Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54964.1
JCVISYN3A_0795
F0F1 ATP synthase subunit C.
M. mycoides homolog: Q6MS89.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 32
Unique PROST Go: 1
Unique BLAST Go: 3
Unique Foldseek Go: 0
Total Homologs: 576
Unique PROST Homologs: 191
Unique BLAST Homologs: 64
Unique Foldseek Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q8EWZ3
(ATP synthase subunit c) with a FATCAT P-Value: 0 and RMSD of 0.79 angstrom. The sequence alignment identity is 38.2%.
Structural alignment shown in left. Query protein AVX54964.1 colored as red in alignment, homolog Q8EWZ3 colored as blue.
Query protein AVX54964.1 is also shown in right top, homolog Q8EWZ3 showed in right bottom. They are colored based on secondary structures.
AVX54964.1 MLHTAFISNILANYLGAMSIILPNILAVDGNIKYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFV 100 Q8EWZ3 -----------------MNI--TN----QG-YAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76 AVX54964.1 V- 101 Q8EWZ3 AR 78
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0015986 | ATP synthesis coupled proton transport |
| 1. PBF | GO:0015078 | proton transmembrane transporter activity |
| 1. PBF | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
| 1. PBF | GO:0016021 | integral component of membrane |
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0031966 | mitochondrial membrane |
| 1. PBF | GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
| 1. PBF | GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) |
| 1. PBF | GO:0008289 | lipid binding |
| 4. PB | GO:0034703 | cation channel complex |
| 4. PB | GO:0045471 | response to ethanol |
| 4. PB | GO:0009535 | chloroplast thylakoid membrane |
| 4. PB | GO:0005829 | cytosol |
| 4. PB | GO:0061959 | response to (R)-carnitine |
| 4. PB | GO:0005753 | mitochondrial proton-transporting ATP synthase complex |
| 4. PB | GO:0005524 | ATP binding |
| 4. PB | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
| 4. PB | GO:0046931 | pore complex assembly |
| 4. PB | GO:0006754 | ATP biosynthetic process |
| 4. PB | GO:1905242 | response to 3,3',5-triiodo-L-thyronine |
| 4. PB | GO:0031676 | plasma membrane-derived thylakoid membrane |
| 4. PB | GO:0150034 | distal axon |
| 4. PB | GO:0042170 | plastid membrane |
| 4. PB | GO:0022834 | ligand-gated channel activity |
| 4. PB | GO:0010917 | negative regulation of mitochondrial membrane potential |
| 4. PB | GO:0045773 | positive regulation of axon extension |
| 4. PB | GO:1905232 | cellular response to L-glutamate |
| 4. PB | GO:0009631 | cold acclimation |
| 5. P | GO:0033179 | proton-transporting V-type ATPase, V0 domain |
| 7. B | GO:0070118 | organellar chromatophore thylakoid membrane |
| 7. B | GO:1901216 | positive regulation of neuron death |
| 7. B | GO:0009536 | plastid |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0015986 | ATP synthesis coupled proton transport |
| GO:0015078 | proton transmembrane transporter activity |
| GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
| GO:1902600 | proton transmembrane transport |
| GO:0016021 | integral component of membrane |
| GO:0006811 | ion transport |
| GO:0005886 | plasma membrane |
| GO:0033177 | proton-transporting two-sector ATPase complex, proton-transporting domain |
| GO:0016020 | membrane |
| GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
| GO:0006754 | ATP biosynthetic process |
| GO:0008289 | lipid binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q4A8W4 | ATP synthase subunit c | 1.53e-14 | 2.50e-44 | 6.90e-16 | 0.6902 |
| 1. PBF | B1LBC4 | ATP synthase subunit c | 2.05e-06 | 1.44e-21 | 1.23e-05 | 0.8533 |
| 1. PBF | Q01554 | ATP synthase subunit 9, mitochondrial | 3.83e-14 | 1.69e-06 | 4.23e-07 | 0.9471 |
| 1. PBF | A5ILW7 | ATP synthase subunit c | 2.02e-06 | 1.44e-21 | 1.23e-05 | 0.8549 |
| 1. PBF | Q602A0 | ATP synthase subunit c | 2.60e-13 | 2.27e-43 | 8.04e-16 | 0.7072 |
| 1. PBF | A8MJW4 | ATP synthase subunit c | 3.03e-09 | 6.34e-09 | 7.79e-11 | 0.9668 |
| 1. PBF | Q4AAW2 | ATP synthase subunit c | 1.83e-13 | 7.76e-44 | 7.78e-16 | 0.7101 |
| 1. PBF | Q98QU0 | ATP synthase subunit c | 9.49e-11 | 2.23e-33 | 7.42e-18 | 0.7995 |
| 1. PBF | Q6F207 | ATP synthase subunit c | 1.18e-14 | 1.62e-66 | 6.50e-34 | 0.7217 |
| 1. PBF | A7G9Q4 | ATP synthase subunit c | 3.10e-11 | 7.93e-11 | 1.46e-06 | 0.9386 |
| 1. PBF | Q4A5Z9 | ATP synthase subunit c | 7.65e-09 | 2.26e-36 | 5.69e-17 | 0.9059 |
| 1. PBF | Q3ZZU2 | ATP synthase subunit c | 9.44e-15 | 7.93e-11 | 3.46e-12 | 0.9601 |
| 1. PBF | Q8XIC9 | ATP synthase subunit c | 1.22e-15 | 2.06e-03 | 3.35e-06 | 0.9613 |
| 1. PBF | B2UZJ5 | ATP synthase subunit c | 1.11e-15 | 2.74e-03 | 1.77e-06 | 0.9658 |
| 1. PBF | Q6AQ28 | ATP synthase subunit c | 3.10e-11 | 4.23e-05 | 7.74e-08 | 0.8417 |
| 1. PBF | Q37377 | ATP synthase subunit 9, mitochondrial | 1.39e-10 | 1.90e-14 | 2.16e-06 | 0.8842 |
| 1. PBF | Q85Q98 | ATP synthase subunit 9, mitochondrial | 1.55e-14 | 8.07e-10 | 0.047 | 0.9571 |
| 1. PBF | Q0ZS24 | ATP synthase subunit c, sodium ion specific | 4.36e-11 | 7.91e-04 | 2.69e-10 | 0.9475 |
| 1. PBF | Q8EWZ3 | ATP synthase subunit c | 0.00e+00 | 1.67e-05 | 9.27e-18 | 0.9742 |
| 1. PBF | A0Q2Z9 | ATP synthase subunit c | 4.61e-10 | 1.57e-07 | 4.87e-10 | 0.9375 |
| 1. PBF | B2TJZ5 | ATP synthase subunit c | 9.99e-16 | 2.74e-03 | 1.77e-06 | 0.9663 |
| 1. PBF | Q0SQZ0 | ATP synthase subunit c | 1.55e-15 | 3.76e-04 | 6.57e-07 | 0.9603 |
| 1. PBF | P47644 | ATP synthase subunit c | 3.00e-15 | 1.16e-38 | 5.27e-10 | 0.7111 |
| 1. PBF | B1IE29 | ATP synthase subunit c | 3.48e-11 | 7.93e-11 | 1.46e-06 | 0.9347 |
| 1. PBF | A7FQH4 | ATP synthase subunit c | 3.32e-11 | 7.93e-11 | 1.46e-06 | 0.9358 |
| 1. PBF | B2A3G7 | ATP synthase subunit c | 5.19e-10 | 1.31e-06 | 6.71e-05 | 0.9652 |
| 1. PBF | Q9X1V0 | ATP synthase subunit c | 2.04e-06 | 1.44e-21 | 1.23e-05 | 0.8533 |
| 1. PBF | A5HY47 | ATP synthase subunit c | 2.84e-11 | 7.93e-11 | 1.46e-06 | 0.94 |
| 1. PBF | Q6MS89 | ATP synthase subunit c | 7.01e-13 | 2.53e-120 | 8.77e-62 | 0.8036 |
| 1. PBF | A5FRR4 | ATP synthase subunit c | 7.11e-15 | 7.93e-11 | 3.46e-12 | 0.9609 |
| 1. PBF | Q2ST39 | ATP synthase subunit c | 0.00e+00 | 2.45e-113 | 1.49e-61 | 0.7095 |
| 1. PBF | A5IYE0 | ATP synthase subunit c | 6.22e-15 | 1.55e-03 | 2.09e-09 | 0.9528 |
| 1. PBF | Q59550 | ATP synthase subunit c | 1.15e-14 | 1.06e-38 | 3.84e-12 | 0.6951 |
| 1. PBF | A9BFX8 | ATP synthase subunit c | 1.82e-11 | 6.91e-32 | 2.67e-12 | 0.7288 |
| 1. PBF | O08310 | ATP synthase subunit c | 6.02e-11 | 1.90e-12 | 2.68e-09 | 0.9694 |
| 1. PBF | P33258 | ATP synthase subunit c | 4.12e-13 | 1.01e-38 | 2.77e-08 | 0.6975 |
| 1. PBF | Q2LRB9 | ATP synthase subunit c | 3.96e-12 | 9.78e-27 | 2.38e-07 | 0.709 |
| 1. PBF | Q0TNB9 | ATP synthase subunit c | 7.77e-16 | 2.06e-03 | 3.35e-06 | 0.9631 |
| 1. PBF | Q3Z8Z7 | ATP synthase subunit c | 4.66e-15 | 7.93e-11 | 3.46e-12 | 0.9603 |
| 1. PBF | B1KSS3 | ATP synthase subunit c | 2.92e-11 | 7.93e-11 | 1.46e-06 | 0.9403 |
| 1. PBF | Q6KI76 | ATP synthase subunit c | 6.12e-11 | 9.54e-43 | 1.06e-17 | 0.7318 |
| 2. PF | O66564 | ATP synthase subunit c | 3.79e-12 | 2.58e-29 | NA | 0.7226 |
| 2. PF | A9KK97 | ATP synthase subunit c | 7.99e-15 | 2.20e-05 | NA | 0.9571 |
| 2. PF | Q8R5T5 | ATP synthase subunit c | 3.34e-14 | 1.24e-02 | NA | 0.951 |
| 2. PF | B8I574 | ATP synthase subunit c | 7.57e-14 | 2.70e-05 | NA | 0.9212 |
| 3. BF | Q180X0 | ATP synthase subunit c | 1.13e-10 | NA | 4.98e-05 | 0.8985 |
| 3. BF | A0LIN9 | ATP synthase subunit c | 4.38e-13 | NA | 4.30e-08 | 0.9431 |
| 4. PB | B1NWD7 | ATP synthase subunit c, chloroplastic | 5.23e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q6YXK1 | ATP synthase subunit c, chloroplastic | 5.73e-14 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q9MUT0 | ATP synthase subunit c, chloroplastic | 1.87e-12 | 9.60e-03 | 4.99e-06 | NA |
| 4. PB | B2LMI5 | ATP synthase subunit c, chloroplastic | 5.60e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B2UUX5 | ATP synthase subunit c | 5.87e-11 | 1.42e-32 | 0.032 | NA |
| 4. PB | Q2MIK0 | ATP synthase subunit c, chloroplastic | 1.93e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q8G7A8 | ATP synthase subunit c | 2.19e-12 | 1.17e-13 | 0.005 | NA |
| 4. PB | Q09X30 | ATP synthase subunit c, chloroplastic | 5.12e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A0T0E7 | ATP synthase subunit c, chloroplastic | 6.99e-14 | 2.17e-02 | 1.64e-05 | NA |
| 4. PB | Q32RS6 | ATP synthase subunit c, chloroplastic | 1.89e-12 | 4.30e-04 | 2.31e-05 | NA |
| 4. PB | A4QK92 | ATP synthase subunit c, chloroplastic | 5.54e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B0RED9 | ATP synthase subunit c | 1.13e-11 | 4.16e-16 | 2.69e-04 | NA |
| 4. PB | A4QKH9 | ATP synthase subunit c, chloroplastic | 5.78e-14 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | A3PS63 | ATP synthase subunit c 2 | 2.22e-14 | 4.67e-04 | 1.55e-04 | NA |
| 4. PB | B2J054 | ATP synthase subunit c | 1.71e-12 | 1.30e-04 | 2.01e-04 | NA |
| 4. PB | B3DTV5 | ATP synthase subunit c | 2.05e-12 | 1.17e-13 | 0.005 | NA |
| 4. PB | P69449 | ATP synthase subunit c, chloroplastic | 7.09e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q3A941 | ATP synthase subunit c | 6.70e-11 | 3.15e-05 | 4.88e-06 | NA |
| 4. PB | Q4FGF0 | ATP synthase subunit c, chloroplastic | 4.45e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P06286 | ATP synthase subunit c, chloroplastic | 1.78e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q7VA59 | ATP synthase subunit c | 1.67e-12 | 9.20e-04 | 6.52e-09 | NA |
| 4. PB | Q49L11 | ATP synthase subunit c, chloroplastic | 5.67e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A5CQ53 | ATP synthase subunit c | 2.95e-11 | 2.19e-17 | 2.97e-05 | NA |
| 4. PB | Q33C51 | ATP synthase subunit c, chloroplastic | 1.59e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P12409 | ATP synthase subunit c | 5.00e-14 | 2.27e-05 | 5.88e-05 | NA |
| 4. PB | A5GND2 | ATP synthase subunit c | 1.89e-12 | 1.14e-03 | 3.55e-05 | NA |
| 4. PB | Q7V5S3 | ATP synthase subunit c | 1.88e-12 | 1.17e-03 | 1.00e-07 | NA |
| 4. PB | P48880 | ATP synthase subunit 9, mitochondrial | 7.19e-13 | 6.45e-11 | 2.01e-07 | NA |
| 4. PB | Q7HKY1 | ATP synthase subunit c, chloroplastic | 5.44e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P61172 | ATP synthase subunit c, chloroplastic | 1.93e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A3PEU3 | ATP synthase subunit c | 1.96e-12 | 7.30e-04 | 1.21e-08 | NA |
| 4. PB | Q37695 | ATP synthase subunit 9, mitochondrial | 3.94e-14 | 1.15e-09 | 1.95e-08 | NA |
| 4. PB | A9QC36 | ATP synthase subunit c, chloroplastic | 1.79e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | A5GV76 | ATP synthase subunit c | 7.47e-14 | 3.68e-02 | 1.51e-06 | NA |
| 4. PB | B0Z5D2 | ATP synthase subunit c, chloroplastic | 1.71e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | A4QJS0 | ATP synthase subunit c, chloroplastic | 5.24e-14 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | P56087 | ATP synthase subunit c | 7.94e-11 | 4.33e-32 | 0.026 | NA |
| 4. PB | P05496 | ATP synthase F(0) complex subunit C1, mitochondrial | 9.79e-08 | 2.41e-03 | 8.78e-07 | NA |
| 4. PB | A0RQF4 | ATP synthase subunit c | 3.88e-10 | 9.04e-26 | 0.006 | NA |
| 4. PB | P21905 | ATP synthase subunit c, sodium ion specific | 4.62e-09 | 1.06e-08 | 6.91e-08 | NA |
| 4. PB | Q7HJJ2 | ATP synthase subunit c, chloroplastic | 6.12e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q2LCR3 | ATP synthase subunit 9, mitochondrial | 8.95e-12 | 8.20e-23 | 1.22e-04 | NA |
| 4. PB | B6YR09 | ATP synthase subunit c | 2.05e-08 | 4.29e-21 | 4.71e-04 | NA |
| 4. PB | B7GTY8 | ATP synthase subunit c | 4.57e-12 | 2.10e-12 | 0.006 | NA |
| 4. PB | A4QJA2 | ATP synthase subunit c, chloroplastic | 5.07e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | O05331 | ATP synthase subunit c | 1.11e-10 | 5.37e-09 | 0.031 | NA |
| 4. PB | Q06GS3 | ATP synthase subunit c, chloroplastic | 1.56e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | P56384 | ATP synthase F(0) complex subunit C3, mitochondrial | 8.98e-10 | 4.23e-03 | 1.51e-06 | NA |
| 4. PB | A8W3H7 | ATP synthase subunit C, plastid | 5.21e-14 | 6.21e-03 | 2.15e-05 | NA |
| 4. PB | A9L983 | ATP synthase subunit c, chloroplastic | 1.71e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B0JWU7 | ATP synthase subunit c | 6.95e-14 | 1.98e-04 | 1.37e-05 | NA |
| 4. PB | B7KKR8 | ATP synthase subunit c | 1.48e-12 | 1.63e-05 | 1.49e-04 | NA |
| 4. PB | A3M139 | ATP synthase subunit c | 1.89e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q4FGE9 | ATP synthase subunit c, chloroplastic | 5.03e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P15014 | ATP synthase subunit c | 1.13e-12 | 1.57e-07 | 3.93e-08 | NA |
| 4. PB | Q09G59 | ATP synthase subunit c, chloroplastic | 1.83e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B9LBM5 | ATP synthase subunit c | 1.15e-13 | 1.29e-04 | 3.88e-05 | NA |
| 4. PB | A4GGB0 | ATP synthase subunit c, chloroplastic | 7.37e-14 | 1.66e-03 | 1.28e-05 | NA |
| 4. PB | Q19VA3 | ATP synthase subunit c, chloroplastic | 5.72e-14 | 2.49e-02 | 2.75e-05 | NA |
| 4. PB | B3CQT8 | ATP synthase subunit c | 2.49e-10 | 8.37e-07 | 1.67e-04 | NA |
| 4. PB | B5LMM9 | ATP synthase subunit c, chloroplastic | 1.79e-12 | 5.08e-03 | 9.81e-06 | NA |
| 4. PB | A6MMA9 | ATP synthase subunit c, chloroplastic | 6.35e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | C0R5U2 | ATP synthase subunit c | 1.24e-11 | 6.44e-06 | 1.24e-05 | NA |
| 4. PB | A1E9R9 | ATP synthase subunit c, chloroplastic | 1.78e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q37304 | ATP synthase subunit c, chloroplastic | 6.87e-14 | 9.66e-05 | 2.85e-04 | NA |
| 4. PB | Q7GUD2 | ATP synthase subunit c, chloroplastic | 6.11e-14 | 2.48e-03 | 9.40e-06 | NA |
| 4. PB | A8G6V5 | ATP synthase subunit c | 1.87e-12 | 7.30e-04 | 1.21e-08 | NA |
| 4. PB | Q5SCX4 | ATP synthase subunit c, chloroplastic | 6.41e-14 | 2.27e-03 | 3.59e-05 | NA |
| 4. PB | A2BYI0 | ATP synthase subunit c | 2.04e-12 | 7.30e-04 | 1.21e-08 | NA |
| 4. PB | A8GUJ2 | ATP synthase subunit c | 6.79e-13 | 6.02e-06 | 2.49e-07 | NA |
| 4. PB | P48201 | ATP synthase F(0) complex subunit C3, mitochondrial | 1.38e-08 | 5.43e-03 | 1.73e-06 | NA |
| 4. PB | B3CLG2 | ATP synthase subunit c | 1.10e-11 | 6.44e-06 | 1.24e-05 | NA |
| 4. PB | A4QKR8 | ATP synthase subunit c, chloroplastic | 1.92e-12 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | Q1KXW7 | ATP synthase subunit c, chloroplastic | 5.02e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A8XDX2 | ATP synthase lipid-binding protein, mitochondrial | 1.36e-09 | 6.15e-12 | 2.53e-06 | NA |
| 4. PB | A2C6X1 | ATP synthase subunit c | 1.75e-12 | 1.17e-03 | 1.00e-07 | NA |
| 4. PB | A6MM23 | ATP synthase subunit c, chloroplastic | 1.67e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q6ENW8 | ATP synthase subunit c, chloroplastic | 5.57e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q112Z2 | ATP synthase subunit c | 7.11e-14 | 3.46e-04 | 1.73e-04 | NA |
| 4. PB | Q6EW61 | ATP synthase subunit c, chloroplastic | 1.72e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B5Z8K9 | ATP synthase subunit c | 8.77e-11 | 2.71e-32 | 0.043 | NA |
| 4. PB | O78479 | ATP synthase subunit c, chloroplastic | 6.95e-14 | 2.58e-03 | 2.55e-05 | NA |
| 4. PB | A4GYP5 | ATP synthase subunit c, chloroplastic | 1.82e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A9WGS9 | ATP synthase subunit c | 6.13e-14 | 1.29e-04 | 3.88e-05 | NA |
| 4. PB | Q06RE4 | ATP synthase subunit c, chloroplastic | 5.55e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q36852 | ATP synthase subunit 9, mitochondrial | 4.84e-14 | 3.94e-09 | 0.001 | NA |
| 4. PB | P69195 | ATP synthase subunit c, chloroplastic | 1.94e-12 | 1.66e-03 | 1.28e-05 | NA |
| 4. PB | P08212 | ATP synthase subunit c, chloroplastic | 5.86e-14 | 4.57e-03 | 4.78e-06 | NA |
| 4. PB | Q6FFK5 | ATP synthase subunit c | 2.00e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q0G9N2 | ATP synthase subunit c, chloroplastic | 5.70e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A9NGW7 | ATP synthase subunit c | 1.20e-09 | 1.93e-28 | 1.11e-08 | NA |
| 4. PB | A9HDM8 | ATP synthase subunit c | 2.80e-13 | 9.46e-10 | 8.14e-05 | NA |
| 4. PB | B3TN46 | ATP synthase subunit c, chloroplastic | 7.52e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q68S19 | ATP synthase subunit c, chloroplastic | 1.59e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q6MAK2 | ATP synthase subunit c | 2.54e-09 | 1.51e-28 | 7.14e-05 | NA |
| 4. PB | C3PM50 | ATP synthase subunit c | 3.38e-13 | 5.44e-06 | 1.94e-07 | NA |
| 4. PB | Q71S46 | ATP synthase F(0) complex subunit C3, mitochondrial | 2.24e-08 | 5.43e-03 | 1.73e-06 | NA |
| 4. PB | A1E9I6 | ATP synthase subunit c, chloroplastic | 1.90e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | B0VNJ9 | ATP synthase subunit c | 2.14e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q9ZK12 | ATP synthase subunit c | 2.28e-10 | 2.71e-32 | 0.043 | NA |
| 4. PB | A4QL06 | ATP synthase subunit c, chloroplastic | 1.60e-12 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | Q32RK9 | ATP synthase subunit c, chloroplastic | 7.62e-14 | 2.21e-02 | 1.33e-05 | NA |
| 4. PB | A9RAH4 | ATP synthase subunit 9, mitochondrial | 2.90e-12 | 3.37e-08 | 0.003 | NA |
| 4. PB | Q14FH0 | ATP synthase subunit c, chloroplastic | 1.81e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q09MJ1 | ATP synthase subunit c, chloroplastic | 5.55e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B0Z548 | ATP synthase subunit c, chloroplastic | 7.09e-14 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | A9BCE3 | ATP synthase subunit c | 1.82e-12 | 9.20e-04 | 6.52e-09 | NA |
| 4. PB | A0A322 | ATP synthase subunit c, chloroplastic | 5.22e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P62481 | ATP synthase subunit c, chloroplastic | 1.72e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | C4K0P2 | ATP synthase subunit c | 5.24e-12 | 4.24e-06 | 2.69e-07 | NA |
| 4. PB | Q31RF5 | ATP synthase subunit c | 2.08e-12 | 1.59e-04 | 4.95e-05 | NA |
| 4. PB | C0HK59 | ATP synthase subunit 9, mitochondrial | 5.61e-14 | 7.18e-08 | 8.76e-05 | NA |
| 4. PB | B9KD84 | ATP synthase subunit c | 1.69e-09 | 7.93e-15 | 0.003 | NA |
| 4. PB | B2X1U7 | ATP synthase subunit c, chloroplastic | 1.00e-13 | 1.14e-04 | 1.47e-05 | NA |
| 4. PB | A1SHI6 | ATP synthase subunit c | 1.43e-12 | 3.01e-06 | 0.005 | NA |
| 4. PB | Q06SG3 | ATP synthase subunit c, chloroplastic | 3.73e-12 | 1.78e-04 | 3.34e-04 | NA |
| 4. PB | Q06645 | ATP synthase F(0) complex subunit C1, mitochondrial | 9.79e-08 | 1.27e-02 | 1.76e-06 | NA |
| 4. PB | A5CDC6 | ATP synthase subunit c | 1.58e-10 | 8.37e-07 | 1.67e-04 | NA |
| 4. PB | Q06FX4 | ATP synthase subunit c, chloroplastic | 1.62e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | B2V9H0 | ATP synthase subunit c | 7.45e-11 | 7.48e-23 | 0.003 | NA |
| 4. PB | A1EA03 | ATP synthase subunit c, chloroplastic | 2.03e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | A6MVW8 | ATP synthase subunit c, chloroplastic | 6.54e-14 | 3.45e-03 | 2.52e-05 | NA |
| 4. PB | Q06646 | ATP synthase F(0) complex subunit C2, mitochondrial | 8.87e-08 | 3.85e-02 | 1.18e-06 | NA |
| 4. PB | B2XWN6 | ATP synthase subunit c, chloroplastic | 5.76e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P41603 | ATP synthase subunit c, chloroplastic | 1.75e-12 | 2.48e-03 | 9.40e-06 | NA |
| 4. PB | Q6WQW2 | ATP synthase subunit c, chloroplastic | 1.59e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q0H8W9 | ATP synthase subunit 9, mitochondrial | 9.33e-15 | 6.69e-07 | 4.91e-07 | NA |
| 4. PB | Q9BKS0 | ATP synthase lipid-binding protein, mitochondrial | 2.24e-09 | 6.15e-12 | 2.53e-06 | NA |
| 4. PB | P69447 | ATP synthase subunit c, chloroplastic | 6.81e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | P62480 | ATP synthase subunit c, chloroplastic | 1.73e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q17VM5 | ATP synthase subunit c | 4.54e-11 | 7.98e-33 | 0.023 | NA |
| 4. PB | B2Y1W0 | ATP synthase subunit c, chloroplastic | 1.62e-12 | 2.41e-03 | 1.35e-05 | NA |
| 4. PB | Q9ZEC2 | ATP synthase subunit c | 3.42e-12 | 2.20e-05 | 1.23e-07 | NA |
| 4. PB | A0T0P0 | ATP synthase subunit c, chloroplastic | 6.54e-14 | 3.28e-02 | 4.46e-04 | NA |
| 4. PB | A8W3B1 | ATP synthase subunit C, plastid | 5.17e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q3AZM5 | ATP synthase subunit c | 1.81e-12 | 1.58e-03 | 1.37e-06 | NA |
| 4. PB | Q85FR2 | ATP synthase subunit c, chloroplastic | 4.10e-14 | 3.10e-03 | 5.28e-05 | NA |
| 4. PB | B1X3Y2 | ATP synthase subunit C, organellar chromatophore | 1.60e-13 | 2.71e-03 | 2.31e-05 | NA |
| 4. PB | Q9TM30 | ATP synthase subunit c, chloroplastic | 7.94e-14 | 4.11e-03 | 4.40e-05 | NA |
| 4. PB | A6MMT1 | ATP synthase subunit c, chloroplastic | 1.58e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B0Z4W4 | ATP synthase subunit c, chloroplastic | 1.73e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q72DL2 | ATP synthase subunit c | 6.19e-12 | 7.83e-04 | 2.28e-06 | NA |
| 4. PB | Q20EV7 | ATP synthase subunit c, chloroplastic | 2.27e-12 | 8.87e-05 | 1.73e-04 | NA |
| 4. PB | Q9PR08 | ATP synthase subunit c | 4.68e-08 | 4.99e-47 | 6.69e-11 | NA |
| 4. PB | A1VF67 | ATP synthase subunit c | 4.40e-12 | 7.83e-04 | 2.28e-06 | NA |
| 4. PB | Q5RFL2 | ATP synthase F(0) complex subunit C3, mitochondrial | 1.51e-07 | 3.88e-03 | 1.77e-06 | NA |
| 4. PB | Q00824 | ATP synthase subunit c, chloroplastic | 4.60e-14 | 1.95e-02 | 0.001 | NA |
| 4. PB | P92811 | ATP synthase subunit 9, mitochondrial | 2.69e-14 | 1.48e-09 | 2.31e-07 | NA |
| 4. PB | P0C301 | ATP synthase subunit c, chloroplastic | 1.71e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | A7M953 | ATP synthase subunit C, plastid | 5.67e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q05366 | ATP synthase subunit c | 8.92e-14 | 3.03e-04 | 5.45e-05 | NA |
| 4. PB | P28530 | ATP synthase subunit c, chloroplastic | 8.64e-14 | 1.43e-02 | 5.86e-05 | NA |
| 4. PB | P56760 | ATP synthase subunit c, chloroplastic | 4.03e-14 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | P69448 | ATP synthase subunit c, chloroplastic | 5.43e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q2VEI9 | ATP synthase subunit c, chloroplastic | 7.33e-14 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q8RGD7 | ATP synthase subunit c | 9.60e-09 | 2.69e-08 | 1.16e-09 | NA |
| 4. PB | P48086 | ATP synthase subunit C, cyanelle | 1.52e-12 | 4.00e-04 | 4.13e-05 | NA |
| 4. PB | Q1GDE1 | ATP synthase subunit c | 2.25e-12 | 4.39e-04 | 2.70e-06 | NA |
| 4. PB | Q8MA07 | ATP synthase subunit c, chloroplastic | 1.69e-12 | 6.73e-04 | 1.59e-05 | NA |
| 4. PB | P27182 | ATP synthase subunit c | 2.07e-12 | 8.75e-04 | 5.63e-05 | NA |
| 4. PB | A6MMJ4 | ATP synthase subunit c, chloroplastic | 6.01e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q0G9X5 | ATP synthase subunit c, chloroplastic | 5.62e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q9TL14 | ATP synthase subunit c, chloroplastic | 4.15e-14 | 4.61e-03 | 6.33e-05 | NA |
| 4. PB | Q2GE12 | ATP synthase subunit c | 7.02e-12 | 1.32e-05 | 1.11e-07 | NA |
| 4. PB | P10603 | ATP synthase subunit c, chloroplastic | 1.13e-13 | 2.10e-03 | 2.65e-06 | NA |
| 4. PB | B0Z4N0 | ATP synthase subunit c, chloroplastic | 1.75e-12 | 1.10e-03 | 2.12e-05 | NA |
| 4. PB | Q09FX4 | ATP synthase subunit c, chloroplastic | 2.01e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A4QJI6 | ATP synthase subunit c, chloroplastic | 5.17e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q0I7Q8 | ATP synthase subunit c | 1.58e-12 | 4.11e-03 | 8.70e-08 | NA |
| 4. PB | Q6B8R2 | ATP synthase subunit c, chloroplastic | 6.42e-14 | 9.69e-03 | 1.46e-05 | NA |
| 4. PB | Q2RPA5 | ATP synthase subunit c | 7.03e-13 | 1.57e-07 | 3.93e-08 | NA |
| 4. PB | B1A922 | ATP synthase subunit c, chloroplastic | 1.72e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q3IK45 | ATP synthase subunit c | 2.38e-11 | 1.35e-08 | 0.006 | NA |
| 4. PB | B3PLV3 | ATP synthase subunit c | 1.23e-08 | 1.76e-30 | 9.50e-11 | NA |
| 4. PB | Q8DLP7 | ATP synthase subunit c | 5.66e-14 | 1.31e-03 | 1.90e-04 | NA |
| 4. PB | P61829 | ATP synthase subunit 9, mitochondrial | 2.19e-12 | 5.49e-10 | 3.68e-07 | NA |
| 4. PB | Q30XU9 | ATP synthase subunit c | 1.12e-11 | 8.97e-37 | 1.77e-06 | NA |
| 4. PB | P48881 | ATP synthase subunit 9, mitochondrial | 4.23e-14 | 2.17e-08 | 1.15e-05 | NA |
| 4. PB | A2T319 | ATP synthase subunit c, chloroplastic | 7.12e-14 | 3.16e-04 | 5.63e-05 | NA |
| 4. PB | Q2W027 | ATP synthase subunit c | 2.91e-13 | 3.37e-08 | 2.99e-08 | NA |
| 4. PB | A4QK05 | ATP synthase subunit c, chloroplastic | 1.72e-12 | 1.06e-03 | 1.13e-05 | NA |
| 4. PB | A8SE66 | ATP synthase subunit c, chloroplastic | 5.74e-14 | 1.87e-03 | 1.24e-05 | NA |
| 4. PB | B8G6H1 | ATP synthase subunit c | 4.20e-14 | 1.29e-04 | 3.88e-05 | NA |
| 4. PB | Q9B8D5 | ATP synthase subunit 9, mitochondrial | 1.80e-12 | 3.28e-09 | 2.00e-04 | NA |
| 4. PB | A6H5F3 | ATP synthase subunit c, chloroplastic | 2.59e-14 | 1.21e-03 | 1.05e-05 | NA |
| 4. PB | B1AIC5 | ATP synthase subunit c | 6.60e-08 | 4.99e-47 | 6.69e-11 | NA |
| 4. PB | Q2RFX4 | ATP synthase subunit c | 3.54e-12 | 2.76e-02 | 2.63e-07 | NA |
| 4. PB | Q56P08 | ATP synthase subunit c, chloroplastic | 5.65e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q3C1H2 | ATP synthase subunit c, chloroplastic | 1.56e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q9U505 | ATP synthase lipid-binding protein, mitochondrial | 5.85e-08 | 1.92e-06 | 2.96e-07 | NA |
| 4. PB | A4QLS0 | ATP synthase subunit c, chloroplastic | 1.77e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B7K5I4 | ATP synthase subunit c | 5.32e-14 | 2.08e-04 | 4.59e-05 | NA |
| 4. PB | Q1RGZ2 | ATP synthase subunit c | 6.61e-13 | 6.02e-06 | 2.49e-07 | NA |
| 4. PB | Q37315 | ATP synthase subunit 9, mitochondrial | 1.25e-11 | 8.20e-23 | 1.22e-04 | NA |
| 4. PB | Q4UNH9 | ATP synthase subunit c | 1.82e-11 | 6.23e-06 | 1.26e-07 | NA |
| 4. PB | Q02851 | ATP synthase subunit c, chloroplastic | 6.38e-14 | 9.69e-03 | 1.46e-05 | NA |
| 4. PB | B7H299 | ATP synthase subunit c | 1.75e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q68XQ0 | ATP synthase subunit c | 3.84e-13 | 1.46e-05 | 3.52e-07 | NA |
| 4. PB | Q7U8W9 | ATP synthase subunit c | 7.67e-14 | 3.68e-02 | 1.51e-06 | NA |
| 4. PB | A1XQS5 | ATP synthase F(0) complex subunit C1, mitochondrial | 7.02e-08 | 1.15e-03 | 1.12e-05 | NA |
| 4. PB | Q3V547 | ATP synthase subunit c, chloroplastic | 4.24e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q1CS52 | ATP synthase subunit c | 1.14e-10 | 2.71e-32 | 0.043 | NA |
| 4. PB | Q2MIB3 | ATP synthase subunit c, chloroplastic | 1.77e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A6LQH1 | ATP synthase subunit c | 0.00e+00 | 4.71e-04 | 0.002 | NA |
| 4. PB | A4QLI1 | ATP synthase subunit c, chloroplastic | 6.47e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B5ZAW9 | ATP synthase subunit c | 3.67e-07 | 5.41e-45 | 5.16e-11 | NA |
| 4. PB | Q1XDP1 | ATP synthase subunit c, chloroplastic | 6.37e-14 | 7.37e-03 | 1.38e-05 | NA |
| 4. PB | A8Y9G5 | ATP synthase subunit c, chloroplastic | 6.05e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | A6BM12 | ATP synthase subunit c, chloroplastic | 4.88e-14 | 2.41e-03 | 1.35e-05 | NA |
| 4. PB | Q1ACN0 | ATP synthase subunit c, chloroplastic | 5.26e-14 | 4.98e-03 | 1.24e-05 | NA |
| 4. PB | Q0BQY6 | ATP synthase subunit c | 4.74e-14 | 2.06e-09 | 2.43e-04 | NA |
| 4. PB | Q06H10 | ATP synthase subunit c, chloroplastic | 1.77e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P0C300 | ATP synthase subunit c, chloroplastic | 1.89e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | P0C2Z9 | ATP synthase subunit c, chloroplastic | 5.22e-14 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q0ZJ33 | ATP synthase subunit c, chloroplastic | 6.24e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A8GLV9 | ATP synthase subunit c | 4.93e-11 | 1.74e-05 | 5.31e-08 | NA |
| 4. PB | P17605 | ATP synthase F(0) complex subunit C1, mitochondrial | 1.63e-07 | 1.76e-04 | 1.27e-06 | NA |
| 4. PB | A7M8Z1 | ATP synthase subunit C, plastid | 4.35e-14 | 6.21e-03 | 2.15e-05 | NA |
| 4. PB | Q85FN2 | ATP synthase subunit c, chloroplastic | 1.67e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A6H4Q2 | ATP synthase subunit 9, mitochondrial | 3.55e-14 | 4.55e-10 | 2.87e-07 | NA |
| 4. PB | Q3M9V6 | ATP synthase subunit c | 8.64e-14 | 2.27e-05 | 5.88e-05 | NA |
| 4. PB | A2BT29 | ATP synthase subunit c | 1.93e-12 | 7.30e-04 | 1.21e-08 | NA |
| 4. PB | B2I0Z7 | ATP synthase subunit c | 1.90e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | B8HPJ7 | ATP synthase subunit c | 5.71e-14 | 1.46e-03 | 2.68e-04 | NA |
| 4. PB | Q06J70 | ATP synthase subunit c, chloroplastic | 6.25e-14 | 2.84e-06 | 7.95e-04 | NA |
| 4. PB | Q1MPG5 | ATP synthase subunit c | 1.05e-11 | 9.92e-09 | 1.18e-08 | NA |
| 4. PB | A4QL93 | ATP synthase subunit c, chloroplastic | 1.93e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | P61828 | ATP synthase subunit 9, mitochondrial | 8.10e-15 | 5.49e-10 | 3.68e-07 | NA |
| 4. PB | Q6L3A2 | ATP synthase subunit c, chloroplastic | 1.70e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q42969 | ATP synthase subunit c, chloroplastic | 8.13e-14 | 1.91e-02 | 1.90e-04 | NA |
| 4. PB | P08445 | ATP synthase subunit c | 2.07e-12 | 1.59e-04 | 4.95e-05 | NA |
| 4. PB | P69194 | ATP synthase subunit c, chloroplastic | 6.47e-14 | 1.66e-03 | 1.28e-05 | NA |
| 4. PB | Q8KRV3 | ATP synthase subunit c, sodium ion specific | 1.05e-08 | 3.24e-09 | 1.92e-09 | NA |
| 4. PB | P32876 | ATP synthase F(0) complex subunit C1, mitochondrial | 4.98e-08 | 3.63e-05 | 1.28e-06 | NA |
| 4. PB | Q73HW2 | ATP synthase subunit c | 1.75e-11 | 6.44e-06 | 1.24e-05 | NA |
| 4. PB | Q8A9V0 | ATP synthase subunit c | 4.23e-09 | 2.25e-24 | 0.019 | NA |
| 4. PB | B1XHZ2 | ATP synthase subunit c | 2.16e-12 | 1.01e-04 | 3.71e-05 | NA |
| 4. PB | Q04G25 | ATP synthase subunit c | 4.61e-13 | 1.36e-04 | 0.023 | NA |
| 4. PB | P21537 | ATP synthase subunit 9, mitochondrial | 8.88e-15 | 2.10e-06 | 8.92e-08 | NA |
| 4. PB | P51246 | ATP synthase subunit c, chloroplastic | 5.37e-14 | 7.37e-03 | 1.38e-05 | NA |
| 4. PB | Q3BAQ5 | ATP synthase subunit c, chloroplastic | 1.68e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A0ZZ22 | ATP synthase subunit c, chloroplastic | 1.52e-12 | 1.59e-03 | 8.35e-06 | NA |
| 4. PB | Q75G38 | ATP synthase subunit 9, mitochondrial | 1.65e-14 | 2.98e-08 | 1.20e-07 | NA |
| 4. PB | Q5FRW6 | ATP synthase subunit c | 3.61e-09 | 6.67e-25 | 0.042 | NA |
| 4. PB | B0YPM3 | ATP synthase subunit C, plastid | 1.23e-12 | 3.67e-05 | 2.24e-04 | NA |
| 4. PB | A2C4J9 | ATP synthase subunit c | 1.77e-12 | 9.20e-04 | 6.52e-09 | NA |
| 4. PB | Q1KVY0 | ATP synthase subunit c, chloroplastic | 8.13e-14 | 1.35e-05 | 2.70e-04 | NA |
| 4. PB | Q7V033 | ATP synthase subunit c | 1.95e-12 | 7.30e-04 | 1.21e-08 | NA |
| 4. PB | B9DME9 | ATP synthase subunit c | 2.19e-12 | 2.89e-02 | 0.008 | NA |
| 4. PB | Q88UT8 | ATP synthase subunit c | 5.29e-12 | 2.23e-03 | 0.001 | NA |
| 4. PB | A7I137 | ATP synthase subunit c | 9.71e-06 | 1.94e-03 | 2.79e-04 | NA |
| 4. PB | B7I1V9 | ATP synthase subunit c | 1.91e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q7NCR9 | ATP synthase subunit c | 2.14e-12 | 1.05e-02 | 2.26e-05 | NA |
| 4. PB | P56297 | ATP synthase subunit c, chloroplastic | 1.08e-13 | 8.32e-05 | 4.32e-04 | NA |
| 4. PB | A7Y3A9 | ATP synthase subunit c, chloroplastic | 6.36e-14 | 1.96e-03 | 1.09e-05 | NA |
| 4. PB | Q70Y12 | ATP synthase subunit c, chloroplastic | 6.33e-14 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | B0VBP8 | ATP synthase subunit c | 1.94e-11 | 1.01e-03 | 0.002 | NA |
| 4. PB | Q4FGF2 | ATP synthase subunit c, chloroplastic | 1.68e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | A6YG66 | ATP synthase subunit c, chloroplastic | 4.73e-14 | 2.50e-05 | 2.28e-04 | NA |
| 4. PB | Q8RU61 | ATP synthase subunit c, chloroplastic | 1.63e-12 | 5.11e-04 | 9.50e-06 | NA |
| 4. PB | Q3ZC75 | ATP synthase F(0) complex subunit C3, mitochondrial | 1.24e-07 | 1.18e-02 | 1.54e-06 | NA |
| 4. PB | B6JN51 | ATP synthase subunit c | 5.42e-11 | 2.71e-32 | 0.043 | NA |
| 4. PB | Q9CR84 | ATP synthase F(0) complex subunit C1, mitochondrial | 1.27e-07 | 3.16e-02 | 1.67e-06 | NA |
| 4. PB | Q6ENH9 | ATP synthase subunit c, chloroplastic | 1.91e-12 | 2.27e-03 | 1.09e-05 | NA |
| 4. PB | Q4G3A1 | ATP synthase subunit c, chloroplastic | 9.68e-14 | 3.46e-02 | 1.18e-05 | NA |
| 4. PB | Q3AHK1 | ATP synthase subunit c | 7.75e-14 | 3.68e-02 | 1.51e-06 | NA |
| 4. PB | A8EX89 | ATP synthase subunit c | 3.57e-13 | 1.18e-05 | 7.59e-08 | NA |
| 4. PB | Q5GSH7 | ATP synthase subunit c | 1.13e-11 | 1.90e-06 | 9.21e-06 | NA |
| 4. PB | Q2L8Z2 | ATP synthase subunit c, chloroplastic | 1.59e-12 | 1.79e-03 | 1.13e-05 | NA |
| 4. PB | Q0C0X2 | ATP synthase subunit c | 3.93e-14 | 1.26e-08 | 5.16e-09 | NA |
| 4. PB | Q92JP1 | ATP synthase subunit c | 7.34e-12 | 4.24e-06 | 2.69e-07 | NA |
| 4. PB | B1VKH8 | ATP synthase subunit c, chloroplastic | 6.07e-14 | 1.43e-03 | 1.85e-05 | NA |
| 4. PB | Q46J53 | ATP synthase subunit c | 1.68e-12 | 9.20e-04 | 6.52e-09 | NA |
| 4. PB | Q318T7 | ATP synthase subunit c | 1.95e-12 | 7.30e-04 | 1.21e-08 | NA |
| 5. P | A9MJR4 | ATP synthase subunit c | 1.94e-11 | 5.10e-09 | NA | NA |
| 5. P | B7JB89 | ATP synthase subunit c | 1.98e-10 | 7.01e-04 | NA | NA |
| 5. P | P16001 | ATP synthase subunit 9, mitochondrial | 1.48e-10 | 3.69e-06 | NA | NA |
| 5. P | P62021 | Membrane-associated ATPase C chain | 2.43e-09 | 4.61e-21 | NA | NA |
| 5. P | Q814V7 | ATP synthase subunit c | 1.19e-10 | 3.12e-04 | NA | NA |
| 5. P | Q2JSV7 | ATP synthase subunit c | 2.40e-12 | 2.27e-03 | NA | NA |
| 5. P | Q99SF0 | ATP synthase subunit c | 4.75e-12 | 4.66e-03 | NA | NA |
| 5. P | Q329S6 | ATP synthase subunit c | 1.86e-11 | 5.10e-09 | NA | NA |
| 5. P | Q3YVP1 | ATP synthase subunit c | 1.76e-11 | 5.10e-09 | NA | NA |
| 5. P | B1X9W5 | ATP synthase subunit c | 1.92e-11 | 5.10e-09 | NA | NA |
| 5. P | P0A304 | ATP synthase subunit c | 4.22e-08 | 1.11e-12 | NA | NA |
| 5. P | P68701 | ATP synthase subunit c | 1.93e-11 | 5.10e-09 | NA | NA |
| 5. P | Q1B548 | ATP synthase subunit c | 1.61e-11 | 7.38e-06 | NA | NA |
| 5. P | Q3IZ13 | ATP synthase subunit c | 4.94e-11 | 6.11e-10 | NA | NA |
| 5. P | Q0TAX2 | ATP synthase subunit c | 1.86e-11 | 5.10e-09 | NA | NA |
| 5. P | A6U3J3 | ATP synthase subunit c | 3.85e-12 | 4.66e-03 | NA | NA |
| 5. P | P9WPS1 | ATP synthase subunit c | 1.40e-11 | 8.66e-04 | NA | NA |
| 5. P | C3LFI4 | ATP synthase subunit c | 1.17e-10 | 3.12e-04 | NA | NA |
| 5. P | Q5PKW7 | ATP synthase subunit c | 1.84e-11 | 5.10e-09 | NA | NA |
| 5. P | Q1C090 | ATP synthase subunit c | 2.00e-11 | 5.10e-09 | NA | NA |
| 5. P | Q6HAX4 | ATP synthase subunit c | 1.09e-10 | 3.12e-04 | NA | NA |
| 5. P | C1AMU9 | ATP synthase subunit c | 1.48e-11 | 8.66e-04 | NA | NA |
| 5. P | P63692 | ATP synthase subunit c | 1.43e-11 | 8.66e-04 | NA | NA |
| 5. P | B4SYD6 | ATP synthase subunit c | 1.76e-11 | 5.10e-09 | NA | NA |
| 5. P | P41015 | ATP synthase subunit c | 1.36e-13 | 5.06e-04 | NA | NA |
| 5. P | Q2JIF6 | ATP synthase subunit c | 2.45e-12 | 2.27e-03 | NA | NA |
| 5. P | Q7A0C3 | ATP synthase subunit c | 3.26e-12 | 4.66e-03 | NA | NA |
| 5. P | A6L4M1 | ATP synthase subunit c | 4.77e-09 | 3.42e-19 | NA | NA |
| 5. P | Q3SF61 | ATP synthase subunit c | 1.45e-11 | 1.47e-06 | NA | NA |
| 5. P | B7M593 | ATP synthase subunit c | 1.86e-11 | 5.10e-09 | NA | NA |
| 5. P | A1JTD2 | ATP synthase subunit c | 1.94e-11 | 3.33e-09 | NA | NA |
| 5. P | P0A305 | ATP synthase subunit c | 4.38e-08 | 1.11e-12 | NA | NA |
| 5. P | P00845 | ATP synthase subunit c | 6.30e-13 | 7.97e-05 | NA | NA |
| 5. P | B4U8V5 | ATP synthase subunit c | 1.32e-08 | 1.29e-23 | NA | NA |
| 5. P | P64472 | Uncharacterized protein YdhI | 5.12e-04 | 5.18e-03 | NA | NA |
| 5. P | B8D8G8 | ATP synthase subunit c | 1.53e-11 | 2.17e-08 | NA | NA |
| 5. P | B5YGC8 | ATP synthase subunit c | 1.56e-10 | 3.53e-22 | NA | NA |
| 5. P | Q9K6H0 | ATP synthase subunit c | 1.28e-11 | 3.20e-03 | NA | NA |
| 5. P | A4ITJ4 | ATP synthase subunit c | 1.74e-13 | 2.82e-03 | NA | NA |
| 5. P | B8ZR37 | ATP synthase subunit c | 1.21e-11 | 1.78e-04 | NA | NA |
| 5. P | B5RFV8 | ATP synthase subunit c | 1.80e-11 | 5.10e-09 | NA | NA |
| 5. P | A7ZTU9 | ATP synthase subunit c | 1.89e-11 | 5.10e-09 | NA | NA |
| 5. P | C1F0N3 | ATP synthase subunit c | 9.05e-11 | 3.12e-04 | NA | NA |
| 5. P | A7X4V0 | ATP synthase subunit c | 4.82e-12 | 4.66e-03 | NA | NA |
| 5. P | B5FN38 | ATP synthase subunit c | 1.94e-11 | 5.10e-09 | NA | NA |
| 5. P | A1A3D0 | ATP synthase subunit c | 3.29e-10 | 7.62e-12 | NA | NA |
| 5. P | P95783 | ATP synthase subunit c | 5.62e-11 | 8.73e-03 | NA | NA |
| 5. P | Q83HY5 | ATP synthase subunit c | 6.87e-10 | 3.72e-10 | NA | NA |
| 5. P | Q5KUI8 | ATP synthase subunit c | 8.36e-13 | 7.97e-05 | NA | NA |
| 5. P | B2TUN8 | ATP synthase subunit c | 1.70e-11 | 5.10e-09 | NA | NA |
| 5. P | B1IX01 | ATP synthase subunit c | 2.01e-11 | 5.10e-09 | NA | NA |
| 5. P | B4TAX7 | ATP synthase subunit c | 1.89e-11 | 5.10e-09 | NA | NA |
| 5. P | A8YY75 | ATP synthase subunit c | 3.23e-12 | 4.66e-03 | NA | NA |
| 5. P | B8D6S2 | ATP synthase subunit c | 1.47e-11 | 2.17e-08 | NA | NA |
| 5. P | C5D995 | ATP synthase subunit c | 1.73e-13 | 2.82e-03 | NA | NA |
| 5. P | C0Q2N7 | ATP synthase subunit c | 1.98e-11 | 5.10e-09 | NA | NA |
| 5. P | B6I3X4 | ATP synthase subunit c | 1.75e-11 | 5.10e-09 | NA | NA |
| 5. P | P22483 | ATP synthase subunit c | 6.14e-12 | 3.16e-04 | NA | NA |
| 5. P | B5QVD7 | ATP synthase subunit c | 1.83e-11 | 5.10e-09 | NA | NA |
| 5. P | B7LK82 | ATP synthase subunit c | 1.93e-11 | 5.10e-09 | NA | NA |
| 5. P | Q8EM78 | ATP synthase subunit c | 1.32e-14 | 7.48e-05 | NA | NA |
| 5. P | P68705 | ATP synthase subunit c | 1.84e-11 | 5.10e-09 | NA | NA |
| 5. P | B2VCA9 | ATP synthase subunit c | 2.14e-11 | 3.21e-08 | NA | NA |
| 5. P | P68706 | ATP synthase subunit c | 1.98e-11 | 5.10e-09 | NA | NA |
| 5. P | Q6G7K2 | ATP synthase subunit c | 4.76e-12 | 4.66e-03 | NA | NA |
| 5. P | P41173 | ATP synthase subunit c | 2.06e-10 | 7.01e-04 | NA | NA |
| 5. P | A8G7M3 | ATP synthase subunit c | 1.89e-11 | 6.51e-09 | NA | NA |
| 5. P | Q4J8L5 | Membrane-associated ATPase C chain | 1.32e-10 | 5.79e-26 | NA | NA |
| 5. P | B7L883 | ATP synthase subunit c | 2.02e-11 | 5.10e-09 | NA | NA |
| 5. P | Q49Z55 | ATP synthase subunit c | 2.00e-13 | 2.62e-05 | NA | NA |
| 5. P | B5YXE1 | ATP synthase subunit c | 1.85e-11 | 5.10e-09 | NA | NA |
| 5. P | Q16AM7 | ATP synthase subunit c | 7.23e-13 | 2.22e-04 | NA | NA |
| 5. P | B5EZ01 | ATP synthase subunit c | 1.73e-11 | 5.10e-09 | NA | NA |
| 5. P | A9R5U4 | ATP synthase subunit c | 1.99e-11 | 5.10e-09 | NA | NA |
| 5. P | A1UJY9 | ATP synthase subunit c | 1.00e-11 | 7.38e-06 | NA | NA |
| 5. P | B5BIP1 | ATP synthase subunit c | 1.93e-11 | 5.10e-09 | NA | NA |
| 5. P | Q83G86 | ATP synthase subunit c | 6.43e-10 | 3.72e-10 | NA | NA |
| 5. P | P9WPS0 | ATP synthase subunit c | 1.59e-11 | 8.66e-04 | NA | NA |
| 5. P | Q3T4E5 | ATP synthase subunit 9, mitochondrial | 4.44e-15 | 2.57e-04 | NA | NA |
| 5. P | B7HFK7 | ATP synthase subunit c | 1.17e-10 | 3.12e-04 | NA | NA |
| 5. P | B4TN36 | ATP synthase subunit c | 1.94e-11 | 5.10e-09 | NA | NA |
| 5. P | B7NF53 | ATP synthase subunit c | 1.65e-11 | 5.10e-09 | NA | NA |
| 5. P | Q4FPE8 | ATP synthase subunit c | 3.97e-13 | 3.44e-07 | NA | NA |
| 5. P | B1JR36 | ATP synthase subunit c | 1.75e-11 | 5.10e-09 | NA | NA |
| 5. P | A7ZC73 | ATP synthase subunit c | 8.14e-10 | 3.95e-27 | NA | NA |
| 5. P | A5IUQ3 | ATP synthase subunit c | 4.14e-12 | 4.66e-03 | NA | NA |
| 5. P | Q41773 | V-type proton ATPase 16 kDa proteolipid subunit (Fragment) | 2.18e-09 | 1.89e-02 | NA | NA |
| 5. P | Q64UA7 | ATP synthase subunit c | 3.03e-09 | 1.06e-25 | NA | NA |
| 5. P | B4F0E2 | ATP synthase subunit c | 1.80e-11 | 5.30e-09 | NA | NA |
| 5. P | B2HQK7 | ATP synthase subunit c | 1.31e-11 | 3.03e-04 | NA | NA |
| 5. P | Q0Q7H1 | ATP synthase subunit c | 1.44e-07 | 9.22e-25 | NA | NA |
| 5. P | B5XZL9 | ATP synthase subunit c | 2.02e-11 | 5.10e-09 | NA | NA |
| 5. P | A6TG41 | ATP synthase subunit c | 1.82e-11 | 5.10e-09 | NA | NA |
| 5. P | Q6GEW7 | ATP synthase subunit c | 4.27e-12 | 4.66e-03 | NA | NA |
| 5. P | P45828 | ATP synthase subunit c | 1.22e-11 | 1.78e-04 | NA | NA |
| 5. P | Q663Q3 | ATP synthase subunit c | 1.78e-11 | 5.10e-09 | NA | NA |
| 5. P | Q2G2F6 | ATP synthase subunit c | 4.50e-12 | 4.66e-03 | NA | NA |
| 5. P | Q31UN7 | ATP synthase subunit c | 1.90e-11 | 5.10e-09 | NA | NA |
| 5. P | A8YUJ6 | ATP synthase subunit c | 7.63e-12 | 5.00e-10 | NA | NA |
| 5. P | A0KQY3 | ATP synthase subunit c | 1.99e-11 | 7.92e-08 | NA | NA |
| 5. P | Q5HUM3 | ATP synthase subunit c | 1.05e-07 | 1.29e-26 | NA | NA |
| 5. P | Q494C8 | ATP synthase subunit c | 1.99e-11 | 3.05e-08 | NA | NA |
| 5. P | B7MGF7 | ATP synthase subunit c | 1.80e-11 | 5.10e-09 | NA | NA |
| 5. P | B3PIT2 | ATP synthase subunit c | 2.78e-11 | 1.67e-04 | NA | NA |
| 5. P | B7IQW3 | ATP synthase subunit c | 1.27e-10 | 3.12e-04 | NA | NA |
| 5. P | P68703 | ATP synthase subunit c | 1.71e-11 | 5.10e-09 | NA | NA |
| 5. P | B7JGN5 | ATP synthase subunit c | 1.01e-10 | 3.12e-04 | NA | NA |
| 5. P | B9IRU2 | ATP synthase subunit c | 8.88e-11 | 3.12e-04 | NA | NA |
| 5. P | A7GX83 | ATP synthase subunit c | 1.66e-10 | 6.45e-28 | NA | NA |
| 5. P | A7MMV9 | ATP synthase subunit c | 1.79e-11 | 5.10e-09 | NA | NA |
| 5. P | Q72XE3 | ATP synthase subunit c | 1.07e-10 | 3.12e-04 | NA | NA |
| 5. P | A4WGF0 | ATP synthase subunit c | 1.97e-11 | 5.10e-09 | NA | NA |
| 5. P | Q57HX4 | ATP synthase subunit c | 1.85e-11 | 5.10e-09 | NA | NA |
| 5. P | Q12635 | ATP synthase subunit 9, mitochondrial | 5.23e-13 | 1.31e-05 | NA | NA |
| 5. P | C3P1F9 | ATP synthase subunit c | 9.32e-11 | 3.12e-04 | NA | NA |
| 5. P | A4T8K8 | ATP synthase subunit c | 1.20e-11 | 1.32e-05 | NA | NA |
| 5. P | B5ER47 | ATP synthase subunit c | 2.02e-10 | 7.01e-04 | NA | NA |
| 5. P | Q6CYJ0 | ATP synthase subunit c | 1.68e-11 | 1.11e-09 | NA | NA |
| 5. P | B7HY70 | ATP synthase subunit c | 1.10e-10 | 3.12e-04 | NA | NA |
| 5. P | A0PUK5 | ATP synthase subunit c | 1.46e-11 | 3.03e-04 | NA | NA |
| 5. P | B1YEG1 | ATP synthase subunit c | 7.10e-13 | 3.39e-04 | NA | NA |
| 5. P | A9FGS9 | ATP synthase subunit c | 2.41e-09 | 8.38e-24 | NA | NA |
| 5. P | A0RLA0 | ATP synthase subunit c | 1.16e-10 | 3.12e-04 | NA | NA |
| 5. P | A1KI93 | ATP synthase subunit c | 1.27e-11 | 8.66e-04 | NA | NA |
| 5. P | A7GV61 | ATP synthase subunit c | 9.82e-11 | 3.19e-04 | NA | NA |
| 5. P | A3PN84 | ATP synthase subunit c 1 | 6.52e-13 | 2.63e-02 | NA | NA |
| 5. P | A4STP8 | ATP synthase subunit c | 1.98e-11 | 5.95e-06 | NA | NA |
| 5. P | C4ZZ15 | ATP synthase subunit c | 1.94e-11 | 5.10e-09 | NA | NA |
| 5. P | A7H3B5 | ATP synthase subunit c | 8.52e-08 | 7.77e-25 | NA | NA |
| 5. P | P68700 | ATP synthase subunit c | 1.90e-11 | 5.10e-09 | NA | NA |
| 5. P | P20603 | ATP synthase subunit c | 3.66e-13 | 1.03e-02 | NA | NA |
| 5. P | P60112 | ATP synthase subunit 9, mitochondrial | 1.97e-09 | 1.75e-15 | NA | NA |
| 5. P | Q0P9W3 | ATP synthase subunit c | 1.23e-07 | 6.14e-26 | NA | NA |
| 5. P | Q5LD85 | ATP synthase subunit c | 3.39e-09 | 1.06e-25 | NA | NA |
| 5. P | A4WNY7 | ATP synthase subunit c | 4.38e-11 | 6.11e-10 | NA | NA |
| 5. P | A8FLY5 | ATP synthase subunit c | 1.67e-07 | 9.22e-25 | NA | NA |
| 5. P | C5BF35 | ATP synthase subunit c | 1.67e-11 | 6.51e-09 | NA | NA |
| 5. P | C5CA73 | ATP synthase subunit c | 4.04e-13 | 4.81e-04 | NA | NA |
| 5. P | P42011 | ATP synthase subunit c | 1.37e-12 | 2.59e-05 | NA | NA |
| 5. P | Q81JZ0 | ATP synthase subunit c | 1.40e-10 | 3.12e-04 | NA | NA |
| 5. P | P64473 | Uncharacterized protein YdhI | 2.43e-04 | 5.18e-03 | NA | NA |
| 5. P | Q89B44 | ATP synthase subunit c | 5.82e-12 | 1.13e-07 | NA | NA |
| 5. P | Q2FF19 | ATP synthase subunit c | 5.02e-12 | 4.66e-03 | NA | NA |
| 5. P | B7NR39 | ATP synthase subunit c | 2.10e-11 | 5.10e-09 | NA | NA |
| 5. P | P57119 | ATP synthase subunit c | 1.59e-11 | 2.17e-08 | NA | NA |
| 5. P | Q03A23 | ATP synthase subunit c | 9.82e-13 | 1.07e-04 | NA | NA |
| 5. P | B8DWS7 | ATP synthase subunit c | 3.51e-10 | 3.99e-13 | NA | NA |
| 5. P | Q0SYT9 | ATP synthase subunit c | 1.80e-11 | 5.10e-09 | NA | NA |
| 5. P | A4TSI8 | ATP synthase subunit c | 1.69e-11 | 5.10e-09 | NA | NA |
| 5. P | B7UMK2 | ATP synthase subunit c | 1.91e-11 | 5.10e-09 | NA | NA |
| 5. P | A9MXB1 | ATP synthase subunit c | 1.70e-11 | 5.10e-09 | NA | NA |
| 5. P | B1LL64 | ATP synthase subunit c | 2.07e-11 | 5.10e-09 | NA | NA |
| 5. P | B7GMF8 | ATP synthase subunit c | 1.62e-13 | 2.82e-03 | NA | NA |
| 5. P | C6DJG7 | ATP synthase subunit c | 1.62e-11 | 1.11e-09 | NA | NA |
| 5. P | A8A6K0 | ATP synthase subunit c | 1.86e-11 | 5.10e-09 | NA | NA |
| 5. P | Q1LTU9 | ATP synthase subunit c | 3.13e-12 | 4.02e-07 | NA | NA |
| 5. P | P68699 | ATP synthase subunit c | 2.04e-11 | 5.10e-09 | NA | NA |
| 5. P | Q7VIL1 | ATP synthase subunit c | 7.69e-10 | 6.50e-36 | NA | NA |
| 5. P | A3Q3B6 | ATP synthase subunit c | 1.43e-11 | 7.38e-06 | NA | NA |
| 5. P | Q9D103 | Interferon-induced transmembrane protein 1 | 7.59e-04 | 9.16e-05 | NA | NA |
| 5. P | B3WDL3 | ATP synthase subunit c | 1.01e-12 | 1.07e-04 | NA | NA |
| 5. P | Q1CCH0 | ATP synthase subunit c | 1.75e-11 | 5.10e-09 | NA | NA |
| 5. P | Q2NQ91 | ATP synthase subunit c | 1.97e-11 | 5.10e-09 | NA | NA |
| 5. P | A7FPE5 | ATP synthase subunit c | 1.96e-11 | 5.10e-09 | NA | NA |
| 5. P | A5U204 | ATP synthase subunit c | 1.41e-11 | 8.66e-04 | NA | NA |
| 5. P | A8EVM2 | ATP synthase subunit c | 4.29e-10 | 3.11e-27 | NA | NA |
| 5. P | P68704 | ATP synthase subunit c | 1.72e-11 | 5.10e-09 | NA | NA |
| 5. P | B2GAU0 | ATP synthase subunit c | 1.92e-11 | 2.00e-03 | NA | NA |
| 5. P | A6QBH1 | ATP synthase subunit c | 2.84e-11 | 8.04e-28 | NA | NA |
| 5. P | Q7VQW1 | ATP synthase subunit c | 1.70e-11 | 3.50e-09 | NA | NA |
| 5. P | Q8CES1 | Transmembrane protein PMIS2 | 2.38e-03 | 1.78e-02 | NA | NA |
| 5. P | Q8D3J8 | ATP synthase subunit c | 2.12e-12 | 7.02e-07 | NA | NA |
| 5. P | Q5LNH0 | ATP synthase subunit c | 4.86e-13 | 1.94e-04 | NA | NA |
| 5. P | Q5HMB4 | ATP synthase subunit c | 4.89e-12 | 4.66e-03 | NA | NA |
| 5. P | Q630T8 | ATP synthase subunit c | 8.31e-11 | 3.12e-04 | NA | NA |
| 5. P | O51877 | ATP synthase subunit c | 2.07e-11 | 1.51e-08 | NA | NA |
| 5. P | Q30TH1 | ATP synthase subunit c | 1.01e-11 | 4.06e-25 | NA | NA |
| 5. P | Q1R4J5 | ATP synthase subunit c | 2.03e-11 | 5.10e-09 | NA | NA |
| 5. P | A9VSA8 | ATP synthase subunit c | 9.60e-11 | 3.12e-04 | NA | NA |
| 5. P | A8ACP3 | ATP synthase subunit c | 2.10e-11 | 5.10e-09 | NA | NA |
| 5. P | B2K842 | ATP synthase subunit c | 1.87e-11 | 5.10e-09 | NA | NA |
| 5. P | Q8CNJ2 | ATP synthase subunit c | 4.57e-12 | 4.66e-03 | NA | NA |
| 5. P | P68702 | ATP synthase subunit c | 1.62e-11 | 5.10e-09 | NA | NA |
| 5. P | Q7A4E6 | ATP synthase subunit c | 3.58e-12 | 4.66e-03 | NA | NA |
| 5. P | Q2YUJ6 | ATP synthase subunit c | 4.09e-12 | 4.66e-03 | NA | NA |
| 5. P | Q5HE92 | ATP synthase subunit c | 3.87e-12 | 4.66e-03 | NA | NA |
| 5. P | P60113 | ATP synthase subunit 9, mitochondrial | 3.42e-14 | 1.16e-02 | NA | NA |
| 5. P | P64471 | Uncharacterized protein YdhI | 2.13e-04 | 5.18e-03 | NA | NA |
| 5. P | B7N2H6 | ATP synthase subunit c | 1.82e-11 | 5.10e-09 | NA | NA |
| 5. P | A6QIV2 | ATP synthase subunit c | 3.93e-12 | 4.66e-03 | NA | NA |
| 5. P | Q28UC7 | ATP synthase subunit c | 1.74e-10 | 1.15e-10 | NA | NA |
| 7. B | B8EDV5 | ATP synthase subunit c | 5.56e-11 | NA | 0.036 | NA |
| 7. B | P0A308 | ATP synthase subunit c | 3.64e-11 | NA | 0.019 | NA |
| 7. B | B8CVV0 | ATP synthase subunit c | 6.05e-11 | NA | 0.037 | NA |
| 7. B | Q4QN59 | ATP synthase subunit c | 4.00e-11 | NA | 0.022 | NA |
| 7. B | C1C8A5 | ATP synthase subunit c | 5.63e-11 | NA | 0.010 | NA |
| 7. B | Q0P3K7 | ATP synthase subunit c, chloroplastic | 7.78e-14 | NA | 1.18e-06 | NA |
| 7. B | C6E8P1 | ATP synthase subunit c | 2.94e-13 | NA | 1.18e-07 | NA |
| 7. B | P26682 | ATP synthase subunit c | 5.01e-14 | NA | 0.048 | NA |
| 7. B | B2IQX6 | ATP synthase subunit c | 5.62e-11 | NA | 0.010 | NA |
| 7. B | B9MS73 | ATP synthase subunit c | 1.15e-12 | NA | 0.002 | NA |
| 7. B | Q5RAP9 | ATP synthase F(0) complex subunit C2, mitochondrial | 8.08e-08 | NA | 9.28e-07 | NA |
| 7. B | A3DAR9 | ATP synthase subunit c | 4.61e-11 | NA | 0.036 | NA |
| 7. B | C1CSD4 | ATP synthase subunit c | 8.11e-11 | NA | 0.010 | NA |
| 7. B | Q38WK0 | ATP synthase subunit c | 8.24e-12 | NA | 0.020 | NA |
| 7. B | C1CF99 | ATP synthase subunit c | 4.60e-11 | NA | 0.010 | NA |
| 7. B | A3N2U9 | ATP synthase subunit c | 3.75e-11 | NA | 0.020 | NA |
| 7. B | A1AP46 | ATP synthase subunit c 2 | 1.03e-13 | NA | 1.19e-08 | NA |
| 7. B | Q5E1N2 | ATP synthase subunit c | 4.39e-11 | NA | 0.021 | NA |
| 7. B | B0BRX7 | ATP synthase subunit c | 3.97e-11 | NA | 0.020 | NA |
| 7. B | B8ZLB5 | ATP synthase subunit c | 7.34e-11 | NA | 0.010 | NA |
| 7. B | A1ALL1 | ATP synthase subunit c 1 | 7.56e-14 | NA | 6.05e-09 | NA |
| 7. B | Q0HD74 | ATP synthase subunit c | 6.24e-11 | NA | 0.036 | NA |
| 7. B | A6WUJ5 | ATP synthase subunit c | 5.29e-11 | NA | 0.036 | NA |
| 7. B | Q8E8B5 | ATP synthase subunit c | 7.10e-11 | NA | 0.036 | NA |
| 7. B | B2XT86 | ATP synthase subunit c, chloroplastic | 6.38e-14 | NA | 2.93e-05 | NA |
| 7. B | P0A306 | ATP synthase subunit c | 6.04e-11 | NA | 0.010 | NA |
| 7. B | B8F769 | ATP synthase subunit c | 3.78e-11 | NA | 0.019 | NA |
| 7. B | A0L2T3 | ATP synthase subunit c | 5.68e-11 | NA | 0.036 | NA |
| 7. B | P35013 | ATP synthase subunit c, chloroplastic | 7.65e-14 | NA | 6.67e-05 | NA |
| 7. B | A9KX11 | ATP synthase subunit c | 5.03e-11 | NA | 0.036 | NA |
| 7. B | B9LZL2 | ATP synthase subunit c | 3.41e-13 | NA | 3.86e-08 | NA |
| 7. B | P56383 | ATP synthase F(0) complex subunit C2, mitochondrial | 2.27e-07 | NA | 1.43e-06 | NA |
| 7. B | P0A307 | ATP synthase subunit c | 5.55e-11 | NA | 0.010 | NA |
| 7. B | Q3A8L3 | ATP synthase subunit c 1 | 1.10e-14 | NA | 1.68e-06 | NA |
| 7. B | B3E9X4 | ATP synthase subunit c | 2.45e-13 | NA | 2.07e-07 | NA |
| 7. B | A5G9C4 | ATP synthase subunit c | 7.32e-14 | NA | 4.40e-08 | NA |
| 7. B | P07926 | ATP synthase F(0) complex subunit C2, mitochondrial | 1.16e-07 | NA | 1.40e-06 | NA |
| 7. B | Q74GB3 | ATP synthase subunit c | 7.39e-13 | NA | 1.92e-07 | NA |
| 7. B | P43721 | ATP synthase subunit c | 4.69e-11 | NA | 0.022 | NA |
| 7. B | B1KQ39 | ATP synthase subunit c | 6.37e-11 | NA | 0.037 | NA |
| 7. B | B5EFG9 | ATP synthase subunit c | 3.85e-13 | NA | 1.18e-07 | NA |
| 7. B | A3QJR5 | ATP synthase subunit c | 6.66e-11 | NA | 0.037 | NA |
| 7. B | C1CLL2 | ATP synthase subunit c | 5.95e-11 | NA | 0.010 | NA |
| 7. B | Q06055 | ATP synthase F(0) complex subunit C2, mitochondrial | 6.54e-09 | NA | 1.25e-06 | NA |
| 7. B | A8ZUM8 | ATP synthase subunit c | 9.10e-06 | NA | 1.72e-07 | NA |
| 7. B | A5UGZ4 | ATP synthase subunit c | 4.30e-11 | NA | 0.022 | NA |
| 7. B | Q04HT3 | ATP synthase subunit c | 1.81e-10 | NA | 0.010 | NA |
| 7. B | Q4L7Y9 | ATP synthase subunit c | 2.74e-12 | NA | 0.023 | NA |
| 7. B | B3H2P8 | ATP synthase subunit c | 4.35e-11 | NA | 0.020 | NA |
| 7. B | Q3A602 | ATP synthase subunit c 2 | 6.68e-14 | NA | 4.78e-08 | NA |
| 7. B | A8G1X0 | ATP synthase subunit c | 7.83e-11 | NA | 0.037 | NA |
| 7. B | Q39QA2 | ATP synthase subunit c | 1.31e-13 | NA | 2.31e-07 | NA |
| 7. B | Q06056 | ATP synthase F(0) complex subunit C2, mitochondrial | 8.48e-09 | NA | 1.30e-06 | NA |
| 7. B | P0A309 | ATP synthase subunit c | 3.27e-11 | NA | 0.019 | NA |
| 7. B | B5FCZ6 | ATP synthase subunit c | 4.37e-11 | NA | 0.021 | NA |
| 7. B | Q0HPF6 | ATP synthase subunit c | 4.94e-11 | NA | 0.036 | NA |
| 7. B | B5E677 | ATP synthase subunit c | 1.19e-10 | NA | 0.010 | NA |
| 7. B | B2XTP2 | ATP synthase subunit c, chloroplastic | 5.87e-14 | NA | 2.93e-05 | NA |
| 7. B | B1ICT5 | ATP synthase subunit c | 7.21e-11 | NA | 0.010 | NA |
| 7. B | Q5QZI1 | ATP synthase subunit c | 8.72e-11 | NA | 0.019 | NA |
| 7. B | A4XKX5 | ATP synthase subunit c | 8.00e-14 | NA | 0.002 | NA |
| 7. B | Q31DL5 | ATP synthase subunit c | 2.89e-06 | NA | 0.001 | NA |
| 7. B | A5UA06 | ATP synthase subunit c | 4.13e-11 | NA | 0.021 | NA |
| 7. B | A6VL62 | ATP synthase subunit c | 4.48e-11 | NA | 0.025 | NA |