISQ--AD-KS----VFLKDSNFETKKTLWIVINSNLGLCGGYN 92
      P29710 MAAGKEIKSRISSVQSTRQITKAMEIVSSTKFKKF-QALV---NQ-SKPYSGSMDKVLANLAAGIKNERHPLF--DGKTEVKRIGIIVMTSDRGLCGGFN 93

  AVX54960.1 SN----VNKLVLQNLKTNDE---IFAIGSKAVSFFKSKKIKIRD---QVTNI--DINFTNEKAKIISNDLLAMYTNRE-FDEIKIVYTKFINNVTFEPAI 179
      P29710 SSTLKEMEKLIVAN---PDKEVSVIAIGKKGRDY--CKK-KDRDLKAEYIQLIPETMF--DKAKEISENIVE-YFYEDIFDEVYLIYNEFISALSTE-LI 183

  AVX54960.1 I-RIFPIVKSEL--HFTHKQKIIFEPDADQILNNTISIYINAIIYGTVIESQVSEQASRRTAMENATNNGQNLEHELSLKYNRQRQGAITQEISEIVSGA 276
      P29710 VKKLLPIERIEVQDNTTY----IFEPSVEDILSSLLPKYLNIQLYQAILENTASEHSARKNAMKNATDNAEDMIKDLTLQYNRERQAAITQEISEIVSGA 279

  AVX54960.1 NAQS 280
      P29710 SAL- 282

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0015986 ATP synthesis coupled proton transport
1. PBF GO:0005753 mitochondrial proton-transporting ATP synthase complex
1. PBF GO:0005756 mitochondrial proton-transporting ATP synthase, central stalk
1. PBF GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
1. PBF GO:0005886 plasma membrane
1. PBF GO:0042777 plasma membrane ATP synthesis coupled proton transport
1. PBF GO:0005524 ATP binding
1. PBF GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)
1. PBF GO:0000275 mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)
1. PBF GO:0045260 plasma membrane proton-transporting ATP synthase complex
1. PBF GO:0031676 plasma membrane-derived thylakoid membrane
1. PBF GO:0045262 plasma membrane proton-transporting ATP synthase complex, catalytic core F(1)
4. PB GO:0003723 RNA binding
4. PB GO:0008270 zinc ion binding
4. PB GO:0005829 cytosol
4. PB GO:0042776 mitochondrial ATP synthesis coupled proton transport
4. PB GO:0005634 nucleus
4. PB GO:0005737 cytoplasm
4. PB GO:0009544 chloroplast ATP synthase complex
4. PB GO:0006754 ATP biosynthetic process

Uniprot GO Annotations

GO Description
GO:0015986 ATP synthesis coupled proton transport
GO:1902600 proton transmembrane transport
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
GO:0005886 plasma membrane
GO:0042777 plasma membrane ATP synthesis coupled proton transport
GO:0016020 membrane
GO:0110165 cellular anatomical entity
GO:0005524 ATP binding
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)
GO:0006811 ion transport
GO:0006754 ATP biosynthetic process

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF A5U208 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 0.8873
1. PBF A4Y188 ATP synthase gamma chain 0.00e+00 4.60e-58 1.14e-44 0.9049
1. PBF A6WUJ1 ATP synthase gamma chain 0.00e+00 8.54e-57 2.02e-48 0.8987
1. PBF Q2N8Z4 ATP synthase gamma chain 0.00e+00 1.19e-57 7.26e-40 0.8749
1. PBF Q6FFK1 ATP synthase gamma chain 0.00e+00 1.19e-57 8.91e-48 0.8865
1. PBF A9WGS5 ATP synthase gamma chain 0.00e+00 1.55e-54 1.51e-42 0.8952
1. PBF B7JB85 ATP synthase gamma chain 0.00e+00 1.42e-57 2.28e-37 0.9016
1. PBF Q1MP34 ATP synthase gamma chain 0.00e+00 1.37e-58 9.92e-28 0.9129
1. PBF A9AJG3 ATP synthase gamma chain 0.00e+00 2.67e-58 6.21e-40 0.883
1. PBF A2BYH5 ATP synthase gamma chain 0.00e+00 1.19e-43 6.98e-38 0.8539
1. PBF Q3M9W1 ATP synthase gamma chain 0.00e+00 3.18e-46 4.97e-46 0.8674
1. PBF Q83AF6 ATP synthase gamma chain 0.00e+00 3.46e-58 5.55e-35 0.9078
1. PBF Q663Q7 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9007
1. PBF A8YY71 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.9022
1. PBF Q6NHT0 ATP synthase gamma chain 0.00e+00 3.53e-38 1.55e-24 0.8824
1. PBF Q0AJB1 ATP synthase gamma chain 0.00e+00 7.86e-54 1.01e-42 0.8935
1. PBF B1W0A4 ATP synthase gamma chain 0.00e+00 2.65e-45 2.30e-33 0.8762
1. PBF C0Q2N3 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8951
1. PBF B8HPK2 ATP synthase gamma chain 0.00e+00 2.08e-44 7.00e-46 0.876
1. PBF B1VFY6 ATP synthase gamma chain 0.00e+00 9.62e-40 2.61e-30 0.8605
1. PBF Q28TJ7 ATP synthase gamma chain 0.00e+00 7.30e-54 2.44e-33 0.8787
1. PBF C3PLT2 ATP synthase gamma chain 0.00e+00 7.13e-42 2.53e-25 0.8246
1. PBF Q1Q898 ATP synthase gamma chain 0.00e+00 1.62e-55 4.63e-46 0.9139
1. PBF B6J2D9 ATP synthase gamma chain 0.00e+00 3.65e-58 1.19e-35 0.9046
1. PBF Q5KUJ2 ATP synthase gamma chain 0.00e+00 8.64e-61 1.41e-44 0.9091
1. PBF B7HY65 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9188
1. PBF Q4UQF3 ATP synthase gamma chain 0.00e+00 1.05e-55 1.59e-42 0.8781
1. PBF Q1CSD4 ATP synthase gamma chain 0.00e+00 2.36e-55 2.16e-35 0.9035
1. PBF P41169 ATP synthase gamma chain 0.00e+00 5.32e-56 3.50e-36 0.8817
1. PBF A7ZC36 ATP synthase gamma chain 0.00e+00 2.85e-57 1.42e-31 0.9057
1. PBF Q5NQZ0 ATP synthase gamma chain 0.00e+00 1.39e-55 2.35e-43 0.9084
1. PBF A1SHJ0 ATP synthase gamma chain 0.00e+00 8.99e-51 1.26e-28 0.8663
1. PBF Q74GY1 ATP synthase gamma chain 0.00e+00 2.74e-58 2.53e-43 0.8956
1. PBF Q0SYU3 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8958
1. PBF Q1JHN6 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9094
1. PBF Q03QY7 ATP synthase gamma chain 0.00e+00 2.83e-54 2.40e-36 0.8442
1. PBF Q477Z2 ATP synthase gamma chain 0.00e+00 6.02e-60 8.80e-42 0.8991
1. PBF B9MBA2 ATP synthase gamma chain 0.00e+00 4.40e-57 3.18e-40 0.8723
1. PBF Q72E03 ATP synthase gamma chain 0.00e+00 3.58e-57 4.43e-39 0.9347
1. PBF P08450 ATP synthase gamma chain 0.00e+00 1.09e-46 1.67e-40 0.8264
1. PBF Q5P4E3 ATP synthase gamma chain 0.00e+00 9.90e-60 2.24e-46 0.8997
1. PBF B9MS69 ATP synthase gamma chain 0.00e+00 9.90e-60 1.47e-44 0.8698
1. PBF B2UZJ9 ATP synthase gamma chain 0.00e+00 2.12e-62 1.46e-47 0.8683
1. PBF Q8DLU1 ATP synthase gamma chain 0.00e+00 3.20e-44 1.13e-41 0.8582
1. PBF A7NEH5 ATP synthase gamma chain 0.00e+00 6.63e-55 2.11e-36 0.8882
1. PBF Q67TB8 ATP synthase gamma chain 0.00e+00 2.81e-59 9.42e-49 0.8676
1. PBF C3LFI0 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9002
1. PBF A3M143 ATP synthase gamma chain 0.00e+00 1.71e-57 1.01e-47 0.892
1. PBF Q6MS93 ATP synthase gamma chain 0.00e+00 5.12e-99 0.0 0.972
1. PBF A9WWS3 ATP synthase gamma chain 0.00e+00 7.67e-54 8.00e-30 0.8982
1. PBF Q31RF0 ATP synthase gamma chain 0.00e+00 1.51e-46 8.55e-41 0.8277
1. PBF B0BZL3 ATP synthase gamma chain 0.00e+00 2.50e-43 3.47e-42 0.8452
1. PBF Q1GEU7 ATP synthase gamma chain 0.00e+00 2.68e-55 8.15e-42 0.893
1. PBF Q9CER9 ATP synthase gamma chain 0.00e+00 6.79e-57 5.44e-48 0.8937
1. PBF B4U2E0 ATP synthase gamma chain 0.00e+00 9.51e-59 3.82e-43 0.9022
1. PBF C3M9S2 ATP synthase gamma chain 0.00e+00 7.70e-55 7.76e-31 0.8744
1. PBF A8ACN7 ATP synthase gamma chain 0.00e+00 8.87e-61 2.43e-44 0.8939
1. PBF A7MMX0 ATP synthase gamma chain 0.00e+00 8.31e-58 2.55e-46 0.8964
1. PBF B8DYT1 ATP synthase gamma chain 0.00e+00 2.19e-56 9.33e-33 0.8754
1. PBF Q4UK17 ATP synthase gamma chain 0.00e+00 4.36e-61 2.82e-28 0.8384
1. PBF Q04BA4 ATP synthase gamma chain 0.00e+00 3.99e-39 2.52e-34 0.8752
1. PBF Q2NQ87 ATP synthase gamma chain 0.00e+00 1.71e-59 7.89e-44 0.8999
1. PBF Q2LQZ6 ATP synthase gamma chain 0.00e+00 2.74e-58 1.89e-36 0.9058
1. PBF Q494C4 ATP synthase gamma chain 0.00e+00 4.84e-59 2.56e-38 0.9116
1. PBF A1SBU1 ATP synthase gamma chain 0.00e+00 4.75e-57 1.74e-46 0.8921
1. PBF Q2KU35 ATP synthase gamma chain 0.00e+00 1.03e-52 2.33e-39 0.8955
1. PBF B8D6S6 ATP synthase gamma chain 0.00e+00 1.43e-59 1.08e-35 0.9162
1. PBF C0MH18 ATP synthase gamma chain 0.00e+00 3.29e-58 1.24e-43 0.904
1. PBF A6T471 ATP synthase gamma chain 0.00e+00 1.67e-60 5.28e-41 0.8647
1. PBF Q87KA7 ATP synthase gamma chain 0.00e+00 3.84e-58 6.10e-47 0.8978
1. PBF B2IQX1 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.8897
1. PBF A5G9D7 ATP synthase gamma chain 0.00e+00 4.72e-59 5.93e-40 0.919
1. PBF A6VL58 ATP synthase gamma chain 0.00e+00 2.90e-56 1.13e-46 0.881
1. PBF C4K228 ATP synthase gamma chain 0.00e+00 5.79e-41 7.54e-26 0.8285
1. PBF O50289 ATP synthase gamma chain 0.00e+00 3.72e-61 5.38e-30 0.886
1. PBF Q1B552 ATP synthase gamma chain 0.00e+00 1.33e-49 2.55e-32 0.8784
1. PBF Q1C094 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9048
1. PBF A4SGM8 ATP synthase gamma chain 0.00e+00 3.46e-58 1.29e-41 0.9279
1. PBF Q03V28 ATP synthase gamma chain 0.00e+00 9.70e-57 1.59e-37 0.872
1. PBF P05436 ATP synthase gamma chain 0.00e+00 9.51e-59 1.53e-37 0.8653
1. PBF B4F0E6 ATP synthase gamma chain 0.00e+00 8.10e-58 1.69e-48 0.901
1. PBF Q4A603 ATP synthase gamma chain 0.00e+00 8.70e-67 9.17e-49 0.9266
1. PBF A3DAR5 ATP synthase gamma chain 0.00e+00 8.54e-57 2.02e-48 0.8929
1. PBF A5FZ53 ATP synthase gamma chain 0.00e+00 4.73e-52 2.21e-31 0.8991
1. PBF B8G6G7 ATP synthase gamma chain 0.00e+00 1.70e-53 4.84e-40 0.8972
1. PBF B7KKR3 ATP synthase gamma chain 0.00e+00 5.92e-45 7.44e-49 0.8684
1. PBF Q1QSC9 ATP synthase gamma chain 0.00e+00 1.20e-53 2.25e-39 0.9054
1. PBF A8M2J4 ATP synthase gamma chain 0.00e+00 2.08e-47 1.26e-31 0.8781
1. PBF B9KPI7 ATP synthase gamma chain 0.00e+00 4.40e-57 4.91e-33 0.876
1. PBF Q57B87 ATP synthase gamma chain 0.00e+00 2.69e-54 1.15e-28 0.9017
1. PBF A4STP4 ATP synthase gamma chain 0.00e+00 8.24e-60 3.10e-48 0.8992
1. PBF B0TQF5 ATP synthase gamma chain 0.00e+00 3.87e-57 2.91e-47 0.8908
1. PBF Q8Z9S5 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9031
1. PBF Q7P096 ATP synthase gamma chain 0.00e+00 2.25e-56 1.92e-39 0.8629
1. PBF B7K5I9 ATP synthase gamma chain 0.00e+00 5.78e-45 4.15e-47 0.8731
1. PBF Q5NIK4 ATP synthase gamma chain 0.00e+00 3.21e-54 5.16e-37 0.8873
1. PBF Q5FH34 ATP synthase gamma chain 0.00e+00 2.52e-46 1.12e-24 0.7943
1. PBF Q9L6B6 ATP synthase gamma chain 0.00e+00 1.94e-57 1.02e-47 0.8919
1. PBF B9L7Y6 ATP synthase gamma chain 0.00e+00 1.66e-56 3.61e-34 0.8887
1. PBF B2K846 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9024
1. PBF Q8Z2Q5 ATP synthase gamma chain 0.00e+00 1.95e-59 1.72e-45 0.8984
1. PBF A4XAW3 ATP synthase gamma chain 0.00e+00 1.93e-47 2.47e-31 0.8482
1. PBF C0HK53 ATP synthase subunit gamma, mitochondrial 0.00e+00 2.24e-40 1.25e-27 0.8337
1. PBF A6VF33 ATP synthase gamma chain 0.00e+00 8.46e-60 3.78e-43 0.9206
1. PBF Q02DF3 ATP synthase gamma chain 0.00e+00 8.46e-60 3.78e-43 0.9093
1. PBF A6H2D6 ATP synthase gamma chain 0.00e+00 1.40e-58 1.21e-34 0.8975
1. PBF Q1QQS6 ATP synthase gamma chain 0.00e+00 1.84e-55 5.17e-24 0.8942
1. PBF Q48BG4 ATP synthase gamma chain 0.00e+00 1.90e-60 2.09e-44 0.915
1. PBF A6WXX0 ATP synthase gamma chain 0.00e+00 9.83e-54 2.81e-30 0.9013
1. PBF A5VSE2 ATP synthase gamma chain 0.00e+00 7.67e-54 8.00e-30 0.8968
1. PBF Q21DK7 ATP synthase gamma chain 0.00e+00 2.05e-59 7.56e-45 0.919
1. PBF Q7VQV7 ATP synthase gamma chain 0.00e+00 1.36e-53 6.11e-39 0.8986
1. PBF B8ZR41 ATP synthase gamma chain 0.00e+00 2.89e-58 3.43e-35 0.8953
1. PBF Q3B1F5 ATP synthase gamma chain 0.00e+00 9.26e-59 2.04e-45 0.9078
1. PBF A1B8N9 ATP synthase gamma chain 0.00e+00 1.29e-57 1.16e-40 0.9057
1. PBF B0VNK3 ATP synthase gamma chain 0.00e+00 1.71e-57 1.01e-47 0.8952
1. PBF A5F458 ATP synthase gamma chain 0.00e+00 6.94e-58 4.01e-45 0.9022
1. PBF Q3J432 ATP synthase gamma chain 0.00e+00 8.99e-57 1.41e-32 0.8772
1. PBF Q64UA3 ATP synthase gamma chain 0.00e+00 4.51e-57 1.05e-26 0.8875
1. PBF Q7WEM8 ATP synthase gamma chain 0.00e+00 1.81e-51 5.94e-39 0.8956
1. PBF A5IUP9 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.8893
1. PBF Q1MAZ1 ATP synthase gamma chain 0.00e+00 5.85e-53 8.91e-36 0.8708
1. PBF Q4L7Y5 ATP synthase gamma chain 0.00e+00 6.35e-60 2.82e-43 0.8895
1. PBF O50158 ATP synthase gamma chain 0.00e+00 1.80e-57 1.91e-40 0.8999
1. PBF A0JY65 ATP synthase gamma chain 0.00e+00 7.51e-55 8.98e-31 0.8887
1. PBF B3CMR1 ATP synthase gamma chain 0.00e+00 3.83e-56 1.09e-26 0.7913
1. PBF Q5RBS9 ATP synthase subunit gamma, mitochondrial 0.00e+00 6.46e-22 7.14e-24 0.7896
1. PBF Q927W3 ATP synthase gamma chain 0.00e+00 2.32e-57 5.38e-44 0.8992
1. PBF Q0I7R3 ATP synthase gamma chain 0.00e+00 5.78e-45 1.56e-38 0.8398
1. PBF Q2ST35 ATP synthase gamma chain 0.00e+00 2.96e-91 4.62e-173 0.9871
1. PBF B7L880 ATP synthase gamma chain 0.00e+00 2.35e-58 4.84e-45 0.8979
1. PBF P29790 ATP synthase gamma chain, chloroplastic 0.00e+00 1.43e-11 8.18e-37 0.8594
1. PBF A8G1W6 ATP synthase gamma chain 0.00e+00 9.22e-57 6.71e-48 0.8924
1. PBF Q8ZKW8 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.893
1. PBF B3R7L6 ATP synthase gamma chain 0.00e+00 2.70e-57 4.30e-48 0.8909
1. PBF Q87TT3 ATP synthase gamma chain 0.00e+00 1.76e-60 1.20e-44 0.9172
1. PBF C5D991 ATP synthase gamma chain 0.00e+00 1.30e-58 5.07e-43 0.9062
1. PBF B7NF49 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8956
1. PBF B2ICI6 ATP synthase gamma chain 0.00e+00 4.13e-56 3.30e-35 0.8931
1. PBF B0RWC3 ATP synthase gamma chain 0.00e+00 1.05e-55 1.59e-42 0.8774
1. PBF B3H2P4 ATP synthase gamma chain 0.00e+00 2.75e-55 4.86e-48 0.8901
1. PBF A1AXU3 ATP synthase gamma chain 0.00e+00 4.97e-62 8.37e-46 0.9066
1. PBF B9DME4 ATP synthase gamma chain 0.00e+00 2.55e-62 4.21e-48 0.9077
1. PBF A5CVI7 ATP synthase gamma chain 0.00e+00 4.38e-63 1.97e-37 0.8867
1. PBF Q8RKV3 ATP synthase gamma chain 0.00e+00 5.51e-58 7.79e-47 0.8986
1. PBF Q89B40 ATP synthase gamma chain 0.00e+00 2.81e-59 6.04e-38 0.924
1. PBF Q4ZL23 ATP synthase gamma chain 0.00e+00 1.90e-60 2.09e-44 0.9062
1. PBF A5CQ59 ATP synthase gamma chain 0.00e+00 7.14e-55 3.49e-26 0.8803
1. PBF Q6HAX9 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9001
1. PBF B5YBP9 ATP synthase gamma chain 0.00e+00 1.63e-54 1.06e-28 0.8501
1. PBF A9W2R2 ATP synthase gamma chain 0.00e+00 2.30e-55 1.27e-30 0.8693
1. PBF A8EV71 ATP synthase gamma chain 0.00e+00 2.61e-55 8.17e-33 0.9176
1. PBF A9MJR8 ATP synthase gamma chain 0.00e+00 4.60e-58 2.66e-45 0.8961
1. PBF B4UKF1 ATP synthase gamma chain 0.00e+00 4.07e-60 4.31e-40 0.9066
1. PBF P12113 ATP synthase gamma chain, chloroplastic 0.00e+00 1.06e-28 4.41e-35 0.84
1. PBF B2G690 ATP synthase gamma chain 0.00e+00 2.00e-51 8.60e-38 0.8944
1. PBF B8IN02 ATP synthase gamma chain 0.00e+00 8.95e-55 5.79e-30 0.8634
1. PBF Q8FYR4 ATP synthase gamma chain 0.00e+00 7.67e-54 8.00e-30 0.8971
1. PBF A0L2S9 ATP synthase gamma chain 0.00e+00 1.22e-57 1.74e-48 0.8953
1. PBF P12408 ATP synthase gamma chain 0.00e+00 1.02e-46 2.06e-45 0.8494
1. PBF Q3K440 ATP synthase gamma chain 0.00e+00 7.38e-61 3.14e-46 0.9161
1. PBF C3KYJ2 ATP synthase gamma chain 0.00e+00 2.67e-60 2.15e-37 0.9227
1. PBF Q1LTV3 ATP synthase gamma chain 0.00e+00 3.66e-60 1.76e-42 0.8982
1. PBF Q71WP8 ATP synthase gamma chain 0.00e+00 2.32e-57 5.38e-44 0.9126
1. PBF B2I861 ATP synthase gamma chain 0.00e+00 2.26e-57 1.24e-39 0.8612
1. PBF A9KX07 ATP synthase gamma chain 0.00e+00 8.54e-57 2.02e-48 0.894
1. PBF Q68VU7 ATP synthase gamma chain 0.00e+00 5.67e-61 1.16e-25 0.8293
1. PBF A0LLF9 ATP synthase gamma chain 0.00e+00 5.87e-60 2.45e-41 0.9314
1. PBF A2RFC3 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9044
1. PBF Q2P7Q5 ATP synthase gamma chain 0.00e+00 6.52e-56 2.68e-41 0.88
1. PBF B2SQB1 ATP synthase gamma chain 0.00e+00 6.52e-56 2.68e-41 0.8895
1. PBF C5C1U7 ATP synthase gamma chain 0.00e+00 8.93e-52 5.53e-26 0.8756
1. PBF Q9A2V8 ATP synthase gamma chain 0.00e+00 5.85e-55 1.18e-22 0.8923
1. PBF B0THN3 ATP synthase gamma chain 0.00e+00 3.05e-54 1.58e-51 0.9267
1. PBF A1UR48 ATP synthase gamma chain 0.00e+00 1.77e-50 2.21e-33 0.902
1. PBF B1ZEE8 ATP synthase gamma chain 0.00e+00 1.14e-55 3.67e-32 0.8984
1. PBF O50141 ATP synthase gamma chain 0.00e+00 5.25e-65 4.82e-51 0.8895
1. PBF A0QCX7 ATP synthase gamma chain 0.00e+00 5.16e-55 8.95e-36 0.8771
1. PBF A0RL96 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9157
1. PBF A8G7M7 ATP synthase gamma chain 0.00e+00 1.54e-60 1.09e-46 0.9023
1. PBF A8HS13 ATP synthase gamma chain 0.00e+00 1.98e-55 1.89e-29 0.8829
1. PBF Q4QN63 ATP synthase gamma chain 0.00e+00 1.37e-58 1.06e-46 0.8816
1. PBF B7UMJ8 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.9181
1. PBF B3WDL7 ATP synthase gamma chain 0.00e+00 1.14e-48 3.86e-41 0.8543
1. PBF Q1CX34 ATP synthase gamma chain 0.00e+00 5.32e-56 1.79e-39 0.8981
1. PBF A1VIV1 ATP synthase gamma chain 0.00e+00 1.07e-61 2.27e-41 0.8733
1. PBF C1FQP4 ATP synthase gamma chain 0.00e+00 4.47e-61 1.06e-38 0.9202
1. PBF A9IYW8 ATP synthase gamma chain 0.00e+00 1.52e-48 1.71e-26 0.8512
1. PBF B1XHY7 ATP synthase gamma chain 0.00e+00 4.19e-46 3.79e-49 0.8592
1. PBF C0R4Q0 ATP synthase gamma chain 0.00e+00 3.29e-58 1.13e-27 0.8125
1. PBF P50006 ATP synthase gamma chain 0.00e+00 1.41e-46 2.95e-37 0.827
1. PBF A5VIR0 ATP synthase gamma chain 0.00e+00 2.00e-51 8.60e-38 0.8826
1. PBF A5EXJ6 ATP synthase gamma chain 0.00e+00 7.42e-60 2.88e-34 0.9068
1. PBF B3DTV1 ATP synthase gamma chain 0.00e+00 1.79e-43 5.97e-27 0.8723
1. PBF B2KEX2 ATP synthase gamma chain 0.00e+00 1.03e-52 4.62e-20 0.8728
1. PBF A5WBW0 ATP synthase gamma chain 0.00e+00 3.13e-56 3.58e-47 0.8984
1. PBF Q8D3J4 ATP synthase gamma chain 0.00e+00 1.70e-55 1.39e-36 0.927
1. PBF C0QTG6 ATP synthase gamma chain 0.00e+00 2.19e-56 4.14e-31 0.8803
1. PBF B8I578 ATP synthase gamma chain 0.00e+00 1.34e-54 3.06e-52 0.8702
1. PBF B7IQV9 ATP synthase gamma chain 0.00e+00 2.90e-56 1.71e-39 0.9067
1. PBF Q2S6P0 ATP synthase gamma chain 0.00e+00 6.79e-59 4.23e-49 0.9036
1. PBF Q112Z7 ATP synthase gamma chain 0.00e+00 5.28e-46 3.31e-45 0.8465
1. PBF B4RS82 ATP synthase gamma chain 0.00e+00 2.23e-60 9.60e-51 0.8847
1. PBF A6UDM2 ATP synthase gamma chain 0.00e+00 1.46e-55 1.75e-33 0.8891
1. PBF B5XKQ0 ATP synthase gamma chain 0.00e+00 1.11e-58 2.70e-44 0.9073
1. PBF Q5GRT1 ATP synthase gamma chain 0.00e+00 3.28e-55 1.24e-29 0.7803
1. PBF Q87E89 ATP synthase gamma chain 0.00e+00 2.26e-57 1.24e-39 0.8856
1. PBF Q79VG6 ATP synthase gamma chain 0.00e+00 2.64e-35 2.04e-24 0.8534
1. PBF Q2YLI6 ATP synthase gamma chain 0.00e+00 2.69e-54 1.15e-28 0.9146
1. PBF Q7UFB6 ATP synthase gamma chain 0.00e+00 2.07e-58 3.25e-30 0.8942
1. PBF Q7A4E8 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.89
1. PBF B2JJ96 ATP synthase gamma chain 0.00e+00 8.54e-57 8.01e-43 0.8901
1. PBF B8DRD1 ATP synthase gamma chain 0.00e+00 8.31e-55 1.87e-37 0.9199
1. PBF A9BCD8 ATP synthase gamma chain 0.00e+00 5.15e-44 2.86e-39 0.8169
1. PBF B3Q746 ATP synthase gamma chain 0.00e+00 1.19e-56 1.54e-24 0.9065
1. PBF Q2J3I3 ATP synthase gamma chain 0.00e+00 9.21e-58 2.14e-24 0.9028
1. PBF Q3BP14 ATP synthase gamma chain 0.00e+00 4.03e-56 2.09e-41 0.8801
1. PBF A0PUK1 ATP synthase gamma chain 0.00e+00 1.39e-53 3.53e-36 0.8789
1. PBF Q8PCZ6 ATP synthase gamma chain 0.00e+00 1.05e-55 1.59e-42 0.8799
1. PBF A9VSA4 ATP synthase gamma chain 0.00e+00 6.86e-56 2.39e-38 0.9049
1. PBF A3PET8 ATP synthase gamma chain 0.00e+00 9.07e-44 1.75e-38 0.8256
1. PBF B8FZ35 ATP synthase gamma chain 0.00e+00 1.44e-61 1.08e-48 0.9043
1. PBF A6LQH5 ATP synthase gamma chain 0.00e+00 6.62e-57 1.40e-47 0.9096
1. PBF Q04G21 ATP synthase gamma chain 0.00e+00 3.21e-56 7.98e-28 0.8961
1. PBF Q6LLG7 ATP synthase gamma chain 1 0.00e+00 1.14e-58 5.11e-44 0.895
1. PBF B1YMR5 ATP synthase gamma chain 0.00e+00 1.77e-61 5.50e-44 0.9098
1. PBF B0UWG6 ATP synthase gamma chain 0.00e+00 6.76e-58 1.92e-41 0.8812
1. PBF A1VXI9 ATP synthase gamma chain 0.00e+00 1.42e-57 2.85e-35 0.9211
1. PBF B5FCZ2 ATP synthase gamma chain 0.00e+00 5.52e-61 7.71e-45 0.9028
1. PBF A2BT24 ATP synthase gamma chain 0.00e+00 4.01e-44 1.59e-38 0.8269
1. PBF Q12HQ0 ATP synthase gamma chain 0.00e+00 4.51e-57 7.65e-46 0.8932
1. PBF Q5LD81 ATP synthase gamma chain 0.00e+00 1.42e-57 5.01e-27 0.8933
1. PBF Q07VU3 ATP synthase gamma chain 0.00e+00 3.55e-56 2.59e-46 0.8904
1. PBF B9JBZ6 ATP synthase gamma chain 0.00e+00 7.90e-55 2.39e-37 0.8816
1. PBF Q72SY0 ATP synthase gamma chain 0.00e+00 2.96e-59 3.25e-43 0.9062
1. PBF Q6G7K6 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.9009
1. PBF Q8RGE1 ATP synthase gamma chain 0.00e+00 8.56e-63 1.03e-48 0.9182
1. PBF P33257 ATP synthase gamma chain 0.00e+00 6.18e-65 4.69e-47 0.8712
1. PBF P72246 ATP synthase gamma chain 0.00e+00 2.75e-55 2.73e-30 0.8913
1. PBF A9KK93 ATP synthase gamma chain 0.00e+00 7.33e-57 7.73e-45 0.9223
1. PBF Q9JW71 ATP synthase gamma chain 0.00e+00 1.46e-59 3.36e-42 0.8677
1. PBF B9JTR3 ATP synthase gamma chain 0.00e+00 6.44e-54 6.16e-31 0.8937
1. PBF A6U3I9 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.8897
1. PBF Q9ZK80 ATP synthase gamma chain 0.00e+00 8.19e-56 1.97e-35 0.9078
1. PBF A4GAH0 ATP synthase gamma chain 0.00e+00 4.84e-61 8.58e-40 0.8695
1. PBF O51873 ATP synthase gamma chain 0.00e+00 3.83e-59 2.89e-36 0.9072
1. PBF B4SJS0 ATP synthase gamma chain 0.00e+00 1.20e-55 8.11e-42 0.8934
1. PBF A8AYG2 ATP synthase gamma chain 0.00e+00 1.16e-59 2.49e-42 0.9002
1. PBF A1TJ40 ATP synthase gamma chain 0.00e+00 4.07e-60 6.23e-41 0.8723
1. PBF A5V3X4 ATP synthase gamma chain 0.00e+00 6.61e-54 1.94e-36 0.8993
1. PBF Q82XP9 ATP synthase gamma chain 0.00e+00 5.42e-55 1.43e-41 0.904
1. PBF A5UGZ0 ATP synthase gamma chain 0.00e+00 1.95e-59 2.22e-46 0.8887
1. PBF A5GV71 ATP synthase gamma chain 0.00e+00 6.97e-46 2.60e-34 0.8679
1. PBF A9R5U0 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9037
1. PBF Q0BK83 ATP synthase gamma chain 0.00e+00 6.63e-55 2.11e-36 0.8981
1. PBF A3N2U5 ATP synthase gamma chain 0.00e+00 2.75e-55 4.86e-48 0.8847
1. PBF A1K1S1 ATP synthase gamma chain 0.00e+00 6.35e-60 6.64e-44 0.8967
1. PBF B0T336 ATP synthase gamma chain 0.00e+00 3.04e-55 5.45e-25 0.9044
1. PBF B0UE40 ATP synthase gamma chain 0.00e+00 9.29e-56 3.10e-33 0.9013
1. PBF A9GHR3 ATP synthase gamma chain 0.00e+00 3.13e-44 4.72e-34 0.8653
1. PBF Q2VZN1 ATP synthase gamma chain 0.00e+00 3.05e-54 7.44e-35 0.8931
1. PBF B5FN34 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.897
1. PBF A1BJF4 ATP synthase gamma chain 0.00e+00 9.69e-58 3.32e-41 0.9081
1. PBF Q98QU4 ATP synthase gamma chain 0.00e+00 8.05e-69 1.00e-61 0.916
1. PBF Q39Q55 ATP synthase gamma chain 0.00e+00 1.62e-57 3.00e-43 0.898
1. PBF B7HFK2 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9174
1. PBF Q88UU2 ATP synthase gamma chain 0.00e+00 3.27e-52 9.17e-35 0.8682
1. PBF Q6NDD1 ATP synthase gamma chain 0.00e+00 1.19e-56 1.54e-24 0.8989
1. PBF P09222 ATP synthase gamma chain 0.00e+00 1.07e-61 1.38e-44 0.9067
1. PBF Q4JUJ9 ATP synthase gamma chain 0.00e+00 3.34e-41 9.48e-36 0.869
1. PBF A0Q2Z5 ATP synthase gamma chain 0.00e+00 1.28e-63 3.11e-48 0.9325
1. PBF Q8E073 ATP synthase gamma chain 0.00e+00 7.71e-57 2.03e-48 0.8995
1. PBF Q1J7G0 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9072
1. PBF C5CNB2 ATP synthase gamma chain 0.00e+00 8.35e-59 1.44e-39 0.874
1. PBF Q162S8 ATP synthase gamma chain 0.00e+00 1.14e-55 3.33e-39 0.9067
1. PBF B2S7M4 ATP synthase gamma chain 0.00e+00 2.69e-54 1.15e-28 0.9007
1. PBF A3QJR1 ATP synthase gamma chain 0.00e+00 1.66e-56 1.20e-46 0.8936
1. PBF A9KBF8 ATP synthase gamma chain 0.00e+00 3.46e-58 5.55e-35 0.9054
1. PBF Q73X58 ATP synthase gamma chain 0.00e+00 5.16e-55 8.95e-36 0.8882
1. PBF Q0HD78 ATP synthase gamma chain 0.00e+00 9.69e-58 3.49e-48 0.895
1. PBF A0A161CFW5 ATP synthase subunit gamma, mitochondrial 0.00e+00 5.87e-38 3.20e-05 0.7853
1. PBF P0ABA7 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8983
1. PBF Q14K07 ATP synthase gamma chain 0.00e+00 3.21e-54 5.16e-37 0.8751
1. PBF A4TSJ2 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9012
1. PBF A8LJR5 ATP synthase gamma chain 0.00e+00 7.52e-57 1.32e-34 0.8683
1. PBF B2UGV0 ATP synthase gamma chain 0.00e+00 5.13e-57 1.02e-42 0.8834
1. PBF B4TN32 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8959
1. PBF B8GRB9 ATP synthase gamma chain 0.00e+00 3.57e-60 1.09e-46 0.8938
1. PBF Q1I2I6 ATP synthase gamma chain 0.00e+00 2.78e-61 1.67e-44 0.9047
1. PBF A9MXA7 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8897
1. PBF C3K1E7 ATP synthase gamma chain 0.00e+00 7.78e-61 2.45e-44 0.9211
1. PBF B0BRX3 ATP synthase gamma chain 0.00e+00 3.72e-55 1.39e-48 0.8917
1. PBF Q7VA64 ATP synthase gamma chain 0.00e+00 1.12e-40 1.18e-38 0.8506
1. PBF P9WPU8 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 0.8823
1. PBF Q5F4Z1 ATP synthase gamma chain 0.00e+00 1.32e-59 1.68e-41 0.8679
1. PBF Q2STE8 ATP synthase gamma chain 0.00e+00 5.37e-58 2.80e-40 0.8864
1. PBF Q62FR6 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8861
1. PBF B5XZM3 ATP synthase gamma chain 0.00e+00 2.16e-59 4.16e-44 0.9019
1. PBF Q1AVH8 ATP synthase gamma chain 0.00e+00 3.55e-59 7.44e-43 0.9342
1. PBF Q6FYM2 ATP synthase gamma chain 0.00e+00 2.60e-50 1.83e-27 0.8562
1. PBF P05631 ATP synthase subunit gamma, mitochondrial 0.00e+00 1.01e-21 1.73e-24 0.802
1. PBF Q5LNP0 ATP synthase gamma chain 0.00e+00 4.90e-55 2.64e-39 0.8759
1. PBF B5ZAW2 ATP synthase gamma chain 0.00e+00 3.74e-59 4.24e-53 0.8843
1. PBF B7KUA3 ATP synthase gamma chain 0.00e+00 1.70e-55 3.46e-31 0.8766
1. PBF B9E8E7 ATP synthase gamma chain 0.00e+00 9.90e-55 1.92e-43 0.9005
1. PBF A7G9Q8 ATP synthase gamma chain 0.00e+00 9.35e-61 1.68e-38 0.9207
1. PBF A4QDH2 ATP synthase gamma chain 0.00e+00 8.52e-36 1.60e-24 0.8578
1. PBF A9BPU6 ATP synthase gamma chain 0.00e+00 8.10e-58 2.92e-41 0.8684
1. PBF Q1GAW6 ATP synthase gamma chain 0.00e+00 3.99e-39 2.52e-34 0.8711
1. PBF A4YKD9 ATP synthase gamma chain 0.00e+00 8.46e-60 4.00e-24 0.8962
1. PBF Q97PT5 ATP synthase gamma chain 0.00e+00 4.48e-59 1.03e-43 0.9096
1. PBF Q1JCL4 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9156
1. PBF Q03LX4 ATP synthase gamma chain 0.00e+00 5.51e-58 7.79e-47 0.8977
1. PBF P42007 ATP synthase gamma chain 0.00e+00 6.51e-60 1.99e-44 0.8938
1. PBF B2GLY9 ATP synthase gamma chain 0.00e+00 3.47e-47 8.46e-29 0.8862
1. PBF P07227 ATP synthase gamma chain 0.00e+00 3.21e-54 9.13e-30 0.893
1. PBF Q042L4 ATP synthase gamma chain 0.00e+00 2.68e-41 5.98e-33 0.8439
1. PBF Q9RQ80 ATP synthase gamma chain 0.00e+00 1.89e-57 4.84e-36 0.9073
1. PBF Q57HX8 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8932
1. PBF B6JMX3 ATP synthase gamma chain 0.00e+00 3.46e-54 6.09e-36 0.9067
1. PBF A6W3S9 ATP synthase gamma chain 0.00e+00 1.71e-57 1.08e-44 0.9122
1. PBF B4EEY8 ATP synthase gamma chain 0.00e+00 8.76e-57 7.36e-40 0.8809
1. PBF A5FRQ4 ATP synthase gamma chain 0.00e+00 9.53e-56 2.41e-38 0.9108
1. PBF Q63PH9 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8861
1. PBF Q8CNJ6 ATP synthase gamma chain 0.00e+00 1.67e-59 1.37e-43 0.9025
1. PBF B5BIN7 ATP synthase gamma chain 0.00e+00 7.15e-59 2.72e-45 0.8945
1. PBF Q6MGM6 ATP synthase gamma chain 0.00e+00 3.94e-58 5.88e-42 0.8673
1. PBF A7FQH8 ATP synthase gamma chain 0.00e+00 3.21e-60 3.43e-38 0.9191
1. PBF B9LZ85 ATP synthase gamma chain 0.00e+00 3.57e-60 3.19e-45 0.905
1. PBF B5YXD7 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8965
1. PBF B2VCA5 ATP synthase gamma chain 0.00e+00 4.97e-58 8.16e-43 0.8955
1. PBF A0LDA1 ATP synthase gamma chain 0.00e+00 6.76e-58 1.91e-25 0.9005
1. PBF Q46J58 ATP synthase gamma chain 0.00e+00 1.46e-43 8.27e-40 0.838
1. PBF Q9ZJ02 ATP synthase gamma chain 0.00e+00 1.35e-59 2.28e-42 0.9012
1. PBF Q1GXM9 ATP synthase gamma chain 0.00e+00 5.37e-58 3.66e-41 0.8755
1. PBF Q4K3A8 ATP synthase gamma chain 0.00e+00 9.60e-61 4.18e-44 0.9044
1. PBF Q5HMB8 ATP synthase gamma chain 0.00e+00 1.67e-59 1.37e-43 0.9023
1. PBF C0RF51 ATP synthase gamma chain 0.00e+00 2.69e-54 1.15e-28 0.9001
1. PBF A4XKX1 ATP synthase gamma chain 0.00e+00 6.02e-60 1.55e-42 0.8687
1. PBF A5WBA4 ATP synthase gamma chain 0.00e+00 1.64e-61 6.57e-45 0.9056
1. PBF Q3SVJ3 ATP synthase gamma chain 0.00e+00 1.11e-55 3.66e-27 0.9077
1. PBF B3QWX8 ATP synthase gamma chain 0.00e+00 5.34e-52 3.16e-40 0.8998
1. PBF C0Q979 ATP synthase gamma chain 0.00e+00 3.63e-55 2.39e-29 0.9287
1. PBF Q2RV19 ATP synthase gamma chain 0.00e+00 3.21e-54 9.13e-30 0.8744
1. PBF A7GV57 ATP synthase gamma chain 0.00e+00 6.62e-57 3.38e-39 0.8899
1. PBF A0KQX9 ATP synthase gamma chain 0.00e+00 4.18e-60 9.47e-47 0.8977
1. PBF A7H1I0 ATP synthase gamma chain 0.00e+00 9.70e-57 7.13e-35 0.9258
1. PBF A4IW23 ATP synthase gamma chain 0.00e+00 4.55e-55 4.18e-37 0.8955
1. PBF B0TWS6 ATP synthase gamma chain 0.00e+00 4.11e-55 3.86e-39 0.8939
1. PBF C0Z777 ATP synthase gamma chain 0.00e+00 2.50e-57 2.29e-52 0.8956
1. PBF Q0BJL6 ATP synthase gamma chain 0.00e+00 4.87e-57 5.78e-41 0.8798
1. PBF Q7ANV0 ATP synthase gamma chain 0.00e+00 2.32e-57 5.38e-44 0.8925
1. PBF P22482 ATP synthase gamma chain 0.00e+00 2.22e-59 2.36e-37 0.907
1. PBF P28552 ATP synthase gamma chain, chloroplastic 5.33e-15 2.67e-12 3.29e-31 0.826
1. PBF Q0I5X2 ATP synthase gamma chain 0.00e+00 7.31e-58 1.56e-40 0.8829
1. PBF Q8XID3 ATP synthase gamma chain 0.00e+00 1.62e-67 1.51e-42 0.9177
1. PBF B6J962 ATP synthase gamma chain 0.00e+00 9.21e-58 9.51e-35 0.906
1. PBF Q50330 ATP synthase gamma chain 0.00e+00 4.55e-55 1.28e-36 0.8888
1. PBF Q7W3A9 ATP synthase gamma chain 0.00e+00 2.81e-51 6.26e-39 0.9175
1. PBF A1WZT2 ATP synthase gamma chain 0.00e+00 3.55e-59 4.12e-45 0.8931
1. PBF B4U6A3 ATP synthase gamma chain 0.00e+00 1.25e-57 6.40e-33 0.8897
1. PBF B1HM55 ATP synthase gamma chain 0.00e+00 2.13e-61 1.49e-41 0.9139
1. PBF B1AIB9 ATP synthase gamma chain 0.00e+00 7.31e-58 2.83e-55 0.8841
1. PBF A8GTS7 ATP synthase gamma chain 0.00e+00 1.97e-41 1.19e-24 0.8366
1. PBF A6Q4C1 ATP synthase gamma chain 0.00e+00 2.87e-49 6.25e-29 0.893
1. PBF Q2YCA4 ATP synthase gamma chain 0.00e+00 1.02e-56 2.83e-39 0.8941
1. PBF P49377 ATP synthase subunit gamma, mitochondrial 0.00e+00 9.66e-31 5.26e-23 0.8098
1. PBF P56082 ATP synthase gamma chain 0.00e+00 4.13e-56 5.19e-35 0.9208
1. PBF Q0SQZ4 ATP synthase gamma chain 0.00e+00 1.62e-67 1.51e-42 0.9165
1. PBF Q6A8C6 ATP synthase gamma chain 0.00e+00 5.30e-41 1.41e-33 0.8794
1. PBF Q9PJ20 ATP synthase gamma chain 0.00e+00 2.25e-56 3.23e-35 0.9231
1. PBF Q318U2 ATP synthase gamma chain 0.00e+00 2.39e-43 3.33e-37 0.8521
1. PBF Q98EV7 ATP synthase gamma chain 0.00e+00 6.34e-52 8.37e-29 0.8912
1. PBF A8F005 ATP synthase gamma chain 0.00e+00 4.52e-60 4.53e-34 0.8826
1. PBF B2T7K1 ATP synthase gamma chain 0.00e+00 2.19e-56 2.13e-41 0.8812
1. PBF Q73FU0 ATP synthase gamma chain 0.00e+00 1.89e-57 6.63e-27 0.8359
1. PBF B0SDA4 ATP synthase gamma chain 0.00e+00 6.52e-56 1.48e-38 0.9262
1. PBF B7V792 ATP synthase gamma chain 0.00e+00 8.46e-60 3.78e-43 0.9082
1. PBF C6DJH1 ATP synthase gamma chain 0.00e+00 2.67e-60 2.96e-47 0.9016
1. PBF Q8E5U9 ATP synthase gamma chain 0.00e+00 1.28e-56 7.18e-48 0.8998
1. PBF Q7VPP1 ATP synthase gamma chain 0.00e+00 2.26e-57 1.85e-44 0.8989
1. PBF Q8YJ36 ATP synthase gamma chain 0.00e+00 2.69e-54 1.15e-28 0.9004
1. PBF B8HAZ0 ATP synthase gamma chain 0.00e+00 8.68e-54 1.79e-28 0.8781
1. PBF A1KI97 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 0.8709
1. PBF Q06908 ATP synthase gamma chain, chloroplastic 0.00e+00 3.46e-15 9.37e-43 0.8406
1. PBF A4WUM8 ATP synthase gamma chain 0.00e+00 6.20e-56 9.93e-33 0.8847
1. PBF P50005 ATP synthase gamma chain, sodium ion specific 0.00e+00 6.29e-49 8.07e-52 0.9113
1. PBF Q7CND4 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.909
1. PBF Q223D5 ATP synthase gamma chain 0.00e+00 1.83e-56 7.59e-38 0.8801
1. PBF B3EHU5 ATP synthase gamma chain 0.00e+00 1.43e-59 2.93e-42 0.9123
1. PBF A5UQN4 ATP synthase gamma chain 0.00e+00 1.70e-55 1.35e-38 0.9055
1. PBF B7LK78 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.9202
1. PBF Q2YUK0 ATP synthase gamma chain 0.00e+00 5.89e-56 1.16e-41 0.9022
1. PBF A8FJR1 ATP synthase gamma chain 0.00e+00 2.09e-57 3.16e-35 0.9233
1. PBF P0CZ98 ATP synthase gamma chain 0.00e+00 3.64e-59 6.91e-44 0.9098
1. PBF A9NBC9 ATP synthase gamma chain 0.00e+00 3.46e-58 5.55e-35 0.8749
1. PBF B2TUP2 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8946
1. PBF P47640 ATP synthase gamma chain 0.00e+00 2.11e-59 7.15e-45 0.8835
1. PBF Q72XE7 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9187
1. PBF Q0A4M7 ATP synthase gamma chain 0.00e+00 1.10e-56 2.70e-40 0.9016
1. PBF A2SC69 ATP synthase gamma chain 0.00e+00 1.28e-60 1.14e-43 0.8963
1. PBF B8JCV1 ATP synthase gamma chain 0.00e+00 8.03e-60 8.33e-40 0.9051
1. PBF Q7U8W4 ATP synthase gamma chain 0.00e+00 5.16e-45 1.34e-37 0.873
1. PBF A9M122 ATP synthase gamma chain 0.00e+00 3.46e-59 1.46e-41 0.8684
1. PBF Q4FQ36 ATP synthase gamma chain 0.00e+00 8.99e-57 2.79e-45 0.9105
1. PBF Q9RQ74 ATP synthase gamma chain 0.00e+00 2.74e-51 3.80e-31 0.9095
1. PBF A1TD56 ATP synthase gamma chain 0.00e+00 2.54e-50 3.07e-31 0.8739
1. PBF A7IH30 ATP synthase gamma chain 0.00e+00 2.90e-54 8.65e-28 0.9153
1. PBF Q03A19 ATP synthase gamma chain 0.00e+00 1.59e-48 6.57e-41 0.853
1. PBF B4RD46 ATP synthase gamma chain 0.00e+00 7.51e-55 1.60e-30 0.8984
1. PBF Q5Z0Y2 ATP synthase gamma chain 0.00e+00 1.46e-45 6.14e-32 0.8616
1. PBF B8D8H2 ATP synthase gamma chain 0.00e+00 1.43e-59 1.08e-35 0.9164
1. PBF A1KW12 ATP synthase gamma chain 0.00e+00 1.95e-59 1.93e-41 0.8694
1. PBF Q7NA93 ATP synthase gamma chain 0.00e+00 1.32e-59 7.28e-50 0.9092
1. PBF Q3IK49 ATP synthase gamma chain 0.00e+00 4.07e-60 1.44e-46 0.8872
1. PBF Q1RKD8 ATP synthase gamma chain 0.00e+00 4.89e-60 1.83e-27 0.8244
1. PBF Q8A9U6 ATP synthase gamma chain 0.00e+00 8.68e-54 6.70e-29 0.8791
1. PBF B1MLW1 ATP synthase gamma chain 0.00e+00 3.03e-46 1.17e-26 0.8649
1. PBF Q49Z51 ATP synthase gamma chain 0.00e+00 6.55e-63 1.63e-47 0.8951
1. PBF C5BF39 ATP synthase gamma chain 0.00e+00 3.46e-59 3.91e-47 0.8945
1. PBF Q4R5B0 ATP synthase subunit gamma, mitochondrial 0.00e+00 1.48e-22 4.45e-23 0.7944
1. PBF A7I176 ATP synthase gamma chain 0.00e+00 2.54e-58 1.64e-27 0.9032
1. PBF B9DX62 ATP synthase gamma chain 0.00e+00 4.02e-67 3.16e-46 0.9155
1. PBF Q2G5N6 ATP synthase gamma chain 0.00e+00 1.54e-57 3.08e-39 0.8899
1. PBF Q21CY6 ATP synthase gamma chain 0.00e+00 1.50e-56 5.09e-26 0.8951
1. PBF A0ALL4 ATP synthase gamma chain 0.00e+00 3.87e-57 2.16e-43 0.8955
1. PBF Q6AQ11 ATP synthase gamma chain 0.00e+00 1.16e-56 1.62e-38 0.9072
1. PBF Q60CR5 ATP synthase gamma chain 0.00e+00 5.53e-57 1.62e-40 0.888
1. PBF A5CYE3 ATP synthase gamma chain 0.00e+00 2.57e-57 2.30e-47 0.9124
1. PBF A5GNC7 ATP synthase gamma chain 0.00e+00 8.15e-45 4.07e-40 0.8551
1. PBF Q2JIG1 ATP synthase gamma chain 0.00e+00 3.34e-45 2.30e-45 0.8506
1. PBF A0R201 ATP synthase gamma chain 0.00e+00 1.01e-51 9.04e-29 0.8711
1. PBF A5N3H8 ATP synthase gamma chain 0.00e+00 4.02e-67 3.16e-46 0.911
1. PBF A1AHR5 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8949
1. PBF Q04HT8 ATP synthase gamma chain 0.00e+00 4.48e-59 1.03e-43 0.9071
1. PBF P95788 ATP synthase gamma chain 0.00e+00 9.95e-58 4.36e-42 0.9192
1. PBF B6EHG5 ATP synthase gamma chain 0.00e+00 2.77e-62 5.51e-44 0.9015
1. PBF P0CZ99 ATP synthase gamma chain 0.00e+00 3.64e-59 6.91e-44 0.905
1. PBF O05432 ATP synthase gamma chain 0.00e+00 1.32e-60 1.88e-49 0.9284
1. PBF A7HT51 ATP synthase gamma chain 0.00e+00 5.36e-50 1.67e-30 0.904
1. PBF Q47M81 ATP synthase gamma chain 0.00e+00 2.48e-45 1.14e-25 0.8692
1. PBF Q8PGG6 ATP synthase gamma chain 0.00e+00 2.03e-55 2.68e-41 0.8819
1. PBF Q630U2 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.8958
1. PBF B4SGC6 ATP synthase gamma chain 0.00e+00 3.04e-55 1.44e-39 0.9203
1. PBF P20602 ATP synthase gamma chain 0.00e+00 1.01e-60 2.29e-42 0.9056
1. PBF A6TK64 ATP synthase gamma chain 0.00e+00 1.37e-58 2.10e-54 0.9329
1. PBF B7NR35 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8947
1. PBF C5BKJ6 ATP synthase gamma chain 0.00e+00 1.25e-59 1.20e-44 0.8949
1. PBF Q1R4K1 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8957
1. PBF C1DND4 ATP synthase gamma chain 0.00e+00 6.47e-61 5.14e-39 0.9126
1. PBF A0M6G3 ATP synthase gamma chain 0.00e+00 4.60e-59 1.15e-33 0.9179
1. PBF B7MGF3 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8974
1. PBF Q5HBD0 ATP synthase gamma chain 0.00e+00 3.25e-46 6.00e-24 0.7862
1. PBF P0ABA9 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8986
1. PBF Q5WB77 ATP synthase gamma chain 0.00e+00 1.90e-60 5.00e-37 0.9136
1. PBF B8EDV1 ATP synthase gamma chain 0.00e+00 8.54e-57 2.02e-48 0.8966
1. PBF A1V8T2 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8845
1. PBF A0Q8E0 ATP synthase gamma chain 0.00e+00 6.63e-55 2.11e-36 0.8962
1. PBF Q2GGH2 ATP synthase gamma chain 0.00e+00 2.31e-51 1.32e-25 0.7699
1. PBF B7H295 ATP synthase gamma chain 0.00e+00 1.71e-57 1.01e-47 0.9133
1. PBF C1F0M9 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.8999
1. PBF Q8EWY9 ATP synthase gamma chain 0.00e+00 1.81e-62 3.11e-53 0.9046
1. PBF B3PQ69 ATP synthase gamma chain 0.00e+00 1.30e-54 5.24e-34 0.877
1. PBF Q5HE96 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.9052
1. PBF A3DIM8 ATP synthase gamma chain 0.00e+00 4.48e-59 9.04e-39 0.8613
1. PBF Q9RGY2 ATP synthase gamma chain 0.00e+00 2.80e-41 2.89e-31 0.8839
1. PBF B1KSS7 ATP synthase gamma chain 0.00e+00 1.39e-60 1.25e-37 0.9258
1. PBF Q48UD4 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9048
1. PBF B4SYD2 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.895
1. PBF Q04ZU4 ATP synthase gamma chain 0.00e+00 8.14e-59 1.02e-44 0.9144
1. PBF Q8RC16 ATP synthase gamma chain 0.00e+00 1.94e-57 1.00e-21 0.8622
1. PBF Q1WUC7 ATP synthase gamma chain 0.00e+00 2.34e-53 9.91e-37 0.8727
1. PBF Q9HT19 ATP synthase gamma chain 0.00e+00 8.46e-60 3.78e-43 0.9061
1. PBF A0RR27 ATP synthase gamma chain 0.00e+00 1.15e-50 2.37e-28 0.8936
1. PBF Q5E1N6 ATP synthase gamma chain 0.00e+00 2.64e-61 6.56e-45 0.9016
1. PBF Q5PKX1 ATP synthase gamma chain 0.00e+00 7.15e-59 2.72e-45 0.8919
1. PBF Q7CRB2 ATP synthase gamma chain 0.00e+00 4.48e-59 1.03e-43 0.913
1. PBF A0LSL5 ATP synthase gamma chain 0.00e+00 1.67e-48 1.13e-25 0.923
1. PBF A5IYE4 ATP synthase gamma chain 0.00e+00 2.59e-65 1.66e-44 0.8736
1. PBF A7ZTU5 ATP synthase gamma chain 0.00e+00 2.35e-58 4.84e-45 0.8934
1. PBF Q02XA4 ATP synthase gamma chain 0.00e+00 1.66e-56 6.93e-51 0.8938
1. PBF Q9KNH4 ATP synthase gamma chain 0.00e+00 6.94e-58 4.01e-45 0.9044
1. PBF Q0C0Z9 ATP synthase gamma chain 0.00e+00 9.53e-56 3.63e-37 0.9017
1. PBF Q9RQ77 ATP synthase gamma chain 0.00e+00 3.05e-54 6.30e-36 0.9019
1. PBF B7N2H2 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8947
1. PBF B3EU99 ATP synthase gamma chain 0.00e+00 3.43e-61 3.27e-34 0.8947
1. PBF A5UA10 ATP synthase gamma chain 0.00e+00 1.43e-59 9.12e-47 0.8798
1. PBF A1T0Z0 ATP synthase gamma chain 0.00e+00 1.62e-59 9.24e-37 0.9212
1. PBF B7JGN1 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9155
1. PBF A1RQB1 ATP synthase gamma chain 0.00e+00 1.19e-56 1.15e-47 0.898
1. PBF B3E0Z9 ATP synthase gamma chain 0.00e+00 3.79e-52 8.61e-38 0.8876
1. PBF Q41075 ATP synthase gamma chain, chloroplastic 0.00e+00 1.30e-14 5.02e-40 0.8634
1. PBF Q0BQE7 ATP synthase gamma chain 0.00e+00 6.20e-56 1.78e-28 0.8674
1. PBF A9AVV3 ATP synthase gamma chain 0.00e+00 2.19e-56 2.57e-35 0.895
1. PBF Q5M5J2 ATP synthase gamma chain 0.00e+00 5.51e-58 7.79e-47 0.8834
1. PBF C3LSJ0 ATP synthase gamma chain 0.00e+00 6.94e-58 4.01e-45 0.9036
1. PBF B4RJF9 ATP synthase gamma chain 0.00e+00 3.55e-59 4.63e-41 0.8701
1. PBF Q9JXQ1 ATP synthase gamma chain 0.00e+00 8.35e-59 4.43e-41 0.8654
1. PBF B0RED5 ATP synthase gamma chain 0.00e+00 3.72e-55 4.96e-26 0.8894
1. PBF P43716 ATP synthase gamma chain 0.00e+00 7.23e-60 3.30e-46 0.8916
1. PBF B9DRT5 ATP synthase gamma chain 0.00e+00 1.76e-59 1.22e-46 0.9052
1. PBF A6W7G8 ATP synthase gamma chain 0.00e+00 2.80e-49 2.38e-37 0.8696
1. PBF O67829 ATP synthase gamma chain 0.00e+00 3.97e-57 2.03e-24 0.8807
1. PBF Q0SGP8 ATP synthase gamma chain 0.00e+00 2.46e-41 1.30e-32 0.8737
1. PBF B1MW86 ATP synthase gamma chain 0.00e+00 3.84e-58 5.56e-34 0.8918
1. PBF B1ZWN7 ATP synthase gamma chain 0.00e+00 9.34e-48 5.73e-31 0.8666
1. PBF B2UNX5 ATP synthase gamma chain 0.00e+00 2.74e-58 1.39e-30 0.8548
1. PBF A4YCH9 ATP synthase gamma chain 0.00e+00 1.19e-56 1.15e-47 0.8996
1. PBF B2TJZ9 ATP synthase gamma chain 0.00e+00 2.77e-62 1.31e-46 0.8675
1. PBF B2A3G3 ATP synthase gamma chain 0.00e+00 6.38e-47 2.19e-43 0.9059
1. PBF C1CF94 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.9062
1. PBF A4VS63 ATP synthase gamma chain 0.00e+00 1.10e-60 4.51e-40 0.8939
1. PBF C4ZZ11 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8922
1. PBF Q3AUA6 ATP synthase gamma chain 0.00e+00 1.50e-55 1.36e-31 0.9021
1. PBF A9H9A6 ATP synthase gamma chain 0.00e+00 7.15e-59 4.60e-31 0.8996
1. PBF C1D5G3 ATP synthase gamma chain 0.00e+00 1.24e-54 2.28e-40 0.9184
1. PBF A4FN28 ATP synthase gamma chain 0.00e+00 1.31e-48 4.53e-37 0.8815
1. PBF Q2J6N2 ATP synthase gamma chain 0.00e+00 1.01e-52 1.35e-36 0.8692
1. PBF B0BVB7 ATP synthase gamma chain 0.00e+00 1.97e-41 1.19e-24 0.827
1. PBF B0VBP4 ATP synthase gamma chain 0.00e+00 1.71e-57 1.01e-47 0.9002
1. PBF Q9PR14 ATP synthase gamma chain 0.00e+00 7.31e-58 2.83e-55 0.8818
1. PBF Q7VJ22 ATP synthase gamma chain 0.00e+00 8.31e-55 2.38e-31 0.9024
1. PBF Q6AG59 ATP synthase gamma chain 0.00e+00 1.29e-55 8.50e-29 0.8865
1. PBF B0SLC7 ATP synthase gamma chain 0.00e+00 6.52e-56 1.48e-38 0.921
1. PBF Q13SQ1 ATP synthase gamma chain 0.00e+00 2.90e-56 3.05e-41 0.8826
1. PBF A8YUK0 ATP synthase gamma chain 0.00e+00 2.56e-40 1.77e-31 0.8774
1. PBF Q3SF65 ATP synthase gamma chain 0.00e+00 5.98e-61 1.15e-41 0.9004
1. PBF Q8DDG9 ATP synthase gamma chain 0.00e+00 3.28e-59 2.59e-46 0.9015
1. PBF Q6LKZ7 ATP synthase gamma chain 2 0.00e+00 2.67e-60 1.65e-44 0.9081
1. PBF Q8KAW9 ATP synthase gamma chain 0.00e+00 1.32e-57 1.24e-36 0.9237
1. PBF B8H5I1 ATP synthase gamma chain 0.00e+00 5.85e-55 1.18e-22 0.8851
1. PBF Q92G87 ATP synthase gamma chain 6.92e-14 1.27e-41 3.27e-25 0.7948
1. PBF Q8E8B9 ATP synthase gamma chain 0.00e+00 1.89e-57 1.50e-49 0.8947
1. PBF C1CLK7 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.9116
1. PBF B5QUS5 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8952
1. PBF A5FL19 ATP synthase gamma chain 0.00e+00 2.35e-60 6.66e-36 0.9058
1. PBF Q02BU2 ATP synthase gamma chain 0.00e+00 5.55e-54 6.68e-35 0.9117
1. PBF Q8XU75 ATP synthase gamma chain 0.00e+00 7.62e-60 7.65e-45 0.8804
1. PBF A3MQJ8 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8952
1. PBF A1U7H5 ATP synthase gamma chain 0.00e+00 1.54e-62 1.14e-45 0.9087
1. PBF Q8KM29 ATP synthase gamma chain 0.00e+00 3.21e-56 7.98e-28 0.9072
1. PBF P17253 ATP synthase gamma chain 0.00e+00 1.91e-46 5.02e-44 0.8618
1. PBF B1XSD3 ATP synthase gamma chain 0.00e+00 6.64e-61 2.47e-45 0.8704
1. PBF P45824 ATP synthase gamma chain 0.00e+00 2.89e-58 3.43e-35 0.8876
1. PBF B3EL40 ATP synthase gamma chain 0.00e+00 1.23e-53 1.98e-37 0.924
1. PBF Q39KX7 ATP synthase gamma chain 0.00e+00 3.29e-58 7.71e-41 0.8859
1. PBF C1A697 ATP synthase gamma chain 0.00e+00 4.76e-60 1.37e-39 0.8863
1. PBF A8A6J6 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.9213
1. PBF Q9A0I8 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9051
1. PBF A4VVK0 ATP synthase gamma chain 0.00e+00 2.05e-54 1.04e-40 0.8894
1. PBF Q7VU45 ATP synthase gamma chain 0.00e+00 3.09e-51 6.33e-39 0.8989
1. PBF A8ZUA0 ATP synthase gamma chain 0.00e+00 8.68e-54 1.94e-28 0.9264
1. PBF B2UUP1 ATP synthase gamma chain 0.00e+00 1.17e-55 3.95e-35 0.912
1. PBF Q6KI81 ATP synthase gamma chain 0.00e+00 1.91e-62 4.29e-56 0.8827
1. PBF A5III4 ATP synthase gamma chain 0.00e+00 6.29e-57 5.39e-44 0.8936
1. PBF Q1CCH4 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9017
1. PBF B1JFU2 ATP synthase gamma chain 0.00e+00 1.87e-61 2.27e-44 0.9208
1. PBF C1AW00 ATP synthase gamma chain 0.00e+00 1.89e-41 1.46e-33 0.8653
1. PBF B1I6J8 ATP synthase gamma chain 0.00e+00 1.68e-51 1.11e-43 0.9322
1. PBF Q0TNC3 ATP synthase gamma chain 0.00e+00 1.62e-67 1.51e-42 0.9179
1. PBF Q7V5S8 ATP synthase gamma chain 0.00e+00 7.74e-44 1.72e-40 0.845
1. PBF B5RFW2 ATP synthase gamma chain 0.00e+00 1.40e-58 1.02e-45 0.8947
1. PBF Q2A1I1 ATP synthase gamma chain 0.00e+00 3.72e-55 2.50e-36 0.8999
1. PBF A1A3C6 ATP synthase gamma chain 0.00e+00 4.38e-42 1.26e-25 0.8772
1. PBF Q814W1 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9205
1. PBF B0KRA9 ATP synthase gamma chain 0.00e+00 1.04e-60 4.96e-44 0.917
1. PBF Q831A4 ATP synthase gamma chain 0.00e+00 1.50e-53 1.02e-47 0.8713
1. PBF Q9K6H4 ATP synthase gamma chain 0.00e+00 3.96e-60 8.95e-41 0.8849
1. PBF Q6CYJ4 ATP synthase gamma chain 0.00e+00 5.57e-60 5.06e-47 0.9012
1. PBF A7H018 ATP synthase gamma chain 0.00e+00 5.89e-56 6.35e-30 0.9057
1. PBF C0M719 ATP synthase gamma chain 0.00e+00 3.29e-58 1.24e-43 0.9113
1. PBF Q1LHK9 ATP synthase gamma chain 0.00e+00 1.93e-56 4.30e-48 0.8897
1. PBF Q48AW1 ATP synthase gamma chain 0.00e+00 2.53e-59 2.58e-49 0.8955
1. PBF Q15MU3 ATP synthase gamma chain 0.00e+00 8.87e-61 2.67e-44 0.9051
1. PBF Q4FP37 ATP synthase gamma chain 0.00e+00 8.98e-58 3.19e-39 0.8831
1. PBF C1C8A0 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.8896
1. PBF Q38WK4 ATP synthase gamma chain 0.00e+00 7.86e-43 1.62e-34 0.8447
1. PBF B1KQ35 ATP synthase gamma chain 0.00e+00 3.00e-57 1.63e-47 0.8922
1. PBF Q93Q45 ATP synthase gamma chain 0.00e+00 7.48e-65 1.79e-46 0.9231
1. PBF Q88BX3 ATP synthase gamma chain 0.00e+00 1.64e-61 6.57e-45 0.9196
1. PBF Q5H4Y5 ATP synthase gamma chain 0.00e+00 6.52e-56 2.68e-41 0.888
1. PBF Q5M105 ATP synthase gamma chain 0.00e+00 5.51e-58 7.79e-47 0.8834
1. PBF B7GTZ2 ATP synthase gamma chain 0.00e+00 2.74e-43 1.45e-26 0.8795
1. PBF A7NIR0 ATP synthase gamma chain 0.00e+00 3.55e-56 3.11e-39 0.8961
1. PBF A1WF57 ATP synthase gamma chain 0.00e+00 9.21e-58 1.23e-38 0.8721
1. PBF Q46VX9 ATP synthase gamma chain 0.00e+00 2.20e-57 1.05e-48 0.8936
1. PBF B8DBI0 ATP synthase gamma chain 0.00e+00 2.32e-57 5.38e-44 0.894
1. PBF A1W2T6 ATP synthase gamma chain 0.00e+00 4.40e-57 3.18e-40 0.866
1. PBF Q0TAX6 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.9157
1. PBF Q82J83 ATP synthase gamma chain 0.00e+00 4.81e-44 6.26e-28 0.8719
1. PBF P50007 ATP synthase gamma chain 0.00e+00 3.25e-46 7.35e-26 0.8803
1. PBF B8DWS3 ATP synthase gamma chain 0.00e+00 1.71e-45 1.08e-25 0.8652
1. PBF A3Q3B2 ATP synthase gamma chain 0.00e+00 1.33e-49 2.55e-32 0.8628
1. PBF A9M838 ATP synthase gamma chain 0.00e+00 7.30e-54 9.97e-30 0.9096
1. PBF C1CSC9 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.9045
1. PBF Q0K5M6 ATP synthase gamma chain 0.00e+00 7.50e-58 1.65e-48 0.8936
1. PBF B7M589 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8939
1. PBF Q3Z8Z3 ATP synthase gamma chain 0.00e+00 1.71e-57 1.66e-36 0.9062
1. PBF C1KYU7 ATP synthase gamma chain 0.00e+00 2.32e-57 5.38e-44 0.8921
1. PBF Q6GEX1 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.8888
1. PBF B1IE33 ATP synthase gamma chain 0.00e+00 8.20e-61 2.52e-38 0.9228
1. PBF Q6MAK6 ATP synthase gamma chain 0.00e+00 4.13e-56 3.22e-30 0.8791
1. PBF Q8EM82 ATP synthase gamma chain 0.00e+00 1.90e-59 3.38e-39 0.9073
1. PBF Q04S17 ATP synthase gamma chain 0.00e+00 8.14e-59 1.02e-44 0.9031
1. PBF B2FHY9 ATP synthase gamma chain 0.00e+00 1.19e-57 2.23e-40 0.8854
1. PBF Q9RAU1 ATP synthase gamma chain 0.00e+00 3.00e-57 1.12e-49 0.9182
1. PBF Q2JSW2 ATP synthase gamma chain 0.00e+00 8.73e-45 9.52e-44 0.8439
1. PBF B2GAU4 ATP synthase gamma chain 0.00e+00 3.33e-51 1.42e-34 0.8732
1. PBF P41010 ATP synthase gamma chain 0.00e+00 4.84e-61 8.27e-43 0.8986
1. PBF A4W1V8 ATP synthase gamma chain 0.00e+00 2.05e-54 1.04e-40 0.9046
1. PBF P0ABA8 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8945
1. PBF Q13DP3 ATP synthase gamma chain 0.00e+00 2.50e-57 2.51e-25 0.9018
1. PBF B2J059 ATP synthase gamma chain 0.00e+00 2.38e-44 9.88e-42 0.8361
1. PBF B5EFI8 ATP synthase gamma chain 0.00e+00 2.62e-56 4.71e-41 0.9063
1. PBF Q7NDC0 ATP synthase gamma chain 0.00e+00 4.00e-49 5.34e-46 0.8669
1. PBF B1JRN1 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9039
1. PBF A8G6V0 ATP synthase gamma chain 0.00e+00 1.42e-43 2.12e-39 0.8255
1. PBF B6YR05 ATP synthase gamma chain 0.00e+00 6.13e-57 7.14e-27 0.8773
1. PBF Q9K4D4 ATP synthase gamma chain 0.00e+00 1.78e-46 3.96e-27 0.8617
1. PBF P29710 ATP synthase gamma chain, sodium ion specific 0.00e+00 1.00e-55 1.42e-44 0.915
1. PBF Q12GQ1 ATP synthase gamma chain 0.00e+00 4.64e-60 8.95e-45 0.8678
1. PBF A6QB60 ATP synthase gamma chain 0.00e+00 1.85e-54 4.16e-32 0.8963
1. PBF A5E949 ATP synthase gamma chain 0.00e+00 2.73e-59 4.81e-24 0.8964
1. PBF Q329S2 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8973
1. PBF P43452 ATP synthase gamma chain 0.00e+00 1.03e-52 8.79e-46 0.8852
1. PBF A2S6J9 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8853
1. PBF Q89X73 ATP synthase gamma chain 0.00e+00 4.07e-57 6.62e-26 0.9199
1. PBF A4SUT3 ATP synthase gamma chain 0.00e+00 1.46e-60 9.65e-44 0.87
1. PBF P05435 ATP synthase gamma chain, chloroplastic 0.00e+00 2.80e-22 4.05e-39 0.9026
1. PBF Q9PE84 ATP synthase gamma chain 0.00e+00 7.69e-58 7.34e-40 0.8899
1. PBF Q65DX3 ATP synthase gamma chain 0.00e+00 9.78e-63 4.37e-44 0.9116
1. PBF Q6C338 ATP synthase subunit gamma, mitochondrial 0.00e+00 1.84e-25 6.06e-28 0.814
1. PBF B8CZ11 ATP synthase gamma chain 0.00e+00 2.17e-60 2.08e-39 0.8892
1. PBF Q0VKX3 ATP synthase gamma chain 0.00e+00 7.89e-58 2.01e-43 0.9071
1. PBF B9KES2 ATP synthase gamma chain 0.00e+00 3.04e-58 4.64e-30 0.9128
1. PBF P57123 ATP synthase gamma chain 0.00e+00 1.58e-59 6.86e-36 0.9067
1. PBF B1Y3S8 ATP synthase gamma chain 0.00e+00 7.89e-58 6.07e-44 0.8779
1. PBF Q3K1J6 ATP synthase gamma chain 0.00e+00 7.71e-57 2.03e-48 0.9102
1. PBF B8F773 ATP synthase gamma chain 0.00e+00 1.63e-54 9.22e-52 0.9016
1. PBF B1ICT0 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.905
1. PBF Q3JXV7 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8865
1. PBF Q3YVN7 ATP synthase gamma chain 0.00e+00 9.39e-60 9.52e-46 0.8989
1. PBF B4S3X4 ATP synthase gamma chain 0.00e+00 2.20e-54 8.33e-35 0.9204
1. PBF Q3ZZT8 ATP synthase gamma chain 0.00e+00 1.93e-56 2.49e-38 0.9079
1. PBF Q6F203 ATP synthase gamma chain 0.00e+00 7.79e-77 8.14e-130 0.9826
1. PBF B6I3X0 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8977
1. PBF Q9Z688 ATP synthase gamma chain 0.00e+00 1.32e-59 3.83e-43 0.921
1. PBF A5HY51 ATP synthase gamma chain 0.00e+00 3.21e-60 3.43e-38 0.9215
1. PBF A4T8K1 ATP synthase gamma chain 0.00e+00 1.10e-49 4.04e-32 0.8661
1. PBF C6E9F2 ATP synthase gamma chain 0.00e+00 1.32e-56 6.60e-40 0.9053
1. PBF B5Z8D1 ATP synthase gamma chain 0.00e+00 7.78e-56 8.37e-36 0.9317
1. PBF A2C4J4 ATP synthase gamma chain 0.00e+00 5.90e-44 6.60e-39 0.8377
1. PBF A6TG37 ATP synthase gamma chain 0.00e+00 4.84e-58 9.01e-45 0.8975
1. PBF Q99SF4 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.9007
1. PBF Q5WSG7 ATP synthase gamma chain 0.00e+00 6.29e-57 5.39e-44 0.8982
1. PBF Q3AZM0 ATP synthase gamma chain 0.00e+00 3.02e-47 1.48e-42 0.8731
1. PBF A6L4M5 ATP synthase gamma chain 0.00e+00 5.16e-55 5.71e-29 0.8545
1. PBF Q65Q06 ATP synthase gamma chain 0.00e+00 2.82e-55 1.00e-47 0.88
1. PBF A1R7V4 ATP synthase gamma chain 0.00e+00 2.46e-53 1.51e-27 0.8906
1. PBF B1IX05 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8973
1. PBF B1X9W1 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.8975
1. PBF A2C6X6 ATP synthase gamma chain 0.00e+00 9.28e-44 1.72e-40 0.8453
1. PBF A3CM13 ATP synthase gamma chain 0.00e+00 1.35e-59 2.28e-42 0.9013
1. PBF B5ER43 ATP synthase gamma chain 0.00e+00 1.42e-57 2.28e-37 0.9022
1. PBF P37810 ATP synthase gamma chain 0.00e+00 3.62e-61 2.29e-47 0.8938
1. PBF Q7MA19 ATP synthase gamma chain 0.00e+00 3.73e-56 3.00e-29 0.889
1. PBF A4WGF4 ATP synthase gamma chain 0.00e+00 4.15e-63 1.72e-45 0.8981
1. PBF Q11YP0 ATP synthase gamma chain 0.00e+00 2.86e-53 3.41e-32 0.8675
1. PBF B3EA02 ATP synthase gamma chain 0.00e+00 1.58e-57 3.87e-37 0.9001
1. PBF Q11DD6 ATP synthase gamma chain 0.00e+00 2.15e-54 2.21e-33 0.8979
1. PBF B6IPC7 ATP synthase gamma chain 0.00e+00 1.68e-58 4.92e-37 0.8942
1. PBF Q5XCY1 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9073
1. PBF B4TAX3 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8922
1. PBF Q0HPG0 ATP synthase gamma chain 0.00e+00 9.69e-58 3.49e-48 0.8938
1. PBF C4LDW1 ATP synthase gamma chain 0.00e+00 2.89e-60 2.87e-43 0.9086
1. PBF Q3J6N0 ATP synthase gamma chain 0.00e+00 8.01e-62 5.32e-45 0.8967
1. PBF Q05384 ATP synthase gamma chain 0.00e+00 6.91e-44 7.73e-42 0.8359
1. PBF Q92LK7 ATP synthase gamma chain 0.00e+00 6.80e-55 2.50e-31 0.8822
1. PBF A1UJY5 ATP synthase gamma chain 0.00e+00 1.33e-49 2.55e-32 0.8778
1. PBF C4KYS4 ATP synthase gamma chain 0.00e+00 3.30e-60 4.24e-42 0.9022
1. PBF Q8VV78 ATP synthase gamma chain 0.00e+00 6.51e-60 2.62e-50 0.8993
1. PBF Q74K16 ATP synthase gamma chain 0.00e+00 1.33e-40 2.71e-34 0.8195
1. PBF B5ZSN8 ATP synthase gamma chain 0.00e+00 1.49e-52 7.44e-35 0.877
1. PBF B2I101 ATP synthase gamma chain 0.00e+00 1.71e-57 1.01e-47 0.9136
1. PBF A7X4U4 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.9001
1. PBF P63672 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 0.8784
1. PBF A8HAG4 ATP synthase gamma chain 0.00e+00 2.14e-56 4.46e-48 0.8911
1. PBF B8ZLB0 ATP synthase gamma chain 0.00e+00 4.60e-59 1.58e-43 0.9113
1. PBF A7Z9Q1 ATP synthase gamma chain 0.00e+00 5.98e-61 7.60e-46 0.9145
1. PBF B0U599 ATP synthase gamma chain 0.00e+00 2.82e-58 1.37e-40 0.8712
1. PBF Q8UC75 ATP synthase gamma chain 0.00e+00 3.75e-53 5.24e-33 0.8831
1. PBF A3PIB8 ATP synthase gamma chain 0.00e+00 4.40e-57 4.91e-33 0.8781
1. PBF B2SEY0 ATP synthase gamma chain 0.00e+00 4.22e-55 3.56e-37 0.8882
1. PBF Q0AKV9 ATP synthase gamma chain 0.00e+00 1.36e-55 1.03e-29 0.9041
1. PBF B5EYZ7 ATP synthase gamma chain 0.00e+00 1.37e-58 1.41e-45 0.8935
1. PBF A1JTC7 ATP synthase gamma chain 0.00e+00 6.35e-60 5.44e-48 0.9016
1. PBF B1WUI3 ATP synthase gamma chain 0.00e+00 4.70e-44 1.51e-48 0.8768
1. PBF Q8FQ21 ATP synthase gamma chain 0.00e+00 6.12e-36 2.21e-24 0.8585
1. PBF Q1JMJ0 ATP synthase gamma chain 0.00e+00 2.66e-59 3.60e-44 0.9105
1. PBF P12990 ATP synthase gamma chain 0.00e+00 2.74e-58 4.47e-47 0.9011
1. PBF A3P0Z1 ATP synthase gamma chain 0.00e+00 1.39e-57 2.14e-40 0.8854
1. PBF B1YQL3 ATP synthase gamma chain 0.00e+00 4.87e-57 5.78e-41 0.8858
1. PBF Q07UZ4 ATP synthase gamma chain 0.00e+00 1.50e-57 1.62e-24 0.9011
1. PBF Q30QQ0 ATP synthase gamma chain 0.00e+00 1.20e-51 1.78e-32 0.9265
1. PBF Q7A0C5 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.8879
1. PBF B8CVU6 ATP synthase gamma chain 0.00e+00 3.32e-57 1.02e-47 0.8959
1. PBF A3NF41 ATP synthase gamma chain 0.00e+00 1.39e-57 2.26e-40 0.8954
1. PBF P26360 ATP synthase subunit gamma, mitochondrial 8.31e-13 1.61e-14 5.39e-29 0.7787
1. PBF Q7V038 ATP synthase gamma chain 0.00e+00 4.92e-44 3.19e-38 0.8506
1. PBF Q5QZI5 ATP synthase gamma chain 0.00e+00 2.70e-57 1.29e-42 0.8942
1. PBF B0JWV2 ATP synthase gamma chain 0.00e+00 1.02e-43 2.54e-46 0.8628
1. PBF C3P1F5 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.9073
1. PBF Q3AHK6 ATP synthase gamma chain 0.00e+00 1.38e-44 2.02e-40 0.8678
1. PBF Q1GQS6 ATP synthase gamma chain 0.00e+00 3.37e-56 1.25e-24 0.9002
1. PBF Q6G1W8 ATP synthase gamma chain 0.00e+00 7.41e-51 2.55e-28 0.8897
1. PBF Q5HX60 ATP synthase gamma chain 0.00e+00 4.75e-57 3.30e-35 0.9203
1. PBF C4K904 ATP synthase gamma chain 0.00e+00 3.25e-62 1.05e-42 0.8861
1. PBF Q17Y79 ATP synthase gamma chain 0.00e+00 5.16e-55 1.68e-35 0.902
1. PBF B2HQK3 ATP synthase gamma chain 0.00e+00 3.37e-54 1.57e-36 0.8873
1. PBF Q2IHQ1 ATP synthase gamma chain 0.00e+00 9.86e-61 8.04e-44 0.9024
1. PBF B9LBM1 ATP synthase gamma chain 0.00e+00 1.55e-54 1.51e-42 0.9018
1. PBF B3QL62 ATP synthase gamma chain 0.00e+00 3.87e-57 1.76e-36 0.9216
1. PBF Q2S431 ATP synthase gamma chain 0.00e+00 3.83e-50 5.17e-35 0.9125
1. PBF A8GY41 ATP synthase gamma chain 0.00e+00 1.79e-56 9.56e-31 0.8122
1. PBF Q7MGH9 ATP synthase gamma chain 0.00e+00 3.28e-59 2.59e-46 0.8991
1. PBF A4J9A0 ATP synthase gamma chain 0.00e+00 1.85e-59 1.91e-46 0.9368
1. PBF A6QIU8 ATP synthase gamma chain 0.00e+00 7.59e-56 1.06e-41 0.8859
1. PBF C5CA77 ATP synthase gamma chain 0.00e+00 2.69e-52 3.20e-29 0.9132
1. PBF A8GPZ5 ATP synthase gamma chain 0.00e+00 4.24e-62 8.32e-28 0.827
1. PBF Q31UN3 ATP synthase gamma chain 0.00e+00 3.04e-58 3.26e-46 0.8914
1. PBF C1AMV3 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 0.8766
1. PBF A7HIX8 ATP synthase gamma chain 0.00e+00 4.81e-56 4.15e-42 0.9016
1. PBF Q5X0P2 ATP synthase gamma chain 0.00e+00 1.50e-56 4.64e-44 0.8983
1. PBF A7FPE1 ATP synthase gamma chain 0.00e+00 3.66e-60 3.90e-48 0.9026
1. PBF Q81JZ4 ATP synthase gamma chain 0.00e+00 3.93e-56 5.94e-39 0.8958
1. PBF Q3A945 ATP synthase gamma chain 0.00e+00 2.64e-57 1.36e-53 0.8882
1. PBF A8FIB3 ATP synthase gamma chain 0.00e+00 3.28e-59 4.39e-41 0.9112
1. PBF A8L3W4 ATP synthase gamma chain 0.00e+00 2.65e-53 1.64e-40 0.8753
1. PBF A9HY41 ATP synthase gamma chain 0.00e+00 3.13e-54 1.03e-39 0.906
1. PBF Q5ZRA0 ATP synthase gamma chain 0.00e+00 6.29e-57 5.39e-44 0.8989
1. PBF Q3YS74 ATP synthase gamma chain 0.00e+00 4.14e-51 8.02e-28 0.7816
1. PBF Q5FRC6 ATP synthase gamma chain 0.00e+00 4.55e-55 2.72e-30 0.8666
1. PBF A6L8N4 ATP synthase gamma chain 0.00e+00 6.94e-58 2.41e-26 0.8827
1. PBF Q03EL3 ATP synthase gamma chain 0.00e+00 6.56e-51 2.66e-31 0.8592
1. PBF A9WNC7 ATP synthase gamma chain 0.00e+00 9.12e-53 3.20e-29 0.8805
1. PBF B2V6N5 ATP synthase gamma chain 0.00e+00 2.14e-56 2.42e-29 0.8956
1. PBF Q8G7B2 ATP synthase gamma chain 0.00e+00 1.79e-43 5.97e-27 0.8865
1. PBF B1LL60 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 0.9216
1. PBF C6BSP7 ATP synthase gamma chain 0.00e+00 7.12e-58 3.07e-37 0.9296
4. PB Q54DF1 ATP synthase subunit gamma, mitochondrial 6.92e-14 4.21e-34 1.60e-21 NA
4. PB P0C1M0 ATP synthase subunit gamma, chloroplastic 1.55e-15 3.42e-26 1.84e-34 NA
4. PB O74754 ATP synthase subunit gamma, mitochondrial 0.00e+00 2.45e-22 6.04e-24 NA
4. PB P9WPU9 ATP synthase gamma chain 0.00e+00 9.82e-53 3.50e-36 NA
4. PB Q01908 ATP synthase gamma chain 1, chloroplastic 2.00e-15 1.48e-13 2.20e-38 NA
4. PB Q01909 ATP synthase gamma chain 2, chloroplastic 2.22e-15 2.24e-10 3.76e-38 NA
4. PB P0ABA6 ATP synthase gamma chain 0.00e+00 6.12e-59 8.46e-46 NA
4. PB O01666 ATP synthase subunit gamma, mitochondrial 0.00e+00 1.07e-22 1.72e-30 NA
4. PB P38077 ATP synthase subunit gamma, mitochondrial 0.00e+00 2.82e-20 1.48e-20 NA
4. PB P36542 ATP synthase subunit gamma, mitochondrial 0.00e+00 1.97e-22 1.18e-23 NA
4. PB Q96250 ATP synthase subunit gamma, mitochondrial 1.25e-12 1.59e-15 1.77e-30 NA
4. PB P35435 ATP synthase subunit gamma, mitochondrial 0.00e+00 4.31e-40 1.92e-23 NA
4. PB Q91VR2 ATP synthase subunit gamma, mitochondrial 0.00e+00 3.85e-22 3.65e-24 NA
6. F Q9PR95 Uncharacterized protein UU050 4.29e-11 NA NA 0.5179
7. B Q2LGZ2 ATP synthase subunit gamma, chloroplastic (Fragment) 2.85e-04 NA 0.027 NA