Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54965.1
JCVISYN3A_0796
F0F1 ATP synthase subunit A.
M. mycoides homolog: Q6MS88.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 25
Unique PROST Go: 12
Unique BLAST Go: 0
Unique Foldseek Go: 0
Total Homologs: 678
Unique PROST Homologs: 268
Unique BLAST Homologs: 66
Unique Foldseek Homologs: 13
Structures and Sequence Alignment
The best structural homolog that predicted by 5. P was
Q2GIS5
(ATP synthase subunit a) with a FATCAT P-Value: 1.24e-14 and RMSD of 3.07 angstrom. The sequence alignment identity is 23.0%.
Structural alignment shown in left. Query protein AVX54965.1 colored as red in alignment, homolog Q2GIS5 colored as blue.
Query protein AVX54965.1 is also shown in right top, homolog Q2GIS5 showed in right bottom. They are colored based on secondary structures.
AVX54965.1 ------MKLVTFASIK-----DNLA-TWNKFNGILITIL--LV--VIIVCTISIIYNKKVRNYNID--DKMP-GFLVLV-NVFVASVE-NIVVSILGKKY 79 Q2GIS5 MSPLEQFKVVRLLEIPMPFGMD-ISFT----NCALFMILASLVSAVLLCCAL-----RK-RT---DGSSSMSHTAVELIYNFVVGAIESNAGVG--GLRY 84 AVX54965.1 QKLTPYIMYLFAYIFIGC-LLSILGLEAQGTS-FTVTLSMGMVTFIMIYYFGIKYQKLAFFKRF---RNPVELFTQFTPLISISFRLFGNLIGGSIILGL 174 Q2GIS5 ---IPFVLSIFLFV-LACNIIGILPLGFTATSHVSVTLALSVVVCASVTVLGFNHQGLHFLRIFLPEGTPLWL----APMM-VFIKLFAYL-ARPVSLAI 174 AVX54965.1 LYGLLIGFQLSWGVNNIEVDGMTRWASYAIWNPELVENGYLKQYEYWWAGLNLFTTPIMPFLH-MY---FDLFSGVIQSTVFAMLTLSYWSAQIDDNEKR 270 Q2GIS5 --------RLA--ANMIA--GHTIIAVIA----EFV----LKMHPV----L----APL-PFAFIMVLIAFEIFVAILQAYIFTVLTTVYLSDAVAGH--- 242 AVX54965.1 ADLVDQVKEEITNKYQS 287 Q2GIS5 ----------------- 242
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0015986 | ATP synthesis coupled proton transport |
1. PBF | GO:0009536 | plastid |
1. PBF | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
1. PBF | GO:0016021 | integral component of membrane |
1. PBF | GO:0005886 | plasma membrane |
1. PBF | GO:0009535 | chloroplast thylakoid membrane |
1. PBF | GO:0042777 | plasma membrane ATP synthesis coupled proton transport |
1. PBF | GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
2. PF | GO:0045264 | plasma membrane proton-transporting ATP synthase complex, coupling factor F(o) |
3. BF | GO:0042170 | plastid membrane |
4. PB | GO:0070118 | organellar chromatophore thylakoid membrane |
4. PB | GO:0015078 | proton transmembrane transporter activity |
4. PB | GO:0031676 | plasma membrane-derived thylakoid membrane |
5. P | GO:0005753 | mitochondrial proton-transporting ATP synthase complex |
5. P | GO:0055093 | response to hyperoxia |
5. P | GO:0044799 | NarGHI complex |
5. P | GO:0005743 | mitochondrial inner membrane |
5. P | GO:0019645 | anaerobic electron transport chain |
5. P | GO:0008940 | nitrate reductase activity |
5. P | GO:0042128 | nitrate assimilation |
5. P | GO:0042776 | mitochondrial ATP synthesis coupled proton transport |
5. P | GO:0009061 | anaerobic respiration |
5. P | GO:0046872 | metal ion binding |
5. P | GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) |
5. P | GO:0009325 | nitrate reductase complex |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0015986 | ATP synthesis coupled proton transport |
GO:0015078 | proton transmembrane transporter activity |
GO:1902600 | proton transmembrane transport |
GO:0016021 | integral component of membrane |
GO:0006811 | ion transport |
GO:0016020 | membrane |
GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
GO:0016787 | hydrolase activity |
GO:0006754 | ATP biosynthetic process |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | B4U8V3 | ATP synthase subunit a | 1.97e-09 | 1.19e-08 | 1.88e-06 | 0.7015 |
1. PBF | Q6YXK0 | ATP synthase subunit a, chloroplastic | 3.82e-08 | 2.39e-02 | 3.03e-06 | 0.5925 |
1. PBF | Q3YQV2 | ATP synthase subunit a | 6.78e-07 | 6.77e-05 | 6.37e-04 | 0.5197 |
1. PBF | A4STP9 | ATP synthase subunit a | 5.47e-08 | 1.04e-03 | 0.017 | 0.5486 |
1. PBF | P33251 | ATP synthase subunit a | 6.84e-10 | 2.06e-16 | 3.16e-33 | 0.6308 |
1. PBF | B3TN45 | ATP synthase subunit a, chloroplastic | 1.10e-07 | 2.68e-02 | 2.05e-04 | 0.6094 |
1. PBF | Q09MJ0 | ATP synthase subunit a, chloroplastic | 7.55e-07 | 4.16e-02 | 3.76e-05 | 0.5862 |
1. PBF | Q4VZP5 | ATP synthase subunit a, chloroplastic | 2.43e-07 | 5.69e-03 | 2.06e-05 | 0.5952 |
1. PBF | A8Y9G4 | ATP synthase subunit a, chloroplastic | 9.33e-08 | 2.90e-02 | 1.47e-04 | 0.6115 |
1. PBF | A5IFJ6 | ATP synthase subunit a | 8.74e-09 | 5.65e-06 | 0.004 | 0.5701 |
1. PBF | A4GGA9 | ATP synthase subunit a, chloroplastic | 9.74e-08 | 4.34e-03 | 3.27e-05 | 0.6099 |
1. PBF | Q50326 | ATP synthase subunit a | 8.03e-09 | 2.07e-18 | 4.15e-26 | 0.5741 |
1. PBF | Q5ZWN4 | ATP synthase subunit a | 2.88e-09 | 3.32e-06 | 0.011 | 0.6114 |
1. PBF | Q2RFX3 | ATP synthase subunit a | 1.99e-07 | 1.85e-03 | 0.006 | 0.5489 |
1. PBF | Q5HTR0 | ATP synthase subunit a | 7.44e-10 | 1.02e-06 | 1.86e-04 | 0.6677 |
1. PBF | Q39QA3 | ATP synthase subunit a | 2.20e-09 | 7.93e-03 | 3.61e-06 | 0.6502 |
1. PBF | A1E9I5 | ATP synthase subunit a, chloroplastic | 2.46e-07 | 4.42e-02 | 1.97e-04 | 0.6132 |
1. PBF | A9QC93 | ATP synthase subunit a, chloroplastic | 1.42e-07 | 2.09e-02 | 2.26e-04 | 0.5927 |
1. PBF | Q6ENI0 | ATP synthase subunit a, chloroplastic | 9.22e-07 | 4.74e-02 | 2.41e-04 | 0.6105 |
1. PBF | B1XRK3 | ATP synthase subunit a 2 | 6.27e-09 | 4.67e-08 | 0.002 | 0.6367 |
1. PBF | A5G9C3 | ATP synthase subunit a | 1.42e-09 | 2.41e-04 | 2.00e-07 | 0.6807 |
1. PBF | O05097 | ATP synthase subunit a | 1.93e-10 | 4.84e-08 | 0.003 | 0.6083 |
1. PBF | Q603U8 | ATP synthase subunit a 2 | 8.12e-07 | 3.42e-05 | 1.01e-09 | 0.5497 |
1. PBF | Q9XPT0 | ATP synthase subunit a, chloroplastic | 4.01e-07 | 4.42e-02 | 1.97e-04 | 0.6057 |
1. PBF | Q2W028 | ATP synthase subunit a | 8.83e-10 | 2.07e-07 | 7.23e-06 | 0.588 |
1. PBF | Q9BBS5 | ATP synthase subunit a, chloroplastic | 1.68e-07 | 3.01e-03 | 1.20e-05 | 0.6091 |
1. PBF | Q0G9N1 | ATP synthase subunit a, chloroplastic | 3.33e-07 | 3.75e-02 | 0.001 | 0.5905 |
1. PBF | Q0P952 | ATP synthase subunit a | 2.81e-08 | 1.66e-06 | 6.78e-05 | 0.6682 |
1. PBF | Q8DLP8 | ATP synthase subunit a | 4.37e-08 | 7.74e-04 | 4.30e-04 | 0.5603 |
1. PBF | B8F768 | ATP synthase subunit a | 1.85e-08 | 2.70e-04 | 0.007 | 0.5576 |
1. PBF | B4S798 | ATP synthase subunit a 1 | 3.44e-08 | 9.15e-05 | 2.30e-04 | 0.5634 |
1. PBF | A8FMQ9 | ATP synthase subunit a | 3.86e-09 | 1.66e-06 | 6.78e-05 | 0.659 |
1. PBF | A1AP45 | ATP synthase subunit a 3 | 7.82e-10 | 3.70e-03 | 6.74e-05 | 0.6682 |
1. PBF | A4QL07 | ATP synthase subunit a, chloroplastic | 1.20e-07 | 3.65e-02 | 2.05e-05 | 0.5991 |
1. PBF | A9L984 | ATP synthase subunit a, chloroplastic | 7.82e-08 | 2.54e-02 | 1.26e-04 | 0.5877 |
1. PBF | P0C2Y6 | ATP synthase subunit a, chloroplastic | 2.57e-07 | 1.98e-02 | 2.16e-04 | 0.6071 |
1. PBF | A1ALL0 | ATP synthase subunit a 1 | 9.57e-10 | 8.38e-03 | 1.07e-05 | 0.6483 |
1. PBF | Q30XV0 | ATP synthase subunit a | 5.78e-08 | 8.96e-04 | 8.25e-06 | 0.5293 |
1. PBF | Q5X2Q6 | ATP synthase subunit a | 1.28e-08 | 3.88e-06 | 0.016 | 0.6133 |
1. PBF | A5FVJ0 | ATP synthase subunit a | 1.12e-09 | 2.26e-03 | 6.81e-05 | 0.5957 |
1. PBF | Q1MPG6 | ATP synthase subunit a | 4.48e-07 | 1.11e-07 | 6.60e-04 | 0.5973 |
1. PBF | Q2G8R3 | ATP synthase subunit a | 3.45e-07 | 5.95e-07 | 2.33e-05 | 0.553 |
1. PBF | B5LMM8 | ATP synthase subunit a, chloroplastic | 3.75e-07 | 4.26e-03 | 2.94e-06 | 0.5983 |
1. PBF | Q06GS2 | ATP synthase subunit a, chloroplastic | 1.74e-07 | 2.17e-02 | 6.10e-04 | 0.6114 |
1. PBF | B2LMI4 | ATP synthase subunit a, chloroplastic | 3.36e-07 | 1.86e-02 | 0.001 | 0.5919 |
1. PBF | A6MMB0 | ATP synthase subunit a, chloroplastic | 6.32e-07 | 2.33e-02 | 4.47e-04 | 0.5784 |
1. PBF | A1EA02 | ATP synthase subunit a, chloroplastic | 1.48e-07 | 2.85e-02 | 1.95e-04 | 0.6017 |
1. PBF | Q56P09 | ATP synthase subunit a, chloroplastic | 3.89e-07 | 3.17e-02 | 1.44e-04 | 0.6005 |
1. PBF | O66566 | ATP synthase subunit a | 1.56e-10 | 1.26e-07 | 1.49e-04 | 0.674 |
1. PBF | A6MM24 | ATP synthase subunit a, chloroplastic | 1.08e-06 | 3.85e-02 | 2.67e-04 | 0.6015 |
1. PBF | B1NWD8 | ATP synthase subunit a, chloroplastic | 1.76e-07 | 7.72e-03 | 6.14e-05 | 0.5977 |
1. PBF | Q6MAK1 | ATP synthase subunit a | 7.69e-07 | 1.15e-04 | 1.98e-04 | 0.5382 |
1. PBF | Q0G9X4 | ATP synthase subunit a, chloroplastic | 2.15e-07 | 4.78e-02 | 6.78e-05 | 0.5981 |
1. PBF | P0C2Y5 | ATP synthase subunit a, chloroplastic | 3.52e-07 | 1.98e-02 | 2.16e-04 | 0.6085 |
1. PBF | Q7MAD5 | ATP synthase subunit a | 7.60e-09 | 1.21e-04 | 7.58e-04 | 0.618 |
1. PBF | A4WNY6 | ATP synthase subunit a | 3.21e-08 | 5.00e-05 | 5.45e-05 | 0.5867 |
1. PBF | Q09X29 | ATP synthase subunit a, chloroplastic | 2.01e-07 | 3.95e-03 | 1.35e-05 | 0.6023 |
1. PBF | A4QLI2 | ATP synthase subunit a, chloroplastic | 2.32e-07 | 4.31e-02 | 2.37e-05 | 0.5385 |
1. PBF | P06452 | ATP synthase subunit a, chloroplastic | 1.89e-07 | 2.61e-03 | 2.70e-06 | 0.5917 |
1. PBF | Q2SNG4 | ATP synthase subunit a 1 | 4.37e-10 | 2.09e-07 | 1.01e-06 | 0.59 |
1. PBF | Q06H09 | ATP synthase subunit a, chloroplastic | 3.60e-07 | 3.12e-02 | 3.49e-04 | 0.596 |
2. PF | A9KX12 | ATP synthase subunit a | 7.46e-08 | 7.59e-04 | NA | 0.4813 |
2. PF | Q4QN58 | ATP synthase subunit a | 7.76e-09 | 7.28e-05 | NA | 0.5273 |
2. PF | Q9KNG9 | ATP synthase subunit a | 2.11e-07 | 3.20e-02 | NA | 0.5536 |
2. PF | C3LSJ5 | ATP synthase subunit a | 2.94e-07 | 3.20e-02 | NA | 0.5295 |
2. PF | Q5E1N1 | ATP synthase subunit a | 9.01e-08 | 4.91e-02 | NA | 0.5148 |
2. PF | A7N2U2 | ATP synthase subunit a 2 | 3.78e-08 | 1.95e-02 | NA | 0.5004 |
2. PF | A7I1B2 | ATP synthase subunit a | 8.27e-09 | 2.12e-06 | NA | 0.624 |
2. PF | Q0BQY7 | ATP synthase subunit a | 4.97e-09 | 2.51e-04 | NA | 0.5713 |
2. PF | C1CF98 | ATP synthase subunit a | 3.76e-09 | 1.03e-06 | NA | 0.6514 |
2. PF | A5UGZ5 | ATP synthase subunit a | 1.05e-08 | 7.28e-05 | NA | 0.5529 |
2. PF | Q9CKW6 | ATP synthase subunit a | 2.30e-07 | 7.59e-06 | NA | 0.5419 |
2. PF | Q5FRW5 | ATP synthase subunit a | 5.41e-11 | 1.64e-04 | NA | 0.6198 |
2. PF | B0ULY1 | ATP synthase subunit a | 1.84e-07 | 3.88e-05 | NA | 0.641 |
2. PF | Q1IS49 | ATP synthase subunit a | 9.19e-07 | 5.01e-04 | NA | 0.525 |
2. PF | A1B619 | ATP synthase subunit a | 3.81e-10 | 1.68e-04 | NA | 0.6147 |
2. PF | B1ICT4 | ATP synthase subunit a | 4.01e-10 | 1.03e-06 | NA | 0.6396 |
3. BF | Q3V546 | ATP synthase subunit a, chloroplastic | 3.02e-07 | NA | 3.42e-04 | 0.5803 |
3. BF | Q09G58 | ATP synthase subunit a, chloroplastic | 2.27e-07 | NA | 4.11e-04 | 0.6005 |
3. BF | Q4FGF8 | ATP synthase subunit a, chloroplastic | 1.36e-06 | NA | 3.42e-04 | 0.5833 |
3. BF | Q329S7 | ATP synthase subunit a | 2.05e-07 | NA | 0.005 | 0.5117 |
3. BF | B1LL65 | ATP synthase subunit a | 2.41e-07 | NA | 0.005 | 0.4948 |
3. BF | A4QK93 | ATP synthase subunit a, chloroplastic | 1.05e-07 | NA | 1.01e-05 | 0.595 |
3. BF | B1A923 | ATP synthase subunit a, chloroplastic | 1.87e-07 | NA | 5.19e-05 | 0.6068 |
3. BF | Q3ANW6 | ATP synthase subunit a | 2.08e-07 | NA | 0.003 | 0.5848 |
3. BF | B7UMK3 | ATP synthase subunit a | 1.73e-07 | NA | 0.005 | 0.5073 |
3. BF | Q6L3A3 | ATP synthase subunit a, chloroplastic | 2.03e-07 | NA | 1.87e-04 | 0.6065 |
3. BF | Q33C50 | ATP synthase subunit a, chloroplastic | 2.52e-07 | NA | 1.92e-04 | 0.5929 |
3. BF | Q1C089 | ATP synthase subunit a | 3.59e-07 | NA | 0.010 | 0.4954 |
3. BF | B3EQ98 | ATP synthase subunit a | 1.15e-10 | NA | 0.019 | 0.6062 |
3. BF | Q09FX3 | ATP synthase subunit a, chloroplastic | 3.27e-07 | NA | 4.72e-04 | 0.5998 |
3. BF | B2TUN7 | ATP synthase subunit a | 1.26e-07 | NA | 0.005 | 0.4939 |
3. BF | B1JR35 | ATP synthase subunit a | 4.54e-07 | NA | 0.010 | 0.4833 |
3. BF | Q68S18 | ATP synthase subunit a, chloroplastic | 3.88e-07 | NA | 6.05e-04 | 0.5908 |
3. BF | A4GYP6 | ATP synthase subunit a, chloroplastic | 6.94e-07 | NA | 8.62e-06 | 0.5992 |
3. BF | A8W3B2 | ATP synthase subunit a, plastid | 8.21e-07 | NA | 9.27e-05 | 0.5916 |
3. BF | A7MMW0 | ATP synthase subunit a | 1.88e-07 | NA | 0.001 | 0.5181 |
3. BF | C4XQ07 | ATP synthase subunit a | 7.08e-08 | NA | 1.42e-08 | 0.5737 |
3. BF | Q3BAQ4 | ATP synthase subunit a, chloroplastic | 1.95e-07 | NA | 8.30e-05 | 0.6037 |
3. BF | A9MJR3 | ATP synthase subunit a | 2.32e-07 | NA | 0.005 | 0.5423 |
3. BF | B2X1U8 | ATP synthase subunit a, chloroplastic | 1.95e-06 | NA | 5.20e-08 | 0.577 |
3. BF | C0Q2N8 | ATP synthase subunit a | 2.38e-07 | NA | 0.005 | 0.5576 |
3. BF | Q2NQ92 | ATP synthase subunit a | 3.18e-07 | NA | 0.004 | 0.4915 |
3. BF | Q7NA89 | ATP synthase subunit a | 5.76e-08 | NA | 0.003 | 0.4924 |
3. BF | Q06RE3 | ATP synthase subunit a, chloroplastic | 1.15e-06 | NA | 2.31e-04 | 0.5951 |
3. BF | Q7CPE3 | ATP synthase subunit a | 2.30e-07 | NA | 0.005 | 0.559 |
3. BF | A4QKI0 | ATP synthase subunit a, chloroplastic | 1.75e-07 | NA | 6.67e-05 | 0.595 |
3. BF | A4QL94 | ATP synthase subunit a, chloroplastic | 1.67e-07 | NA | 2.12e-05 | 0.6014 |
3. BF | C6E8P0 | ATP synthase subunit a | 2.38e-07 | NA | 4.25e-07 | 0.6088 |
3. BF | P21903 | ATP synthase subunit a, sodium ion specific | 1.06e-07 | NA | 8.19e-08 | 0.5722 |
3. BF | B5BIP2 | ATP synthase subunit a | 2.00e-07 | NA | 0.005 | 0.5597 |
3. BF | B2K841 | ATP synthase subunit a | 1.99e-07 | NA | 0.010 | 0.503 |
3. BF | Q5PKW6 | ATP synthase subunit a | 2.40e-07 | NA | 0.005 | 0.5407 |
3. BF | B4TAX8 | ATP synthase subunit a | 2.04e-07 | NA | 0.005 | 0.5324 |
3. BF | Q06FX3 | ATP synthase subunit a, chloroplastic | 2.19e-07 | NA | 4.97e-06 | 0.5849 |
3. BF | Q14FG9 | ATP synthase subunit a, chloroplastic | 1.68e-07 | NA | 7.64e-06 | 0.6068 |
3. BF | B7LK83 | ATP synthase subunit a | 1.93e-07 | NA | 0.005 | 0.5067 |
3. BF | A1AHR8 | ATP synthase subunit a | 2.17e-07 | NA | 0.005 | 0.4949 |
3. BF | A8SE70 | ATP synthase subunit a, chloroplastic | 2.00e-07 | NA | 0.001 | 0.5996 |
3. BF | A8G7M2 | ATP synthase subunit a | 7.96e-08 | NA | 0.004 | 0.4812 |
3. BF | Q3C1H1 | ATP synthase subunit a, chloroplastic | 3.26e-07 | NA | 1.92e-04 | 0.6059 |
3. BF | B2VCB0 | ATP synthase subunit a | 1.91e-07 | NA | 0.003 | 0.5188 |
3. BF | A4QKR9 | ATP synthase subunit a, chloroplastic | 1.57e-07 | NA | 2.37e-05 | 0.5957 |
3. BF | P06451 | ATP synthase subunit a, chloroplastic | 3.23e-07 | NA | 9.98e-05 | 0.6013 |
3. BF | Q89B45 | ATP synthase subunit a | 6.01e-07 | NA | 2.71e-04 | 0.5165 |
3. BF | Q2VEI8 | ATP synthase subunit a, chloroplastic | 3.00e-07 | NA | 1.92e-04 | 0.5839 |
3. BF | Q83PJ8 | ATP synthase subunit a | 2.03e-07 | NA | 0.005 | 0.5171 |
3. BF | A6TG42 | ATP synthase subunit a | 1.79e-07 | NA | 0.022 | 0.5085 |
3. BF | B0Z4M9 | ATP synthase subunit a, chloroplastic | 6.55e-07 | NA | 6.91e-05 | 0.6058 |
3. BF | P69371 | ATP synthase subunit a, chloroplastic | 1.85e-07 | NA | 1.92e-04 | 0.5831 |
3. BF | C5BF34 | ATP synthase subunit a | 3.17e-07 | NA | 7.61e-04 | 0.5072 |
3. BF | B7NF54 | ATP synthase subunit a | 1.87e-07 | NA | 0.005 | 0.4959 |
3. BF | B5QVD8 | ATP synthase subunit a | 2.25e-07 | NA | 0.005 | 0.5482 |
3. BF | A4J9A5 | ATP synthase subunit a | 2.40e-08 | NA | 0.001 | 0.5562 |
3. BF | A9MXB2 | ATP synthase subunit a | 2.49e-07 | NA | 0.005 | 0.551 |
3. BF | A0LIP0 | ATP synthase subunit a | 7.05e-08 | NA | 3.46e-07 | 0.6014 |
3. BF | Q4FGF5 | ATP synthase subunit a, chloroplastic | 6.85e-07 | NA | 1.38e-04 | 0.5945 |
3. BF | B2XWN7 | ATP synthase subunit a, chloroplastic | 2.39e-07 | NA | 1.41e-05 | 0.5889 |
3. BF | B7N241 | ATP synthase subunit a | 1.92e-07 | NA | 0.005 | 0.5125 |
3. BF | Q0TAX1 | ATP synthase subunit a | 2.20e-07 | NA | 0.005 | 0.5069 |
3. BF | B4SYD7 | ATP synthase subunit a | 2.09e-07 | NA | 0.005 | 0.5512 |
3. BF | Q1CCG9 | ATP synthase subunit a | 4.19e-07 | NA | 0.010 | 0.4812 |
3. BF | A7M954 | ATP synthase subunit a, plastid | 8.60e-08 | NA | 3.46e-05 | 0.6182 |
3. BF | A0ZZ23 | ATP synthase subunit a, chloroplastic | 2.60e-07 | NA | 4.82e-05 | 0.6235 |
3. BF | B5FN39 | ATP synthase subunit a | 2.06e-07 | NA | 0.005 | 0.5077 |
3. BF | A7FPE6 | ATP synthase subunit a | 4.24e-07 | NA | 0.010 | 0.4902 |
3. BF | B0Z4W3 | ATP synthase subunit a, chloroplastic | 2.38e-07 | NA | 6.91e-05 | 0.6026 |
3. BF | B7NR40 | ATP synthase subunit a | 2.14e-07 | NA | 0.005 | 0.5037 |
3. BF | B7MGF8 | ATP synthase subunit a | 3.11e-07 | NA | 0.005 | 0.4873 |
3. BF | A7Y3B0 | ATP synthase subunit a, chloroplastic | 6.03e-07 | NA | 2.10e-04 | 0.6023 |
3. BF | A8ZUM7 | ATP synthase subunit a | 2.81e-08 | NA | 8.52e-07 | 0.5487 |
3. BF | O51878 | ATP synthase subunit a | 1.69e-08 | NA | 0.016 | 0.5202 |
3. BF | A4QJS1 | ATP synthase subunit a, chloroplastic | 2.20e-07 | NA | 1.05e-05 | 0.5913 |
3. BF | B0Z5D1 | ATP synthase subunit a, chloroplastic | 3.70e-07 | NA | 6.91e-05 | 0.5991 |
3. BF | Q7YJY2 | ATP synthase subunit a, chloroplastic | 4.23e-07 | NA | 1.46e-04 | 0.5845 |
3. BF | A4QJI7 | ATP synthase subunit a, chloroplastic | 1.56e-07 | NA | 2.09e-05 | 0.601 |
3. BF | A6MMJ5 | ATP synthase subunit a, chloroplastic | 8.79e-07 | NA | 1.33e-04 | 0.5949 |
3. BF | A8ACP4 | ATP synthase subunit a | 2.01e-07 | NA | 0.013 | 0.5229 |
3. BF | B4TN37 | ATP synthase subunit a | 1.01e-07 | NA | 0.005 | 0.5539 |
3. BF | A4TSI7 | ATP synthase subunit a | 4.29e-07 | NA | 0.010 | 0.4925 |
3. BF | Q2L8Z7 | ATP synthase subunit a, chloroplastic | 1.93e-07 | NA | 4.12e-05 | 0.621 |
3. BF | Q8XGC2 | ATP synthase subunit a | 2.26e-07 | NA | 0.005 | 0.5448 |
3. BF | B5RFV7 | ATP synthase subunit a | 2.15e-07 | NA | 0.005 | 0.5485 |
3. BF | Q2MIB2 | ATP synthase subunit a, chloroplastic | 2.48e-07 | NA | 1.92e-04 | 0.597 |
3. BF | Q0ZJ32 | ATP synthase subunit a, chloroplastic | 2.70e-07 | NA | 1.55e-04 | 0.5914 |
3. BF | Q8FBS8 | ATP synthase subunit a | 1.92e-07 | NA | 0.005 | 0.5369 |
3. BF | Q7CFM3 | ATP synthase subunit a | 3.36e-07 | NA | 0.010 | 0.5065 |
3. BF | Q6ENW9 | ATP synthase subunit a, chloroplastic | 1.67e-07 | NA | 1.87e-04 | 0.593 |
3. BF | B3E9X3 | ATP synthase subunit a | 3.94e-09 | NA | 2.37e-06 | 0.6645 |
3. BF | A1E9R8 | ATP synthase subunit a, chloroplastic | 2.00e-07 | NA | 2.26e-04 | 0.5944 |
3. BF | Q49L10 | ATP synthase subunit a, chloroplastic | 1.21e-07 | NA | 5.69e-05 | 0.5869 |
3. BF | A4QK06 | ATP synthase subunit a, chloroplastic | 1.64e-07 | NA | 4.88e-05 | 0.6042 |
3. BF | Q1R4J4 | ATP synthase subunit a | 2.03e-07 | NA | 0.005 | 0.5082 |
3. BF | Q57HX3 | ATP synthase subunit a | 1.87e-07 | NA | 0.005 | 0.5429 |
3. BF | B5XZL8 | ATP synthase subunit a | 2.17e-07 | NA | 0.017 | 0.5249 |
3. BF | B0Z547 | ATP synthase subunit a, chloroplastic | 5.20e-07 | NA | 6.91e-05 | 0.592 |
3. BF | Q1KXW8 | ATP synthase subunit a, chloroplastic | 2.75e-07 | NA | 1.40e-04 | 0.5952 |
3. BF | P69372 | ATP synthase subunit a, chloroplastic | 2.57e-07 | NA | 1.92e-04 | 0.6087 |
3. BF | Q8KGE7 | ATP synthase subunit a 2 | 1.44e-07 | NA | 3.59e-06 | 0.5463 |
3. BF | Q0P3K8 | ATP synthase subunit a, chloroplastic | 4.74e-07 | NA | 5.35e-06 | 0.6086 |
3. BF | A4QLS1 | ATP synthase subunit a, chloroplastic | 1.00e-07 | NA | 2.37e-05 | 0.599 |
3. BF | Q9MTM0 | ATP synthase subunit a, chloroplastic | 1.21e-06 | NA | 6.91e-05 | 0.6126 |
3. BF | A1BJW6 | ATP synthase subunit a | 1.19e-06 | NA | 3.37e-04 | 0.6049 |
3. BF | P56295 | ATP synthase subunit a, chloroplastic | 5.83e-07 | NA | 1.16e-05 | 0.6074 |
3. BF | B5EZ02 | ATP synthase subunit a | 2.27e-07 | NA | 0.005 | 0.5205 |
3. BF | Q9TL13 | ATP synthase subunit a, chloroplastic | 2.25e-06 | NA | 9.87e-05 | 0.566 |
3. BF | A4WGE9 | ATP synthase subunit a | 2.16e-07 | NA | 0.020 | 0.5495 |
3. BF | A6MMT2 | ATP synthase subunit a, chloroplastic | 4.05e-07 | NA | 4.23e-04 | 0.6026 |
4. PB | A2C6X0 | ATP synthase subunit a | 1.23e-06 | 1.50e-04 | 0.016 | NA |
4. PB | C1KYV2 | ATP synthase subunit a | 1.87e-07 | 2.27e-06 | 0.003 | NA |
4. PB | A6QIV3 | ATP synthase subunit a | 8.04e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A1VF66 | ATP synthase subunit a | 6.33e-08 | 9.97e-03 | 4.40e-04 | NA |
4. PB | Q46J52 | ATP synthase subunit a | 1.99e-07 | 2.36e-05 | 0.021 | NA |
4. PB | Q2IRA6 | ATP synthase subunit a | 5.54e-09 | 1.99e-05 | 0.001 | NA |
4. PB | Q5HE91 | ATP synthase subunit a | 2.50e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A5IUQ4 | ATP synthase subunit a | 4.38e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | P20600 | ATP synthase subunit a | 2.97e-10 | 3.27e-04 | 6.60e-04 | NA |
4. PB | C0M715 | ATP synthase subunit a | 5.05e-08 | 4.04e-08 | 0.001 | NA |
4. PB | A7ZD62 | ATP synthase subunit a | 1.53e-08 | 3.84e-06 | 3.04e-04 | NA |
4. PB | P0CZ90 | ATP synthase subunit a | 1.50e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | P15012 | ATP synthase subunit a | 1.66e-06 | 9.75e-06 | 1.17e-06 | NA |
4. PB | Q7CND5 | ATP synthase subunit a | 1.50e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q9A0J2 | ATP synthase subunit a | 1.04e-07 | 2.00e-08 | 2.63e-04 | NA |
4. PB | Q5XCY5 | ATP synthase subunit a | 2.23e-09 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q2PMT1 | ATP synthase subunit a, chloroplastic | 2.94e-07 | 3.43e-03 | 1.46e-05 | NA |
4. PB | Q2JIF4 | ATP synthase subunit a | 4.09e-08 | 1.15e-03 | 1.98e-05 | NA |
4. PB | Q6CYI9 | ATP synthase subunit a | 4.35e-07 | 1.60e-03 | 0.014 | NA |
4. PB | P47645 | ATP synthase subunit a | 1.60e-09 | 3.39e-20 | 2.09e-27 | NA |
4. PB | Q927V8 | ATP synthase subunit a | 4.16e-08 | 2.27e-06 | 0.003 | NA |
4. PB | B5Z7J3 | ATP synthase subunit a | 1.70e-07 | 5.11e-06 | 3.76e-06 | NA |
4. PB | A2BYI1 | ATP synthase subunit a | 1.66e-06 | 1.35e-02 | 0.018 | NA |
4. PB | Q1JCL8 | ATP synthase subunit a | 1.34e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q7U8X0 | ATP synthase subunit a | 8.44e-08 | 7.86e-03 | 4.83e-04 | NA |
4. PB | A7GYS2 | ATP synthase subunit a | 9.93e-08 | 1.08e-04 | 5.86e-05 | NA |
4. PB | Q74GB2 | ATP synthase subunit a | 4.13e-07 | 1.42e-02 | 5.11e-06 | NA |
4. PB | Q1CT41 | ATP synthase subunit a | 9.85e-08 | 5.11e-06 | 3.76e-06 | NA |
4. PB | A3PEU4 | ATP synthase subunit a | 5.27e-07 | 2.18e-03 | 0.017 | NA |
4. PB | P12404 | ATP synthase subunit a | 7.93e-08 | 3.01e-04 | 8.19e-04 | NA |
4. PB | A8G6V6 | ATP synthase subunit a | 1.28e-06 | 2.49e-03 | 0.018 | NA |
4. PB | A9BCE4 | ATP synthase subunit a | 8.17e-07 | 7.20e-05 | 0.005 | NA |
4. PB | Q0RDA8 | ATP synthase subunit a | 8.57e-07 | 2.64e-12 | 0.001 | NA |
4. PB | A2C4K0 | ATP synthase subunit a | 1.66e-07 | 2.36e-05 | 0.021 | NA |
4. PB | Q07VT8 | ATP synthase subunit a | 1.50e-07 | 2.46e-04 | 0.008 | NA |
4. PB | Q2G2F4 | ATP synthase subunit a | 9.70e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | B3CQT9 | ATP synthase subunit a | 4.78e-07 | 2.62e-04 | 3.08e-06 | NA |
4. PB | Q3AZM6 | ATP synthase subunit a | 4.68e-07 | 3.31e-02 | 2.09e-04 | NA |
4. PB | P08444 | ATP synthase subunit a | 2.84e-07 | 1.94e-03 | 3.37e-05 | NA |
4. PB | A0ALL9 | ATP synthase subunit a | 2.09e-07 | 1.73e-06 | 0.004 | NA |
4. PB | B1XHZ3 | ATP synthase subunit a 1 | 1.03e-06 | 2.59e-02 | 1.55e-06 | NA |
4. PB | P9WPV7 | ATP synthase subunit a | 2.44e-08 | 2.13e-02 | 0.002 | NA |
4. PB | Q6GEW6 | ATP synthase subunit a | 1.36e-09 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A2RFC7 | ATP synthase subunit a | 1.58e-07 | 1.45e-07 | 2.56e-04 | NA |
4. PB | B3QNH3 | ATP synthase subunit a 1 | 2.18e-07 | 1.23e-05 | 7.24e-05 | NA |
4. PB | B4U2D6 | ATP synthase subunit a | 1.20e-08 | 4.04e-08 | 0.001 | NA |
4. PB | Q9ZL15 | ATP synthase subunit a | 8.41e-09 | 5.17e-06 | 3.76e-06 | NA |
4. PB | Q2FF18 | ATP synthase subunit a | 4.34e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | Q0H8Y6 | ATP synthase subunit a | 1.02e-07 | 7.76e-06 | 4.71e-04 | NA |
4. PB | Q8KDL8 | ATP synthase subunit a 1 | 9.75e-08 | 2.66e-02 | 5.13e-05 | NA |
4. PB | Q3B402 | ATP synthase subunit a 1 | 3.26e-07 | 1.93e-05 | 7.06e-04 | NA |
4. PB | A5VEV5 | ATP synthase subunit a | 3.24e-07 | 1.31e-05 | 0.030 | NA |
4. PB | Q99SE9 | ATP synthase subunit a | 8.77e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A0KQY4 | ATP synthase subunit a | 1.14e-08 | 1.31e-04 | 0.029 | NA |
4. PB | Q1J7G4 | ATP synthase subunit a | 1.55e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q13CX1 | ATP synthase subunit a | 2.34e-07 | 2.01e-05 | 0.002 | NA |
4. PB | Q0AMJ4 | ATP synthase subunit a | 3.22e-07 | 8.20e-07 | 0.001 | NA |
4. PB | Q2YUJ5 | ATP synthase subunit a | 5.11e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A8ZNS1 | ATP synthase subunit a 2 | 5.22e-09 | 2.46e-06 | 3.72e-05 | NA |
4. PB | Q3A8L4 | ATP synthase subunit a 1 | 9.09e-07 | 6.13e-03 | 1.68e-04 | NA |
4. PB | Q7A4E5 | ATP synthase subunit a | 8.17e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | Q19VA2 | ATP synthase subunit a, chloroplastic | 5.13e-07 | 2.05e-02 | 1.21e-06 | NA |
4. PB | Q2GFB2 | ATP synthase subunit a | 6.59e-07 | 4.72e-03 | 6.62e-05 | NA |
4. PB | Q1JMJ4 | ATP synthase subunit a | 1.65e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | B6JM59 | ATP synthase subunit a | 1.32e-07 | 5.17e-06 | 3.76e-06 | NA |
4. PB | A2BT30 | ATP synthase subunit a | 1.05e-06 | 4.30e-03 | 0.033 | NA |
4. PB | A0LSL0 | ATP synthase subunit a | 2.50e-06 | 1.31e-09 | 0.015 | NA |
4. PB | Q16AM8 | ATP synthase subunit a | 1.30e-08 | 7.51e-04 | 0.002 | NA |
4. PB | Q2LVX0 | ATP synthase subunit a | 6.58e-07 | 4.95e-05 | 1.00e-09 | NA |
4. PB | B8J4L9 | ATP synthase subunit a | 4.45e-07 | 1.61e-02 | 1.24e-05 | NA |
4. PB | Q5P9R8 | ATP synthase subunit a | 9.05e-08 | 1.96e-03 | 0.036 | NA |
4. PB | A6QAM3 | ATP synthase subunit a | 1.70e-08 | 5.66e-12 | 1.31e-06 | NA |
4. PB | B5XKP6 | ATP synthase subunit a | 9.81e-08 | 2.40e-08 | 2.63e-04 | NA |
4. PB | A7X4V1 | ATP synthase subunit a | 3.78e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A6Q3A6 | ATP synthase subunit a | 3.85e-09 | 3.39e-05 | 5.28e-05 | NA |
4. PB | B2UT00 | ATP synthase subunit a | 3.84e-07 | 5.11e-06 | 3.76e-06 | NA |
4. PB | Q8EM77 | ATP synthase subunit a | 1.54e-09 | 2.06e-03 | 2.18e-04 | NA |
4. PB | B1WXB4 | ATP synthase subunit a 1 | 1.31e-08 | 1.09e-08 | 9.72e-06 | NA |
4. PB | P42010 | ATP synthase subunit a | 5.99e-10 | 2.90e-03 | 1.78e-05 | NA |
4. PB | Q5HA45 | ATP synthase subunit a | 5.10e-07 | 5.74e-03 | 2.64e-04 | NA |
4. PB | Q1GU79 | ATP synthase subunit a | 3.15e-07 | 1.25e-04 | 0.013 | NA |
4. PB | Q21ZA2 | ATP synthase subunit a | 4.37e-07 | 4.16e-07 | 2.60e-05 | NA |
4. PB | Q318T6 | ATP synthase subunit a | 1.12e-06 | 1.35e-03 | 0.018 | NA |
4. PB | A7H2H4 | ATP synthase subunit a | 7.15e-08 | 2.51e-06 | 1.13e-05 | NA |
4. PB | P9WPV6 | ATP synthase subunit a | 3.47e-08 | 2.13e-02 | 0.002 | NA |
4. PB | P43454 | ATP synthase subunit a | 1.09e-07 | 6.10e-09 | 0.002 | NA |
4. PB | B9LZL3 | ATP synthase subunit a | 3.63e-07 | 2.85e-02 | 2.14e-09 | NA |
4. PB | Q71WP3 | ATP synthase subunit a | 7.83e-08 | 2.27e-06 | 0.003 | NA |
4. PB | Q1ACN1 | ATP synthase subunit a, chloroplastic | 4.47e-07 | 3.37e-03 | 4.57e-04 | NA |
4. PB | P0C2Y7 | ATP synthase subunit a, chloroplastic | 1.89e-07 | 1.98e-02 | 2.16e-04 | NA |
4. PB | Q2RPA4 | ATP synthase subunit a | 2.35e-09 | 9.75e-06 | 1.17e-06 | NA |
4. PB | Q0I7Q7 | ATP synthase subunit a | 5.62e-07 | 9.79e-04 | 1.63e-04 | NA |
4. PB | Q30QW4 | ATP synthase subunit a | 4.35e-07 | 1.15e-06 | 6.42e-04 | NA |
4. PB | Q3AHK0 | ATP synthase subunit a | 3.86e-07 | 2.19e-02 | 4.08e-05 | NA |
4. PB | A6U3J4 | ATP synthase subunit a | 6.83e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | Q7V032 | ATP synthase subunit a | 2.87e-07 | 3.24e-03 | 0.008 | NA |
4. PB | A3PN85 | ATP synthase subunit a | 5.39e-08 | 4.09e-05 | 6.31e-05 | NA |
4. PB | Q8Y4B6 | ATP synthase subunit a | 1.49e-10 | 4.36e-07 | 0.004 | NA |
4. PB | P09218 | ATP synthase subunit a | 1.02e-07 | 2.54e-04 | 5.04e-05 | NA |
4. PB | B1X3Y1 | ATP synthase subunit a, organellar chromatophore | 8.75e-08 | 3.54e-04 | 1.22e-04 | NA |
4. PB | Q06J71 | ATP synthase subunit a, chloroplastic | 4.96e-07 | 2.73e-02 | 2.68e-05 | NA |
4. PB | Q5KUI7 | ATP synthase subunit a | 6.79e-08 | 3.70e-03 | 2.59e-04 | NA |
4. PB | A5CDC5 | ATP synthase subunit a | 2.11e-06 | 5.97e-05 | 7.35e-05 | NA |
4. PB | P0CZ91 | ATP synthase subunit a | 1.77e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q830Z9 | ATP synthase subunit a | 6.54e-09 | 5.95e-09 | 1.23e-05 | NA |
4. PB | Q3IZ12 | ATP synthase subunit a | 4.79e-08 | 4.09e-05 | 6.31e-05 | NA |
4. PB | Q3M9V5 | ATP synthase subunit a | 7.06e-08 | 2.81e-04 | 6.95e-04 | NA |
4. PB | Q7A0C2 | ATP synthase subunit a | 1.97e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | A0RP13 | ATP synthase subunit a | 1.20e-08 | 2.36e-05 | 0.002 | NA |
4. PB | P56085 | ATP synthase subunit a | 1.36e-07 | 5.11e-06 | 3.76e-06 | NA |
4. PB | A1W0I8 | ATP synthase subunit a | 3.72e-08 | 1.02e-06 | 1.86e-04 | NA |
4. PB | Q17WM4 | ATP synthase subunit a | 2.49e-07 | 6.66e-06 | 2.88e-05 | NA |
4. PB | C6DJG6 | ATP synthase subunit a | 1.67e-07 | 1.65e-03 | 0.009 | NA |
4. PB | Q2GE13 | ATP synthase subunit a | 1.67e-09 | 3.95e-04 | 1.32e-04 | NA |
4. PB | C0MH74 | ATP synthase subunit a | 8.43e-09 | 4.04e-08 | 0.001 | NA |
4. PB | Q5FGK8 | ATP synthase subunit a | 6.19e-07 | 5.74e-03 | 2.64e-04 | NA |
4. PB | Q3A603 | ATP synthase subunit a 2 | 1.25e-06 | 1.32e-04 | 0.001 | NA |
4. PB | Q8D3J9 | ATP synthase subunit a | 2.27e-07 | 3.95e-02 | 1.03e-05 | NA |
4. PB | Q48UD8 | ATP synthase subunit a | 2.15e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q2JSV5 | ATP synthase subunit a | 1.18e-07 | 3.56e-03 | 8.83e-05 | NA |
4. PB | B2V9G8 | ATP synthase subunit a | 7.54e-08 | 3.27e-04 | 2.14e-08 | NA |
4. PB | Q05364 | ATP synthase subunit a | 4.95e-08 | 4.69e-05 | 0.001 | NA |
4. PB | Q7VA58 | ATP synthase subunit a | 7.98e-07 | 1.80e-04 | 0.004 | NA |
4. PB | Q2Y8G6 | ATP synthase subunit a | 5.06e-07 | 1.15e-13 | 4.55e-07 | NA |
4. PB | B2J053 | ATP synthase subunit a | 2.66e-06 | 9.02e-03 | 5.78e-05 | NA |
4. PB | Q7V5S2 | ATP synthase subunit a | 5.19e-07 | 3.14e-05 | 0.016 | NA |
4. PB | Q1JHP0 | ATP synthase subunit a | 2.05e-07 | 2.40e-08 | 2.63e-04 | NA |
4. PB | Q7VG27 | ATP synthase subunit a | 7.14e-07 | 1.69e-05 | 1.87e-08 | NA |
4. PB | A8YY76 | ATP synthase subunit a | 8.25e-10 | 3.51e-06 | 5.24e-06 | NA |
4. PB | Q31RF6 | ATP synthase subunit a | 3.50e-08 | 1.94e-03 | 3.37e-05 | NA |
4. PB | Q72DL1 | ATP synthase subunit a | 7.98e-07 | 9.97e-03 | 4.40e-04 | NA |
4. PB | Q6AQ29 | ATP synthase subunit a | 2.91e-07 | 2.10e-03 | 2.29e-06 | NA |
4. PB | A1AMA7 | ATP synthase subunit a 2 | 1.28e-08 | 1.14e-06 | 0.002 | NA |
4. PB | A8EWC4 | ATP synthase subunit a | 2.69e-08 | 6.48e-04 | 2.46e-06 | NA |
4. PB | P27178 | ATP synthase subunit a | 1.17e-07 | 1.84e-02 | 9.49e-05 | NA |
4. PB | B2KEW6 | ATP synthase subunit a | 1.07e-07 | 6.23e-06 | 0.001 | NA |
4. PB | Q9TM31 | ATP synthase subunit a, chloroplastic | 2.81e-06 | 8.94e-03 | 8.71e-06 | NA |
4. PB | A7Z9Q6 | ATP synthase subunit a | 8.82e-07 | 2.58e-07 | 3.06e-05 | NA |
4. PB | A5EBW8 | ATP synthase subunit a 2 | 1.67e-07 | 4.86e-03 | 5.35e-05 | NA |
4. PB | B9DMF0 | ATP synthase subunit a | 2.47e-06 | 1.01e-05 | 5.06e-11 | NA |
4. PB | P63655 | ATP synthase subunit a | 2.89e-06 | 2.13e-02 | 0.002 | NA |
4. PB | Q6G7K1 | ATP synthase subunit a | 2.26e-08 | 3.51e-06 | 5.24e-06 | NA |
4. PB | Q2J6M7 | ATP synthase subunit a | 9.44e-07 | 9.31e-13 | 8.31e-04 | NA |
5. P | Q9TA24 | ATP synthase subunit a | 8.60e-08 | 7.10e-03 | NA | NA |
5. P | A8G1X1 | ATP synthase subunit a | 1.81e-07 | 3.74e-03 | NA | NA |
5. P | B5E676 | ATP synthase subunit a | 6.74e-10 | 1.70e-06 | NA | NA |
5. P | B3CLG3 | ATP synthase subunit a | 7.13e-06 | 1.87e-03 | NA | NA |
5. P | O47872 | ATP synthase subunit a | 1.59e-07 | 6.03e-06 | NA | NA |
5. P | A6U6M4 | ATP synthase subunit a | 2.74e-08 | 3.97e-07 | NA | NA |
5. P | Q95913 | ATP synthase subunit a | 2.99e-06 | 4.15e-04 | NA | NA |
5. P | O47426 | ATP synthase subunit a | 3.01e-07 | 2.98e-04 | NA | NA |
5. P | Q9ZZ62 | ATP synthase subunit a | 2.95e-06 | 6.51e-06 | NA | NA |
5. P | P14862 | ATP synthase subunit a | 3.51e-07 | 4.87e-04 | NA | NA |
5. P | Q65Q01 | ATP synthase subunit a | 1.08e-07 | 4.69e-05 | NA | NA |
5. P | Q9ZZY6 | ATP synthase subunit a | 2.95e-06 | 1.05e-04 | NA | NA |
5. P | P38591 | ATP synthase subunit a | 2.48e-06 | 1.99e-04 | NA | NA |
5. P | O05330 | ATP synthase subunit a | 4.14e-08 | 1.92e-08 | NA | NA |
5. P | P48878 | ATP synthase subunit a | 1.62e-06 | 5.14e-03 | NA | NA |
5. P | Q0I5W7 | ATP synthase subunit a | 3.71e-08 | 3.43e-03 | NA | NA |
5. P | Q6NBI2 | ATP synthase subunit a | 2.18e-08 | 5.29e-06 | NA | NA |
5. P | P26853 | ATP synthase subunit a | 2.29e-07 | 5.32e-04 | NA | NA |
5. P | Q37708 | ATP synthase subunit a | 2.31e-07 | 1.07e-04 | NA | NA |
5. P | A3DAS0 | ATP synthase subunit a | 5.72e-08 | 7.59e-04 | NA | NA |
5. P | B3H2P9 | ATP synthase subunit a | 5.56e-08 | 9.54e-06 | NA | NA |
5. P | A7HQY7 | ATP synthase subunit a | 3.34e-08 | 3.61e-05 | NA | NA |
5. P | P0A2Y8 | ATP synthase subunit a | 2.65e-09 | 1.03e-06 | NA | NA |
5. P | Q35920 | ATP synthase subunit a | 3.98e-06 | 2.47e-03 | NA | NA |
5. P | Q5NPR9 | ATP synthase subunit a | 1.79e-06 | 9.84e-07 | NA | NA |
5. P | P48893 | ATP synthase subunit a | 4.77e-07 | 1.47e-03 | NA | NA |
5. P | A9M8F8 | ATP synthase subunit a | 6.58e-09 | 5.33e-08 | NA | NA |
5. P | Q1HKB1 | ATP synthase subunit a | 3.00e-06 | 6.51e-06 | NA | NA |
5. P | B0BRX8 | ATP synthase subunit a | 4.96e-08 | 8.56e-06 | NA | NA |
5. P | C5D9M1 | ATP synthase subunit a | 2.73e-08 | 2.19e-05 | NA | NA |
5. P | A3QJR6 | ATP synthase subunit a | 1.32e-07 | 8.61e-03 | NA | NA |
5. P | Q12HP5 | ATP synthase subunit a | 1.40e-07 | 8.00e-03 | NA | NA |
5. P | B2G685 | ATP synthase subunit a | 5.28e-07 | 4.07e-04 | NA | NA |
5. P | P24888 | ATP synthase subunit a | 4.71e-06 | 2.59e-03 | NA | NA |
5. P | A4Z2B4 | ATP synthase subunit a | 9.34e-09 | 2.61e-07 | NA | NA |
5. P | B7GMF9 | ATP synthase subunit a | 6.32e-10 | 1.05e-05 | NA | NA |
5. P | O21004 | ATP synthase subunit a | 1.68e-06 | 1.02e-03 | NA | NA |
5. P | A5F473 | ATP synthase subunit a | 1.09e-07 | 3.20e-02 | NA | NA |
5. P | B0CK70 | ATP synthase subunit a | 1.34e-08 | 5.33e-08 | NA | NA |
5. P | A1URU2 | ATP synthase subunit a | 6.25e-09 | 8.51e-05 | NA | NA |
5. P | P48879 | ATP synthase subunit a | 2.57e-07 | 1.04e-04 | NA | NA |
5. P | Q49Z56 | ATP synthase subunit a | 1.01e-06 | 3.30e-07 | NA | NA |
5. P | Q15MT8 | ATP synthase subunit a | 1.20e-07 | 4.09e-02 | NA | NA |
5. P | Q9ZZ49 | ATP synthase subunit a | 3.47e-06 | 4.41e-04 | NA | NA |
5. P | C0RH93 | ATP synthase subunit a | 9.14e-09 | 5.33e-08 | NA | NA |
5. P | Q4FPE9 | ATP synthase subunit a | 4.19e-06 | 4.28e-04 | NA | NA |
5. P | P95784 | ATP synthase subunit a | 9.66e-08 | 9.36e-08 | NA | NA |
5. P | A6VL63 | ATP synthase subunit a | 3.21e-08 | 2.17e-05 | NA | NA |
5. P | Q7MGH4 | ATP synthase subunit a | 1.62e-07 | 4.46e-02 | NA | NA |
5. P | P00850 | ATP synthase subunit a | 5.55e-07 | 3.03e-02 | NA | NA |
5. P | P34191 | ATP synthase subunit a | 3.08e-06 | 1.60e-03 | NA | NA |
5. P | Q8HEC5 | ATP synthase subunit a | 3.52e-06 | 3.43e-03 | NA | NA |
5. P | A9FGS5 | ATP synthase subunit a | 2.06e-07 | 1.24e-03 | NA | NA |
5. P | Q36918 | ATP synthase subunit a | 3.80e-07 | 6.42e-04 | NA | NA |
5. P | Q0C0X3 | ATP synthase subunit a | 1.88e-06 | 4.46e-07 | NA | NA |
5. P | Q3K1K0 | ATP synthase subunit a | 6.59e-10 | 3.88e-05 | NA | NA |
5. P | Q48AW6 | ATP synthase subunit a | 6.06e-08 | 1.19e-03 | NA | NA |
5. P | Q6LLG2 | ATP synthase subunit a 1 | 1.63e-07 | 2.11e-02 | NA | NA |
5. P | C3MHB5 | ATP synthase subunit a | 4.44e-07 | 5.08e-08 | NA | NA |
5. P | Q7VPP6 | ATP synthase subunit a | 2.73e-08 | 1.61e-04 | NA | NA |
5. P | B9E8F1 | ATP synthase subunit a | 1.89e-08 | 2.12e-04 | NA | NA |
5. P | A0JY70 | ATP synthase subunit a | 7.05e-08 | 1.95e-07 | NA | NA |
5. P | Q03EK8 | ATP synthase subunit a | 3.15e-07 | 1.41e-04 | NA | NA |
5. P | Q5JCK5 | ATP synthase subunit a | 4.42e-06 | 1.48e-03 | NA | NA |
5. P | Q36454 | ATP synthase subunit a | 2.89e-06 | 1.30e-02 | NA | NA |
5. P | Q3SW35 | ATP synthase subunit a | 1.62e-08 | 8.68e-07 | NA | NA |
5. P | O79551 | ATP synthase subunit a | 2.55e-06 | 2.25e-04 | NA | NA |
5. P | P37212 | ATP synthase subunit a | 4.82e-07 | 4.59e-04 | NA | NA |
5. P | Q04654 | ATP synthase subunit a | 8.49e-08 | 5.00e-02 | NA | NA |
5. P | P14092 | ATP synthase subunit a | 3.56e-06 | 3.67e-03 | NA | NA |
5. P | C4K0P3 | ATP synthase subunit a | 2.49e-06 | 1.39e-05 | NA | NA |
5. P | B9JSF9 | ATP synthase subunit a | 8.27e-09 | 1.18e-06 | NA | NA |
5. P | A5UA05 | ATP synthase subunit a | 3.58e-08 | 1.77e-05 | NA | NA |
5. P | Q2KU30 | ATP synthase subunit a | 1.26e-07 | 1.86e-02 | NA | NA |
5. P | Q34946 | ATP synthase subunit a | 9.14e-07 | 6.10e-05 | NA | NA |
5. P | O47494 | ATP synthase subunit a | 1.01e-07 | 2.77e-05 | NA | NA |
5. P | A1SBU6 | ATP synthase subunit a | 1.09e-07 | 9.14e-04 | NA | NA |
5. P | A0L2T4 | ATP synthase subunit a | 1.64e-07 | 1.03e-02 | NA | NA |
5. P | C1CSD3 | ATP synthase subunit a | 6.32e-10 | 1.03e-06 | NA | NA |
5. P | P00846 | ATP synthase subunit a | 3.52e-06 | 1.22e-04 | NA | NA |
5. P | Q9ZEC1 | ATP synthase subunit a | 2.18e-06 | 8.21e-04 | NA | NA |
5. P | B5ZS16 | ATP synthase subunit a | 1.64e-08 | 4.29e-08 | NA | NA |
5. P | B1KQ40 | ATP synthase subunit a | 6.34e-08 | 1.78e-03 | NA | NA |
5. P | Q986D4 | ATP synthase subunit a | 3.68e-09 | 2.35e-06 | NA | NA |
5. P | P50363 | ATP synthase subunit a | 5.72e-09 | 1.01e-04 | NA | NA |
5. P | P25005 | ATP synthase subunit a | 1.24e-06 | 1.12e-02 | NA | NA |
5. P | Q8E8B4 | ATP synthase subunit a | 1.59e-07 | 1.10e-02 | NA | NA |
5. P | P24946 | ATP synthase subunit a | 3.71e-06 | 2.23e-02 | NA | NA |
5. P | Q9EVN2 | Ion-translocating oxidoreductase complex subunit E | 5.54e-04 | 1.01e-02 | NA | NA |
5. P | Q8E077 | ATP synthase subunit a | 1.35e-09 | 3.88e-05 | NA | NA |
5. P | Q11KH9 | ATP synthase subunit a | 7.87e-09 | 1.83e-06 | NA | NA |
5. P | Q37385 | ATP synthase subunit a | 4.00e-08 | 1.06e-05 | NA | NA |
5. P | P07925 | ATP synthase subunit a | 1.30e-11 | 1.69e-02 | NA | NA |
5. P | P48662 | ATP synthase subunit a | 3.09e-06 | 1.73e-04 | NA | NA |
5. P | P15994 | ATP synthase subunit a | 6.19e-07 | 6.55e-04 | NA | NA |
5. P | Q4UNH7 | ATP synthase subunit a | 2.39e-06 | 6.23e-05 | NA | NA |
5. P | Q9ZXX9 | ATP synthase subunit a | 2.53e-06 | 3.28e-02 | NA | NA |
5. P | Q73HW3 | ATP synthase subunit a | 8.56e-07 | 1.09e-04 | NA | NA |
5. P | P84628 | Hdr-like menaquinol oxidoreductase cytochrome b-like subunit | 2.68e-03 | 2.59e-03 | NA | NA |
5. P | Q38PR7 | ATP synthase subunit a | 5.85e-07 | 2.01e-04 | NA | NA |
5. P | P50364 | ATP synthase subunit a | 3.90e-08 | 1.56e-04 | NA | NA |
5. P | Q9T9Y7 | ATP synthase subunit a | 3.43e-06 | 3.18e-05 | NA | NA |
5. P | B8EDV6 | ATP synthase subunit a | 7.78e-08 | 7.59e-04 | NA | NA |
5. P | Q5HMB3 | ATP synthase subunit a | 9.08e-08 | 1.17e-05 | NA | NA |
5. P | P00852 | ATP synthase subunit a | 4.68e-07 | 7.93e-03 | NA | NA |
5. P | Q2GIS5 | ATP synthase subunit a | 1.24e-14 | 2.14e-04 | NA | NA |
5. P | A8GUJ3 | ATP synthase subunit a | 1.20e-06 | 4.28e-04 | NA | NA |
5. P | Q1MKT2 | ATP synthase subunit a | 3.38e-08 | 5.12e-09 | NA | NA |
5. P | B1HM50 | ATP synthase subunit a | 5.19e-08 | 2.69e-06 | NA | NA |
5. P | P48894 | ATP synthase subunit a | 2.72e-06 | 6.88e-04 | NA | NA |
5. P | P57118 | ATP synthase subunit a | 8.07e-09 | 2.63e-02 | NA | NA |
5. P | C1A1Y4 | ATP synthase subunit a | 3.24e-07 | 4.23e-04 | NA | NA |
5. P | P33507 | ATP synthase subunit a | 4.61e-06 | 1.21e-02 | NA | NA |
5. P | Q2N9P2 | ATP synthase subunit a | 6.33e-07 | 5.10e-05 | NA | NA |
5. P | A6X1X3 | ATP synthase subunit a 2 | 1.45e-09 | 2.22e-06 | NA | NA |
5. P | C0R5U3 | ATP synthase subunit a | 8.18e-07 | 2.73e-04 | NA | NA |
5. P | Q57EY0 | ATP synthase subunit a | 1.15e-08 | 5.33e-08 | NA | NA |
5. P | Q8LX27 | ATP synthase subunit a | 3.26e-06 | 3.95e-04 | NA | NA |
5. P | Q8YFH6 | ATP synthase subunit a | 1.16e-07 | 5.33e-08 | NA | NA |
5. P | P14569 | ATP synthase subunit a | 4.82e-06 | 3.67e-03 | NA | NA |
5. P | B2GAT9 | ATP synthase subunit a | 2.02e-09 | 2.08e-05 | NA | NA |
5. P | O03200 | ATP synthase subunit a | 2.49e-06 | 8.25e-05 | NA | NA |
5. P | Q9T9W0 | ATP synthase subunit a | 2.51e-06 | 1.57e-05 | NA | NA |
5. P | P50012 | ATP synthase subunit a | 1.18e-06 | 6.72e-03 | NA | NA |
5. P | A7IGT0 | ATP synthase subunit a | 7.75e-09 | 1.77e-08 | NA | NA |
5. P | A8FIB8 | ATP synthase subunit a | 4.06e-07 | 1.48e-06 | NA | NA |
5. P | Q03671 | ATP synthase subunit a | 1.61e-06 | 6.48e-04 | NA | NA |
5. P | A8HT64 | ATP synthase subunit a | 7.15e-09 | 6.53e-10 | NA | NA |
5. P | A8EX90 | ATP synthase subunit a | 1.89e-06 | 8.13e-04 | NA | NA |
5. P | Q35915 | ATP synthase subunit a | 3.96e-06 | 3.43e-04 | NA | NA |
5. P | P41013 | ATP synthase subunit a | 1.96e-07 | 2.25e-04 | NA | NA |
5. P | P24876 | ATP synthase subunit a | 2.49e-06 | 4.55e-03 | NA | NA |
5. P | Q1AVH3 | ATP synthase subunit a | 5.95e-07 | 2.75e-06 | NA | NA |
5. P | Q8CNJ1 | ATP synthase subunit a | 5.20e-08 | 1.17e-05 | NA | NA |
5. P | B8CVV1 | ATP synthase subunit a | 4.98e-08 | 2.06e-03 | NA | NA |
5. P | Q67TC3 | ATP synthase subunit a | 3.79e-06 | 3.39e-06 | NA | NA |
5. P | P48178 | ATP synthase subunit a | 1.69e-05 | 1.96e-03 | NA | NA |
5. P | A9HDN1 | ATP synthase subunit a | 4.09e-09 | 1.84e-04 | NA | NA |
5. P | A3CM09 | ATP synthase subunit a | 3.22e-09 | 1.56e-07 | NA | NA |
5. P | Q4JQI2 | ATP synthase subunit a | 3.32e-06 | 3.08e-04 | NA | NA |
5. P | Q0HPF5 | ATP synthase subunit a | 1.60e-07 | 1.12e-02 | NA | NA |
5. P | O78684 | ATP synthase subunit a | 4.16e-06 | 1.56e-03 | NA | NA |
5. P | Q27559 | ATP synthase subunit a | 2.65e-07 | 4.23e-04 | NA | NA |
5. P | Q6G5L2 | ATP synthase subunit a | 5.49e-07 | 1.66e-06 | NA | NA |
5. P | P41313 | ATP synthase subunit a | 3.10e-06 | 9.27e-03 | NA | NA |
5. P | A9IQH9 | ATP synthase subunit a | 6.80e-07 | 9.09e-07 | NA | NA |
5. P | B0BVU2 | ATP synthase subunit a | 2.12e-06 | 4.60e-05 | NA | NA |
5. P | Q37601 | ATP synthase subunit a | 4.18e-08 | 1.93e-04 | NA | NA |
5. P | Q04HT4 | ATP synthase subunit a | 8.22e-10 | 1.03e-06 | NA | NA |
5. P | Q2KBW1 | ATP synthase subunit a | 2.71e-07 | 5.02e-08 | NA | NA |
5. P | Q8DDH4 | ATP synthase subunit a | 1.40e-06 | 4.46e-02 | NA | NA |
5. P | Q2LCR6 | ATP synthase subunit a | 1.01e-06 | 1.24e-03 | NA | NA |
5. P | Q36258 | ATP synthase subunit a | 3.14e-06 | 2.16e-03 | NA | NA |
5. P | C4LDW6 | ATP synthase subunit a | 4.28e-08 | 4.41e-04 | NA | NA |
5. P | Q96064 | ATP synthase subunit a | 2.56e-06 | 3.28e-03 | NA | NA |
5. P | Q8G2E1 | ATP synthase subunit a | 1.35e-08 | 5.33e-08 | NA | NA |
5. P | O99821 | ATP synthase subunit a | 5.52e-07 | 2.33e-02 | NA | NA |
5. P | B3QF37 | ATP synthase subunit a | 2.04e-08 | 5.29e-06 | NA | NA |
5. P | A3N2V0 | ATP synthase subunit a | 5.69e-08 | 5.96e-06 | NA | NA |
5. P | A8L3V9 | ATP synthase subunit a | 1.53e-07 | 2.11e-07 | NA | NA |
5. P | Q00275 | ATP synthase subunit a | 9.35e-07 | 1.32e-03 | NA | NA |
5. P | Q1HRS5 | ATP synthase subunit a | 4.97e-07 | 1.57e-02 | NA | NA |
5. P | A8AYG6 | ATP synthase subunit a | 3.84e-09 | 1.34e-05 | NA | NA |
5. P | B6EGH2 | Ion-translocating oxidoreductase complex subunit E | 6.99e-04 | 4.50e-02 | NA | NA |
5. P | P37813 | ATP synthase subunit a | 2.20e-07 | 6.66e-06 | NA | NA |
5. P | B5FCZ7 | ATP synthase subunit a | 8.19e-08 | 4.91e-02 | NA | NA |
5. P | B2S9M8 | ATP synthase subunit a | 1.11e-08 | 5.33e-08 | NA | NA |
5. P | P00848 | ATP synthase subunit a | 2.59e-06 | 1.13e-02 | NA | NA |
5. P | P21535 | ATP synthase subunit a | 1.03e-05 | 1.69e-04 | NA | NA |
5. P | P14413 | ATP synthase subunit a | 2.94e-06 | 5.65e-04 | NA | NA |
5. P | C1CLL1 | ATP synthase subunit a | 6.02e-09 | 1.03e-06 | NA | NA |
5. P | B2IQX5 | ATP synthase subunit a | 4.22e-09 | 1.03e-06 | NA | NA |
5. P | Q9B8D4 | ATP synthase subunit a | 1.53e-06 | 3.09e-03 | NA | NA |
5. P | P00849 | ATP synthase subunit a | 1.13e-05 | 9.05e-04 | NA | NA |
5. P | Q36964 | ATP synthase subunit a (Fragment) | 7.00e-07 | 2.06e-03 | NA | NA |
5. P | Q68XQ1 | ATP synthase subunit a | 2.29e-06 | 1.50e-04 | NA | NA |
5. P | A5VNW2 | ATP synthase subunit a | 3.48e-08 | 3.25e-08 | NA | NA |
5. P | Q4L7Z0 | ATP synthase subunit a | 2.98e-10 | 8.84e-06 | NA | NA |
5. P | Q36835 | ATP synthase subunit a | 2.95e-06 | 1.73e-04 | NA | NA |
5. P | Q1RGZ3 | ATP synthase subunit a | 1.64e-05 | 5.22e-04 | NA | NA |
5. P | O21402 | ATP synthase subunit a | 4.06e-06 | 1.66e-02 | NA | NA |
5. P | Q00224 | ATP synthase subunit a | 9.72e-08 | 4.87e-02 | NA | NA |
5. P | Q92JP0 | ATP synthase subunit a | 2.56e-06 | 6.29e-05 | NA | NA |
5. P | B9JA28 | ATP synthase subunit a | 3.55e-08 | 8.51e-08 | NA | NA |
5. P | B2IGL1 | ATP synthase subunit a | 1.17e-07 | 2.90e-07 | NA | NA |
5. P | P92480 | ATP synthase subunit a | 2.64e-06 | 6.17e-04 | NA | NA |
5. P | Q85Q99 | ATP synthase subunit a | 1.61e-06 | 9.69e-04 | NA | NA |
5. P | Q35538 | ATP synthase subunit a | 4.68e-07 | 1.26e-06 | NA | NA |
5. P | B8ZLB4 | ATP synthase subunit a | 9.83e-11 | 1.03e-06 | NA | NA |
5. P | O78752 | ATP synthase subunit a | 3.27e-06 | 8.45e-04 | NA | NA |
5. P | Q00521 | ATP synthase subunit a | 2.55e-06 | 5.00e-05 | NA | NA |
5. P | O79432 | ATP synthase subunit a | 1.96e-06 | 1.73e-03 | NA | NA |
5. P | P0AF33 | Respiratory nitrate reductase 2 gamma chain | 1.92e-03 | 4.23e-02 | NA | NA |
5. P | Q02B01 | ATP synthase subunit a | 9.59e-07 | 1.60e-05 | NA | NA |
5. P | A8GQF6 | ATP synthase subunit a | 2.19e-06 | 4.60e-05 | NA | NA |
5. P | Q8E5V3 | ATP synthase subunit a | 7.72e-10 | 4.05e-05 | NA | NA |
5. P | P55778 | ATP synthase subunit a | 4.36e-06 | 3.20e-04 | NA | NA |
5. P | P00854 | ATP synthase subunit a | 3.88e-07 | 2.62e-05 | NA | NA |
5. P | P92664 | ATP synthase subunit a | 2.27e-06 | 1.19e-03 | NA | NA |
5. P | Q0HD73 | ATP synthase subunit a | 1.63e-07 | 1.12e-02 | NA | NA |
5. P | O63912 | ATP synthase subunit a | 1.05e-06 | 1.32e-05 | NA | NA |
5. P | C1C8A4 | ATP synthase subunit a | 1.18e-09 | 9.96e-07 | NA | NA |
5. P | C3PM51 | ATP synthase subunit a | 2.41e-06 | 3.72e-05 | NA | NA |
5. P | Q32644 | ATP synthase subunit a | 3.07e-06 | 2.54e-03 | NA | NA |
5. P | Q2YM92 | ATP synthase subunit a | 9.80e-09 | 5.33e-08 | NA | NA |
5. P | Q1QRH8 | ATP synthase subunit a | 3.62e-09 | 9.81e-08 | NA | NA |
5. P | Q94UY0 | ATP synthase subunit a | 2.39e-06 | 8.30e-03 | NA | NA |
5. P | B8HAZ5 | ATP synthase subunit a | 1.17e-07 | 3.97e-07 | NA | NA |
5. P | Q3T4C2 | ATP synthase subunit a | 3.44e-07 | 7.93e-06 | NA | NA |
5. P | Q6LL02 | ATP synthase subunit a 2 | 2.69e-08 | 1.89e-03 | NA | NA |
5. P | Q31720 | ATP synthase subunit a | 3.65e-08 | 1.10e-04 | NA | NA |
5. P | O03169 | ATP synthase subunit a | 1.15e-05 | 2.74e-05 | NA | NA |
5. P | A5EAB4 | ATP synthase subunit a 1 | 9.07e-09 | 9.84e-07 | NA | NA |
5. P | A0LDW6 | ATP synthase subunit a | 2.09e-10 | 4.07e-04 | NA | NA |
5. P | Q5QZI0 | ATP synthase subunit a | 2.31e-09 | 4.96e-04 | NA | NA |
5. P | Q5WB72 | ATP synthase subunit a | 6.62e-07 | 2.03e-05 | NA | NA |
5. P | Q7YCA5 | ATP synthase subunit a | 2.70e-06 | 7.30e-04 | NA | NA |
5. P | Q92RM8 | ATP synthase subunit a | 2.41e-08 | 5.08e-08 | NA | NA |
5. P | P75125 | Uncharacterized protein MG452 homolog | 7.65e-04 | 1.59e-03 | NA | NA |
5. P | C0HK57 | ATP synthase subunit a | 3.08e-07 | 4.18e-03 | NA | NA |
5. P | P15995 | ATP synthase subunit a | 1.13e-07 | 2.18e-03 | NA | NA |
5. P | P50681 | ATP synthase subunit a | 3.82e-06 | 1.98e-02 | NA | NA |
5. P | Q75G39 | ATP synthase subunit a | 6.07e-06 | 1.66e-05 | NA | NA |
5. P | A5VIQ5 | ATP synthase subunit a | 1.15e-09 | 4.07e-04 | NA | NA |
5. P | P43719 | ATP synthase subunit a | 8.35e-09 | 7.28e-05 | NA | NA |
5. P | Q89V68 | ATP synthase subunit a | 1.35e-08 | 1.60e-06 | NA | NA |
5. P | Q9MIY5 | ATP synthase subunit a | 1.57e-06 | 8.79e-04 | NA | NA |
5. P | Q95A26 | ATP synthase subunit a | 2.49e-06 | 2.59e-03 | NA | NA |
5. P | A8LKI0 | ATP synthase subunit a | 2.77e-07 | 2.98e-05 | NA | NA |
5. P | A9CK03 | ATP synthase subunit a | 5.01e-09 | 2.74e-07 | NA | NA |
5. P | O21330 | ATP synthase subunit a | 1.49e-07 | 1.95e-02 | NA | NA |
5. P | Q2I3G9 | ATP synthase subunit a | 4.36e-07 | 6.74e-04 | NA | NA |
5. P | Q8W9N1 | ATP synthase subunit a | 2.42e-06 | 1.08e-03 | NA | NA |
5. P | P34834 | ATP synthase subunit a | 4.94e-06 | 1.63e-02 | NA | NA |
5. P | A8F0C9 | ATP synthase subunit a | 2.36e-06 | 1.84e-04 | NA | NA |
5. P | O79406 | ATP synthase subunit a | 2.75e-06 | 4.81e-03 | NA | NA |
5. P | P22476 | ATP synthase subunit a | 3.29e-09 | 3.47e-04 | NA | NA |
5. P | A6WW77 | ATP synthase subunit a 1 | 4.38e-09 | 2.98e-09 | NA | NA |
5. P | Q8W9G8 | ATP synthase subunit a | 3.07e-06 | 1.69e-02 | NA | NA |
5. P | A8GLV8 | ATP synthase subunit a | 2.45e-06 | 6.49e-05 | NA | NA |
5. P | P41291 | ATP synthase subunit a | 1.95e-07 | 1.48e-03 | NA | NA |
5. P | O29749 | Hdr-like menaquinol oxidoreductase cytochrome b-like subunit | 4.79e-03 | 2.80e-02 | NA | NA |
5. P | O79675 | ATP synthase subunit a | 4.07e-06 | 3.01e-03 | NA | NA |
5. P | P92695 | ATP synthase subunit a | 2.65e-06 | 7.08e-04 | NA | NA |
5. P | Q0A4M2 | ATP synthase subunit a | 4.95e-07 | 2.61e-03 | NA | NA |
5. P | A9HY34 | ATP synthase subunit a | 1.10e-07 | 2.66e-02 | NA | NA |
5. P | A9RAH2 | ATP synthase subunit a | 6.71e-06 | 6.61e-04 | NA | NA |
5. P | A1R7V8 | ATP synthase subunit a | 1.19e-06 | 4.19e-08 | NA | NA |
5. P | P24945 | ATP synthase subunit a | 1.22e-06 | 1.06e-03 | NA | NA |
5. P | Q6G0H3 | ATP synthase subunit a | 6.75e-07 | 1.77e-06 | NA | NA |
5. P | P25149 | Uncharacterized protein YwaF | 4.66e-04 | 8.46e-03 | NA | NA |
5. P | B0UWH1 | ATP synthase subunit a | 1.17e-07 | 2.76e-03 | NA | NA |
5. P | Q9B6H6 | ATP synthase subunit a | 9.12e-05 | 3.17e-02 | NA | NA |
5. P | Q20WZ8 | ATP synthase subunit a | 3.93e-08 | 9.51e-07 | NA | NA |
5. P | P0AF32 | Respiratory nitrate reductase 2 gamma chain | 1.92e-03 | 4.23e-02 | NA | NA |
5. P | P0A2Y9 | ATP synthase subunit a | 3.70e-11 | 1.03e-06 | NA | NA |
5. P | Q07H86 | ATP synthase subunit a | 1.81e-08 | 8.56e-06 | NA | NA |
5. P | A1SHI5 | ATP synthase subunit a | 2.38e-07 | 2.20e-04 | NA | NA |
5. P | P05504 | ATP synthase subunit a | 3.77e-06 | 7.30e-03 | NA | NA |
5. P | P12696 | ATP synthase subunit a | 2.53e-07 | 8.45e-04 | NA | NA |
5. P | A6H4Q8 | ATP synthase subunit a | 4.23e-06 | 1.84e-04 | NA | NA |
5. P | B6JDD0 | ATP synthase subunit a | 1.33e-09 | 6.10e-05 | NA | NA |
5. P | Q9T9W9 | ATP synthase subunit a | 3.38e-06 | 2.01e-05 | NA | NA |
5. P | Q33823 | ATP synthase subunit a | 8.55e-07 | 3.91e-04 | NA | NA |
5. P | Q8LTZ5 | ATP synthase subunit a | 3.43e-06 | 4.60e-05 | NA | NA |
5. P | P11350 | Respiratory nitrate reductase 1 gamma chain | 1.29e-03 | 1.25e-02 | NA | NA |
5. P | P00847 | ATP synthase subunit a | 1.20e-06 | 3.70e-03 | NA | NA |
5. P | B3PRF6 | ATP synthase subunit a | 4.33e-08 | 9.47e-08 | NA | NA |
6. F | Q88BW8 | ATP synthase subunit a | 1.35e-08 | NA | NA | 0.4826 |
6. F | Q3B141 | ATP synthase subunit a 2 | 1.51e-08 | NA | NA | 0.5947 |
6. F | Q02DE8 | ATP synthase subunit a | 5.39e-08 | NA | NA | 0.478 |
6. F | B4S6E6 | ATP synthase subunit a 2 | 5.75e-09 | NA | NA | 0.5896 |
6. F | Q1I2I1 | ATP synthase subunit a | 1.32e-07 | NA | NA | 0.4866 |
6. F | Q9HT14 | ATP synthase subunit a | 5.21e-08 | NA | NA | 0.4851 |
6. F | A7N0Y8 | ATP synthase subunit a 1 | 2.38e-07 | NA | NA | 0.5282 |
6. F | A1WZT7 | ATP synthase subunit a | 1.09e-07 | NA | NA | 0.5543 |
6. F | Q7NCR8 | ATP synthase subunit a | 4.11e-07 | NA | NA | 0.5764 |
6. F | A6VF38 | ATP synthase subunit a | 4.17e-08 | NA | NA | 0.5035 |
6. F | B7V797 | ATP synthase subunit a | 5.25e-08 | NA | NA | 0.4915 |
6. F | B4SH40 | ATP synthase subunit a | 2.15e-07 | NA | NA | 0.5995 |
6. F | P12984 | ATP synthase subunit a | 1.84e-07 | NA | NA | 0.5314 |
7. B | B1WUH7 | ATP synthase subunit a 2 | 9.81e-07 | NA | 4.36e-04 | NA |
7. B | A0A323 | ATP synthase subunit a, chloroplastic | 6.32e-07 | NA | 3.62e-05 | NA |
7. B | A8A6K1 | ATP synthase subunit a | 3.29e-08 | NA | 0.005 | NA |
7. B | B1X9W6 | ATP synthase subunit a | 3.04e-06 | NA | 0.005 | NA |
7. B | A5GV77 | ATP synthase subunit a | 7.38e-08 | NA | 2.53e-04 | NA |
7. B | A1JTD4 | ATP synthase subunit a | 4.50e-07 | NA | 0.011 | NA |
7. B | P06289 | ATP synthase subunit a, chloroplastic | 1.47e-06 | NA | 6.57e-06 | NA |
7. B | B5YXE2 | ATP synthase subunit a | 2.60e-07 | NA | 0.005 | NA |
7. B | B7M594 | ATP synthase subunit a | 1.01e-07 | NA | 0.005 | NA |
7. B | O63075 | ATP synthase subunit a, chloroplastic | 9.02e-07 | NA | 4.60e-07 | NA |
7. B | B0JWU6 | ATP synthase subunit a | 8.86e-08 | NA | 2.68e-05 | NA |
7. B | B1VKH7 | ATP synthase subunit a, chloroplastic | 4.65e-07 | NA | 0.006 | NA |
7. B | B2HQK8 | ATP synthase subunit a | 5.87e-08 | NA | 0.015 | NA |
7. B | A5GND3 | ATP synthase subunit a | 1.18e-06 | NA | 5.84e-04 | NA |
7. B | Q6EW60 | ATP synthase subunit a, chloroplastic | 7.47e-07 | NA | 8.53e-04 | NA |
7. B | Q06SI1 | ATP synthase subunit a, chloroplastic | 1.42e-07 | NA | 1.23e-06 | NA |
7. B | A9R5U5 | ATP synthase subunit a | 2.00e-07 | NA | 0.021 | NA |
7. B | B6I3X5 | ATP synthase subunit a | 1.40e-07 | NA | 0.005 | NA |
7. B | Q1XDP0 | ATP synthase subunit a, chloroplastic | 4.74e-07 | NA | 4.13e-06 | NA |
7. B | Q0SYT8 | ATP synthase subunit a | 1.96e-07 | NA | 0.005 | NA |
7. B | Q85X66 | ATP synthase subunit a, chloroplastic | 8.57e-07 | NA | 4.17e-04 | NA |
7. B | Q02847 | ATP synthase subunit a, chloroplastic | 2.13e-07 | NA | 0.009 | NA |
7. B | Q20EV6 | ATP synthase subunit a, chloroplastic | 4.88e-07 | NA | 2.08e-06 | NA |
7. B | O78480 | ATP synthase subunit a, chloroplastic | 6.74e-07 | NA | 9.97e-06 | NA |
7. B | Q3YVP2 | ATP synthase subunit a | 1.45e-07 | NA | 0.005 | NA |
7. B | B1IX00 | ATP synthase subunit a | 2.64e-07 | NA | 0.005 | NA |
7. B | B2Y1V9 | ATP synthase subunit a, chloroplastic | 9.13e-08 | NA | 4.21e-04 | NA |
7. B | P17344 | ATP synthase subunit a, chloroplastic | 1.72e-07 | NA | 1.87e-04 | NA |
7. B | P51247 | ATP synthase subunit a, chloroplastic | 1.35e-06 | NA | 2.17e-06 | NA |
7. B | Q8MA08 | ATP synthase subunit a, chloroplastic | 1.87e-07 | NA | 0.001 | NA |
7. B | Q112Z1 | ATP synthase subunit a | 2.11e-07 | NA | 3.83e-06 | NA |
7. B | Q40607 | ATP synthase subunit a, chloroplastic | 5.22e-07 | NA | 4.97e-07 | NA |
7. B | B7L888 | ATP synthase subunit a | 6.66e-08 | NA | 0.005 | NA |
7. B | A7ZTV0 | ATP synthase subunit a | 3.60e-08 | NA | 0.005 | NA |
7. B | B5EFG8 | ATP synthase subunit a | 1.63e-07 | NA | 5.17e-07 | NA |
7. B | A0PUK6 | ATP synthase subunit a | 4.09e-06 | NA | 0.003 | NA |
7. B | Q2IHP4 | ATP synthase subunit a | 1.13e-05 | NA | 0.028 | NA |
7. B | Q8WI28 | ATP synthase subunit a, chloroplastic | 8.11e-08 | NA | 2.00e-06 | NA |
7. B | B3QZE8 | ATP synthase subunit a | 6.85e-08 | NA | 0.008 | NA |
7. B | Q2MIJ9 | ATP synthase subunit a, chloroplastic | 5.88e-07 | NA | 1.92e-04 | NA |
7. B | Q9MUS9 | ATP synthase subunit a, chloroplastic | 1.30e-07 | NA | 2.70e-06 | NA |
7. B | B0BZK7 | ATP synthase subunit a 1 | 4.45e-07 | NA | 2.09e-06 | NA |
7. B | Q85AE6 | ATP synthase subunit a, chloroplastic | 4.48e-07 | NA | 0.004 | NA |
7. B | Q663Q2 | ATP synthase subunit a | 2.57e-07 | NA | 0.010 | NA |
7. B | B4F0E1 | ATP synthase subunit a | 4.15e-07 | NA | 0.009 | NA |
7. B | P30391 | ATP synthase subunit a, chloroplastic | 6.63e-07 | NA | 2.12e-06 | NA |
7. B | P56758 | ATP synthase subunit a, chloroplastic | 4.77e-07 | NA | 2.37e-05 | NA |
7. B | Q32RY0 | ATP synthase subunit a, chloroplastic | 9.27e-07 | NA | 1.02e-04 | NA |
7. B | Q00825 | ATP synthase subunit a, chloroplastic | 6.64e-08 | NA | 5.97e-06 | NA |
7. B | Q85FN1 | ATP synthase subunit a, chloroplastic | 1.14e-07 | NA | 0.016 | NA |
7. B | A4QJA3 | ATP synthase subunit a, chloroplastic | 1.07e-06 | NA | 1.97e-05 | NA |
7. B | P41604 | ATP synthase subunit a, chloroplastic | 9.80e-07 | NA | 0.001 | NA |
7. B | A6H5F5 | ATP synthase subunit a, chloroplastic | 7.17e-07 | NA | 0.008 | NA |
7. B | Q494C9 | ATP synthase subunit a | 1.84e-07 | NA | 0.007 | NA |
7. B | Q4FGF6 | ATP synthase subunit a, chloroplastic | 1.63e-07 | NA | 5.50e-04 | NA |
7. B | Q1KVW8 | ATP synthase subunit a, chloroplastic | 2.01e-07 | NA | 6.83e-07 | NA |
7. B | P0AB99 | ATP synthase subunit a | 1.52e-07 | NA | 0.005 | NA |
7. B | C4ZZ16 | ATP synthase subunit a | 8.22e-08 | NA | 0.005 | NA |
7. B | P45829 | ATP synthase subunit a | 2.81e-06 | NA | 0.002 | NA |
7. B | A2T320 | ATP synthase subunit a, chloroplastic | 1.11e-07 | NA | 5.72e-06 | NA |
7. B | A6MVW9 | ATP synthase subunit a, chloroplastic | 7.68e-07 | NA | 4.97e-05 | NA |
7. B | Q3ZIZ6 | ATP synthase subunit a, chloroplastic | 1.25e-06 | NA | 2.69e-05 | NA |
7. B | Q70XU8 | ATP synthase subunit a, chloroplastic | 5.62e-07 | NA | 0.001 | NA |
7. B | Q1LTU8 | ATP synthase subunit a | 1.00e-07 | NA | 0.004 | NA |
7. B | C5BKK1 | ATP synthase subunit a | 5.56e-06 | NA | 0.022 | NA |
7. B | P0AB98 | ATP synthase subunit a | 1.52e-07 | NA | 0.005 | NA |