Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54967.1

JCVISYN3A_0798

Uracil phosphoribosyltransferase.
M. mycoides homolog: Q6MS86.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 72
Unique PROST Go: 30
Unique BLAST Go: 10
Unique Foldseek Go: 0

Total Homologs: 2257
Unique PROST Homologs: 1222
Unique BLAST Homologs: 14
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: upp; Uracil phosphoribosyltransferase
Zhang et al. [4]: GO:0006223|uracil salvage
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A7G9P8 (Uracil phosphoribosyltransferase) with a FATCAT P-Value: 0 and RMSD of 1.49 angstrom. The sequence alignment identity is 57.5%.
Structural alignment shown in left. Query protein AVX54967.1 colored as red in alignment, homolog A7G9P8 colored as blue. Query protein AVX54967.1 is also shown in right top, homolog A7G9P8 showed in right bottom. They are colored based on secondary structures.

  AVX54967.1 MA-FTEIKHPLIIDKLTRMRKTETSSKDFRENLNEIAQLMVYEIFRDLKLEPVEITTPVAKT-----TGYTINQPVVLVPILRAGIGMLDGIQKLIPTAR 94
      A7G9P8 MSKVTQIAHPLILHKLALIRDKNTGSKDFRELVEEVAMLMAYEVTRDLQLKEVEIETPICKTKCKMLSG----KKVAIVPILRAGLGMVGGMTSLIPAAK 96

  AVX54967.1 IAHVGLYRDEETLEIHQYFAKTTKDI-DKSYVIVVDPMLATGGSACKAIDIVKQWGAKEVKFVCLVAVEPGIKRLQEQHPDVEIYAASKDEKLNEKGYIV 193
      A7G9P8 VGHIGLYRDEETLKPVEYFCKLPQDIGDRD-VIVTDPMLATGGSAKDAITLLKQKGAKHIRLMCLVAAPEGIKEVMDEHPDVDIYVASVDEKLNEKGYVV 195

  AVX54967.1 PGLGDAGDRIFGTK 207
      A7G9P8 PGLGDAGDRLYGTK 209

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0009116	nucleoside metabolic process
1. PBF	GO:0006223	uracil salvage
1. PBF	GO:0006166	purine ribonucleoside salvage
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0044209	AMP salvage
1. PBF	GO:0003999	adenine phosphoribosyltransferase activity
1. PBF	GO:0004845	uracil phosphoribosyltransferase activity
1. PBF	GO:0005634	nucleus
1. PBF	GO:0006168	adenine salvage
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0006222	UMP biosynthetic process
1. PBF	GO:0044206	UMP salvage
1. PBF	GO:0000287	magnesium ion binding
1. PBF	GO:0005525	GTP binding
2. PF	GO:0052657	guanine phosphoribosyltransferase activity
2. PF	GO:0032265	XMP salvage
2. PF	GO:0043103	hypoxanthine salvage
2. PF	GO:0032264	IMP salvage
2. PF	GO:0005829	cytosol
2. PF	GO:0019856	pyrimidine nucleobase biosynthetic process
2. PF	GO:0044205	'de novo' UMP biosynthetic process
2. PF	GO:0046132	pyrimidine ribonucleoside biosynthetic process
2. PF	GO:0004588	orotate phosphoribosyltransferase activity
2. PF	GO:0004422	hypoxanthine phosphoribosyltransferase activity
2. PF	GO:0000310	xanthine phosphoribosyltransferase activity
2. PF	GO:0046872	metal ion binding
2. PF	GO:0016208	AMP binding
2. PF	GO:0046110	xanthine metabolic process
2. PF	GO:0002055	adenine binding
2. PF	GO:0032263	GMP salvage
3. BF	GO:0005524	ATP binding
4. PB	GO:0008655	pyrimidine-containing compound salvage
5. P	GO:0006353	DNA-templated transcription, termination
5. P	GO:0045964	positive regulation of dopamine metabolic process
5. P	GO:0003723	RNA binding
5. P	GO:0006178	guanine salvage
5. P	GO:0003700	DNA-binding transcription factor activity
5. P	GO:0009507	chloroplast
5. P	GO:0046651	lymphocyte proliferation
5. P	GO:0006355	regulation of transcription, DNA-templated
5. P	GO:0006221	pyrimidine nucleotide biosynthetic process
5. P	GO:0016740	transferase activity
5. P	GO:0046038	GMP catabolic process
5. P	GO:0046100	hypoxanthine metabolic process
5. P	GO:0009220	pyrimidine ribonucleotide biosynthetic process
5. P	GO:0046083	adenine metabolic process
5. P	GO:0021756	striatum development
5. P	GO:0042803	protein homodimerization activity
5. P	GO:0021954	central nervous system neuron development
5. P	GO:0046040	IMP metabolic process
5. P	GO:0005794	Golgi apparatus
5. P	GO:0002057	guanine binding
5. P	GO:0097216	guanosine tetraphosphate binding
5. P	GO:0005576	extracellular region
5. P	GO:0001913	T cell mediated cytotoxicity
5. P	GO:0000166	nucleotide binding
5. P	GO:0021895	cerebral cortex neuron differentiation
5. P	GO:0005783	endoplasmic reticulum
5. P	GO:0016020	membrane
5. P	GO:0007625	grooming behavior
5. P	GO:0042417	dopamine metabolic process
5. P	GO:0005654	nucleoplasm
7. B	GO:2000904	regulation of starch metabolic process
7. B	GO:0009156	ribonucleoside monophosphate biosynthetic process
7. B	GO:1901141	regulation of lignin biosynthetic process
7. B	GO:0006015	5-phosphoribose 1-diphosphate biosynthetic process
7. B	GO:2001006	regulation of cellulose biosynthetic process
7. B	GO:0044211	CTP salvage
7. B	GO:0004749	ribose phosphate diphosphokinase activity
7. B	GO:0004849	uridine kinase activity
7. B	GO:0043097	pyrimidine nucleoside salvage
7. B	GO:0009165	nucleotide biosynthetic process

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0006223	uracil salvage
GO:0008655	pyrimidine-containing compound salvage
GO:0004845	uracil phosphoribosyltransferase activity
GO:0003824	catalytic activity
GO:0016757	glycosyltransferase activity
GO:0008152	metabolic process
GO:0000287	magnesium ion binding
GO:0044206	UMP salvage
GO:0000166	nucleotide binding
GO:0005525	GTP binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	P0A8F3	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9757
1. PBF	Q72XD8	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9705
1. PBF	Q5SIQ7	Uracil phosphoribosyltransferase	0.00e+00	2.11e-66	2.10e-66	0.9623
1. PBF	A5H0J4	Uracil phosphoribosyltransferase	0.00e+00	6.32e-39	7.28e-25	0.9007
1. PBF	P0DH34	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9659
1. PBF	B2JE33	Uracil phosphoribosyltransferase	0.00e+00	8.19e-54	2.60e-59	0.9562
1. PBF	Q0HTW9	Uracil phosphoribosyltransferase	0.00e+00	9.68e-61	4.18e-64	0.976
1. PBF	Q02WM7	Uracil phosphoribosyltransferase	0.00e+00	2.70e-62	4.03e-82	0.9606
1. PBF	Q3ISU0	Uracil phosphoribosyltransferase	0.00e+00	4.25e-46	4.92e-33	0.8891
1. PBF	Q62IJ1	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9669
1. PBF	P50926	Uracil phosphoribosyltransferase	0.00e+00	5.35e-61	1.35e-82	0.9581
1. PBF	A1W0S0	Uracil phosphoribosyltransferase	0.00e+00	3.15e-65	1.06e-63	0.9706
1. PBF	Q8U1G7	Uracil phosphoribosyltransferase	0.00e+00	1.25e-44	1.35e-38	0.9283
1. PBF	C3KYI1	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9436
1. PBF	A5CNC6	Uracil phosphoribosyltransferase	0.00e+00	1.28e-58	6.36e-56	0.9503
1. PBF	A3DIL9	Uracil phosphoribosyltransferase	0.00e+00	1.41e-66	1.26e-70	0.9639
1. PBF	Q5HTC1	Uracil phosphoribosyltransferase	0.00e+00	8.97e-66	3.90e-62	0.9736
1. PBF	Q3BS29	Uracil phosphoribosyltransferase	0.00e+00	2.31e-52	2.16e-59	0.9794
1. PBF	B5RCX0	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.976
1. PBF	A8A2Z0	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9755
1. PBF	B2TXS3	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9756
1. PBF	C3MZM1	Uracil phosphoribosyltransferase	0.00e+00	6.36e-50	8.13e-34	0.9006
1. PBF	Q72J35	Uracil phosphoribosyltransferase	0.00e+00	2.11e-66	2.10e-66	0.9637
1. PBF	A2S4B1	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9667
1. PBF	A6LQG6	Uracil phosphoribosyltransferase	0.00e+00	1.20e-71	1.74e-77	0.9512
1. PBF	Q88PV2	Uracil phosphoribosyltransferase	0.00e+00	3.00e-62	1.67e-69	0.9853
1. PBF	Q5HE88	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9752
1. PBF	A0RR59	Uracil phosphoribosyltransferase	0.00e+00	1.14e-65	6.73e-63	0.9814
1. PBF	Q48MT3	Uracil phosphoribosyltransferase	0.00e+00	3.69e-60	2.67e-67	0.9792
1. PBF	A7H0F9	Uracil phosphoribosyltransferase	0.00e+00	3.26e-64	1.40e-61	0.965
1. PBF	C4Z9S1	Uracil phosphoribosyltransferase	0.00e+00	7.99e-67	2.75e-72	0.9688
1. PBF	Q2NS69	Uracil phosphoribosyltransferase	0.00e+00	1.13e-64	2.30e-61	0.977
1. PBF	A6VQ76	Uracil phosphoribosyltransferase	0.00e+00	3.18e-64	1.07e-68	0.9768
1. PBF	A4QC29	Uracil phosphoribosyltransferase	0.00e+00	3.69e-59	1.29e-56	0.9501
1. PBF	Q2KWB3	Uracil phosphoribosyltransferase	0.00e+00	2.15e-60	5.03e-69	0.9853
1. PBF	Q7VM34	Uracil phosphoribosyltransferase	0.00e+00	3.79e-63	3.92e-68	0.9783
1. PBF	Q6NIX4	Uracil phosphoribosyltransferase	0.00e+00	1.60e-57	7.34e-53	0.9446
1. PBF	B1YU48	Uracil phosphoribosyltransferase	0.00e+00	7.42e-54	1.70e-57	0.9682
1. PBF	A7FQG8	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9462
1. PBF	P67400	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9654
1. PBF	A8MJX1	Uracil phosphoribosyltransferase	0.00e+00	2.77e-71	2.15e-75	0.9514
1. PBF	Q3JUF6	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9669
1. PBF	Q82FS4	Uracil phosphoribosyltransferase	0.00e+00	2.95e-61	3.30e-57	0.9561
1. PBF	Q7N3F8	Uracil phosphoribosyltransferase	0.00e+00	8.67e-64	3.88e-66	0.9773
1. PBF	Q0BD86	Uracil phosphoribosyltransferase	0.00e+00	2.24e-54	1.35e-57	0.9555
1. PBF	A9MCZ3	Uracil phosphoribosyltransferase	0.00e+00	9.05e-55	1.75e-70	0.9767
1. PBF	A7GV65	Uracil phosphoribosyltransferase	0.00e+00	1.61e-69	5.01e-77	0.9663
1. PBF	Q6F210	Uracil phosphoribosyltransferase	0.00e+00	4.01e-88	1.24e-130	0.9957
1. PBF	B3PXN0	Uracil phosphoribosyltransferase	0.00e+00	3.35e-64	6.40e-68	0.9657
1. PBF	Q12MF1	Uracil phosphoribosyltransferase	0.00e+00	1.81e-63	2.26e-63	0.9768
1. PBF	Q9V0K1	Uracil phosphoribosyltransferase	0.00e+00	1.33e-44	2.44e-36	0.9251
1. PBF	B2SDI9	Uracil phosphoribosyltransferase	0.00e+00	3.19e-61	2.14e-59	0.9788
1. PBF	C5CLM9	Uracil phosphoribosyltransferase	0.00e+00	5.81e-65	4.67e-68	0.9747
1. PBF	B3H0R2	Uracil phosphoribosyltransferase	0.00e+00	2.03e-62	3.63e-69	0.9777
1. PBF	A6QIV6	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9767
1. PBF	C0M7M9	Uracil phosphoribosyltransferase	0.00e+00	1.36e-68	4.38e-85	0.9691
1. PBF	C3PLD0	Uracil phosphoribosyltransferase	0.00e+00	1.07e-60	1.45e-54	0.9437
1. PBF	B7GZA8	Uracil phosphoribosyltransferase	0.00e+00	4.00e-58	7.94e-65	0.9831
1. PBF	A5U7Y3	Uracil phosphoribosyltransferase	0.00e+00	3.07e-62	4.25e-56	0.9507
1. PBF	Q97F73	Uracil phosphoribosyltransferase	0.00e+00	4.22e-65	3.57e-80	0.953
1. PBF	Q57LL1	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9757
1. PBF	Q4UVY0	Uracil phosphoribosyltransferase	0.00e+00	3.94e-54	1.76e-60	0.9707
1. PBF	A8FMZ1	Uracil phosphoribosyltransferase	0.00e+00	3.15e-65	1.06e-63	0.9727
1. PBF	A9QZW6	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9765
1. PBF	Q7VZ79	Uracil phosphoribosyltransferase	0.00e+00	3.79e-60	4.17e-67	0.982
1. PBF	C3MY92	Uracil phosphoribosyltransferase	0.00e+00	6.36e-50	8.13e-34	0.9003
1. PBF	Q03EK5	Uracil phosphoribosyltransferase	0.00e+00	1.08e-65	2.45e-81	0.9569
1. PBF	C0RMK4	Uracil phosphoribosyltransferase	0.00e+00	2.80e-54	1.80e-70	0.9764
1. PBF	Q5WUK0	Uracil phosphoribosyltransferase	0.00e+00	2.34e-61	1.01e-68	0.9702
1. PBF	Q8CRN4	Uracil phosphoribosyltransferase	0.00e+00	7.07e-69	3.55e-81	0.9795
1. PBF	A6USD4	Uracil phosphoribosyltransferase	0.00e+00	4.25e-45	1.32e-33	0.9221
1. PBF	Q3IC38	Uracil phosphoribosyltransferase	0.00e+00	5.28e-60	7.60e-64	0.9705
1. PBF	B0R7K0	Uracil phosphoribosyltransferase	0.00e+00	1.36e-41	7.65e-29	0.8998
1. PBF	Q1J888	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9655
1. PBF	A9A7A5	Uracil phosphoribosyltransferase	0.00e+00	7.28e-45	2.94e-33	0.9302
1. PBF	Q2YUJ2	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.976
1. PBF	B8F5N2	Uracil phosphoribosyltransferase	0.00e+00	4.02e-61	8.23e-66	0.9774
1. PBF	B1IE69	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9431
1. PBF	B2A3H5	Uracil phosphoribosyltransferase	0.00e+00	1.72e-71	1.58e-70	0.9658
1. PBF	C6BSG3	Uracil phosphoribosyltransferase	0.00e+00	4.80e-63	1.55e-60	0.9788
1. PBF	A1SVA9	Uracil phosphoribosyltransferase	0.00e+00	1.85e-61	2.47e-64	0.9766
1. PBF	C5D9M4	Uracil phosphoribosyltransferase	0.00e+00	3.54e-70	2.07e-77	0.9679
1. PBF	B5ZAU8	Uracil phosphoribosyltransferase	0.00e+00	2.50e-67	3.80e-85	0.9732
1. PBF	C1ARF7	Uracil phosphoribosyltransferase	0.00e+00	2.01e-67	3.15e-69	0.9782
1. PBF	B1LNE8	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9755
1. PBF	A0ZZM2	Uracil phosphoribosyltransferase	0.00e+00	7.48e-56	1.08e-47	0.9484
1. PBF	B4EY88	Uracil phosphoribosyltransferase	0.00e+00	1.37e-66	3.63e-66	0.9789
1. PBF	B9MJ16	Uracil phosphoribosyltransferase	0.00e+00	5.18e-62	6.12e-70	0.9772
1. PBF	Q9HVE6	Uracil phosphoribosyltransferase	0.00e+00	6.85e-57	5.79e-67	0.9793
1. PBF	A4JGH4	Uracil phosphoribosyltransferase	0.00e+00	2.33e-53	7.05e-58	0.9671
1. PBF	Q180X8	Uracil phosphoribosyltransferase	0.00e+00	8.63e-71	1.57e-77	0.9673
1. PBF	Q7VRS9	Uracil phosphoribosyltransferase	0.00e+00	3.00e-62	8.06e-58	0.9785
1. PBF	Q5JGQ6	Uracil phosphoribosyltransferase	0.00e+00	1.69e-47	1.64e-40	0.9308
1. PBF	B0VU43	Uracil phosphoribosyltransferase	0.00e+00	4.00e-58	7.94e-65	0.9834
1. PBF	B9E8F4	Uracil phosphoribosyltransferase	0.00e+00	6.02e-71	1.38e-77	0.9746
1. PBF	A8AD93	Uracil phosphoribosyltransferase	0.00e+00	1.16e-64	1.43e-64	0.9753
1. PBF	A5VVW9	Uracil phosphoribosyltransferase	0.00e+00	3.40e-54	2.85e-71	0.9825
1. PBF	P0C939	Uracil phosphoribosyltransferase	0.00e+00	2.91e-44	2.21e-22	0.9246
1. PBF	P36399	Uracil phosphoribosyltransferase	0.00e+00	3.35e-70	1.57e-86	0.9659
1. PBF	P59001	Uracil phosphoribosyltransferase	0.00e+00	1.07e-52	1.37e-59	0.9794
1. PBF	B9JYP9	Uracil phosphoribosyltransferase	0.00e+00	1.43e-63	1.80e-69	0.969
1. PBF	A9NEQ2	Uracil phosphoribosyltransferase	0.00e+00	1.07e-68	9.47e-76	0.9881
1. PBF	B2G680	Uracil phosphoribosyltransferase	0.00e+00	2.15e-60	1.47e-74	0.9504
1. PBF	B7N680	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9759
1. PBF	A4VPB2	Uracil phosphoribosyltransferase	0.00e+00	1.43e-61	2.27e-62	0.9819
1. PBF	P0A8F2	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9756
1. PBF	A8YUJ4	Uracil phosphoribosyltransferase	0.00e+00	2.94e-67	2.11e-74	0.9623
1. PBF	B7M7K2	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9758
1. PBF	A1S7E5	Uracil phosphoribosyltransferase	0.00e+00	1.51e-63	1.93e-65	0.9759
1. PBF	A3CPK9	Uracil phosphoribosyltransferase	0.00e+00	8.55e-70	3.92e-81	0.971
1. PBF	B6IW12	Uracil phosphoribosyltransferase	0.00e+00	3.74e-52	8.42e-54	0.9682
1. PBF	B2TJY9	Uracil phosphoribosyltransferase	0.00e+00	1.08e-73	2.86e-83	0.9553
1. PBF	Q7WMM5	Uracil phosphoribosyltransferase	0.00e+00	3.16e-60	3.42e-66	0.9851
1. PBF	A0JSM6	Uracil phosphoribosyltransferase	0.00e+00	6.75e-63	6.46e-61	0.9526
1. PBF	O67914	Uracil phosphoribosyltransferase	0.00e+00	2.11e-56	1.50e-48	0.9608
1. PBF	P93394	Uracil phosphoribosyltransferase	0.00e+00	3.52e-41	3.28e-47	0.9433
1. PBF	Q1QVR2	Uracil phosphoribosyltransferase	0.00e+00	2.94e-67	5.87e-68	0.9795
1. PBF	Q7NBH2	Uracil phosphoribosyltransferase	0.00e+00	1.31e-58	1.13e-71	0.9769
1. PBF	A4YCQ1	Uracil phosphoribosyltransferase	0.00e+00	1.63e-49	3.12e-32	0.9033
1. PBF	C1KYV5	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	5.83e-80	0.9545
1. PBF	B7GNR5	Uracil phosphoribosyltransferase	0.00e+00	4.22e-55	6.77e-49	0.9556
1. PBF	Q8ZCX9	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9765
1. PBF	Q8YDE5	Uracil phosphoribosyltransferase	0.00e+00	2.80e-54	1.80e-70	0.9818
1. PBF	A7Z9Q8	Uracil phosphoribosyltransferase	0.00e+00	5.84e-69	1.10e-77	0.9628
1. PBF	B1IWG2	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9757
1. PBF	B1JW40	Uracil phosphoribosyltransferase	0.00e+00	7.42e-54	1.70e-57	0.964
1. PBF	A8FIC0	Uracil phosphoribosyltransferase	0.00e+00	6.31e-70	1.61e-76	0.9652
1. PBF	Q5HMB1	Uracil phosphoribosyltransferase	0.00e+00	7.07e-69	3.55e-81	0.9692
1. PBF	Q8EUA1	Uracil phosphoribosyltransferase	0.00e+00	2.27e-70	1.73e-86	0.9802
1. PBF	A4WD70	Uracil phosphoribosyltransferase	0.00e+00	3.96e-67	8.05e-65	0.9751
1. PBF	C0MGT4	Uracil phosphoribosyltransferase	0.00e+00	1.36e-68	4.38e-85	0.9686
1. PBF	Q142L5	Uracil phosphoribosyltransferase	0.00e+00	5.54e-54	5.99e-58	0.9556
1. PBF	A5IJ64	Uracil phosphoribosyltransferase	0.00e+00	2.19e-64	9.80e-69	0.9605
1. PBF	Q65DW6	Uracil phosphoribosyltransferase	0.00e+00	1.54e-70	2.38e-77	0.9649
1. PBF	A1SJB1	Adenine phosphoribosyltransferase	3.26e-07	1.52e-11	0.026	0.6484
1. PBF	Q9HN05	Uracil phosphoribosyltransferase	0.00e+00	1.36e-41	7.65e-29	0.9012
1. PBF	A3NT50	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9669
1. PBF	Q084L0	Uracil phosphoribosyltransferase	0.00e+00	5.05e-62	2.91e-64	0.9753
1. PBF	Q9K048	Uracil phosphoribosyltransferase	0.00e+00	1.17e-66	1.69e-63	0.9756
1. PBF	B5R560	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.976
1. PBF	B5YDB8	Uracil phosphoribosyltransferase	0.00e+00	2.17e-68	2.62e-75	0.952
1. PBF	B9KAQ6	Uracil phosphoribosyltransferase	0.00e+00	3.37e-67	8.78e-70	0.9593
1. PBF	C3MRJ6	Uracil phosphoribosyltransferase	0.00e+00	6.36e-50	8.13e-34	0.8999
1. PBF	A7HJR3	Uracil phosphoribosyltransferase	0.00e+00	2.14e-64	1.50e-70	0.9576
1. PBF	C4XJX5	Uracil phosphoribosyltransferase	0.00e+00	1.95e-61	3.24e-62	0.977
1. PBF	A0RLA2	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	5.19e-79	0.9725
1. PBF	Q6AHB4	Uracil phosphoribosyltransferase	0.00e+00	4.82e-57	7.86e-58	0.9515
1. PBF	Q1JID6	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9683
1. PBF	Q927V5	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	1.96e-80	0.9527
1. PBF	Q5ZTB9	Uracil phosphoribosyltransferase	0.00e+00	3.99e-62	1.51e-68	0.9747
1. PBF	B1VF60	Uracil phosphoribosyltransferase	0.00e+00	7.10e-53	2.92e-51	0.9558
1. PBF	Q1GAX2	Uracil phosphoribosyltransferase	0.00e+00	1.10e-68	6.10e-73	0.9653
1. PBF	Q5NGW1	Uracil phosphoribosyltransferase	0.00e+00	2.26e-60	5.12e-59	0.9679
1. PBF	B8DBH1	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	5.83e-80	0.9529
1. PBF	Q15ZS0	Uracil phosphoribosyltransferase	0.00e+00	3.35e-64	3.67e-65	0.9756
1. PBF	Q9PR28	Uracil phosphoribosyltransferase	0.00e+00	3.41e-72	2.29e-85	0.9735
1. PBF	C0QHT9	Uracil phosphoribosyltransferase	0.00e+00	2.44e-64	5.90e-62	0.9822
1. PBF	Q73UD7	Uracil phosphoribosyltransferase	0.00e+00	2.82e-07	1.32e-51	0.9569
1. PBF	Q6HAX0	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9658
1. PBF	B7IDR9	Uracil phosphoribosyltransferase	0.00e+00	5.66e-65	8.74e-73	0.9656
1. PBF	Q26998	Uracil phosphoribosyltransferase	0.00e+00	7.62e-15	2.79e-34	0.8986
1. PBF	B1KSR7	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.945
1. PBF	Q6D7S0	Uracil phosphoribosyltransferase	0.00e+00	4.95e-65	2.32e-65	0.9761
1. PBF	A6W572	Uracil phosphoribosyltransferase	0.00e+00	3.33e-60	2.45e-53	0.9442
1. PBF	A1VEW8	Uracil phosphoribosyltransferase	0.00e+00	2.03e-64	9.87e-63	0.9711
1. PBF	B1AIA5	Uracil phosphoribosyltransferase	0.00e+00	3.41e-72	2.29e-85	0.9746
1. PBF	C4KYT2	Uracil phosphoribosyltransferase	0.00e+00	2.35e-68	1.21e-77	0.9508
1. PBF	Q9KPY7	Uracil phosphoribosyltransferase	0.00e+00	5.99e-64	3.02e-66	0.9787
1. PBF	C4LC66	Uracil phosphoribosyltransferase	0.00e+00	2.04e-60	6.91e-66	0.9747
1. PBF	P72753	Uracil phosphoribosyltransferase	0.00e+00	4.60e-51	9.07e-44	0.9225
1. PBF	P67398	Uracil phosphoribosyltransferase	0.00e+00	3.55e-71	3.39e-84	0.967
1. PBF	Q6G7J8	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9758
1. PBF	B0K7G1	Uracil phosphoribosyltransferase	0.00e+00	1.01e-71	2.46e-73	0.9572
1. PBF	Q9WZI0	Uracil phosphoribosyltransferase	0.00e+00	2.37e-64	1.99e-68	0.9524
1. PBF	A0KM23	Uracil phosphoribosyltransferase	0.00e+00	7.69e-63	2.15e-64	0.9758
1. PBF	A1W748	Uracil phosphoribosyltransferase	0.00e+00	4.95e-61	1.47e-69	0.9773
1. PBF	A1WQN5	Uracil phosphoribosyltransferase	0.00e+00	1.40e-62	3.83e-75	0.9771
1. PBF	B5F173	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9756
1. PBF	B0TPW8	Uracil phosphoribosyltransferase	0.00e+00	6.72e-62	2.44e-62	0.9747
1. PBF	A6LMU0	Uracil phosphoribosyltransferase	0.00e+00	7.44e-66	8.58e-71	0.9598
1. PBF	Q65RC3	Uracil phosphoribosyltransferase	0.00e+00	2.03e-64	1.41e-68	0.9778
1. PBF	P0A659	Uracil phosphoribosyltransferase	0.00e+00	3.07e-62	4.25e-56	0.9501
1. PBF	B9DX75	Uracil phosphoribosyltransferase	0.00e+00	2.34e-71	1.10e-79	0.9613
1. PBF	A6UET4	Uracil phosphoribosyltransferase	0.00e+00	8.67e-64	2.79e-70	0.9761
1. PBF	Q8XXC7	Uracil phosphoribosyltransferase	0.00e+00	5.44e-51	5.73e-60	0.9483
1. PBF	Q898X9	Uracil phosphoribosyltransferase	0.00e+00	6.19e-71	1.80e-81	0.9623
1. PBF	Q4K6B5	Uracil phosphoribosyltransferase	0.00e+00	2.85e-60	8.85e-66	0.9859
1. PBF	B9IRU7	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9691
1. PBF	A3MI49	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9645
1. PBF	A4XQU8	Uracil phosphoribosyltransferase	0.00e+00	1.30e-62	2.03e-67	0.9831
1. PBF	A4FYB9	Uracil phosphoribosyltransferase	0.00e+00	1.85e-45	1.33e-31	0.9324
1. PBF	A0Q5K6	Uracil phosphoribosyltransferase	0.00e+00	2.26e-60	5.12e-59	0.9673
1. PBF	B7MHX9	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9759
1. PBF	A6TK51	Uracil phosphoribosyltransferase	0.00e+00	6.31e-72	5.85e-72	0.952
1. PBF	Q31MH4	Uracil phosphoribosyltransferase	0.00e+00	1.10e-51	2.81e-53	0.9371
1. PBF	A1B467	Uracil phosphoribosyltransferase	0.00e+00	4.85e-64	5.13e-71	0.9631
1. PBF	B4RK50	Uracil phosphoribosyltransferase	0.00e+00	8.22e-68	8.39e-64	0.9736
1. PBF	Q6A5S3	Uracil phosphoribosyltransferase	0.00e+00	6.90e-55	2.72e-49	0.9356
1. PBF	Q0HHL7	Uracil phosphoribosyltransferase	0.00e+00	9.68e-61	4.18e-64	0.9763
1. PBF	A5F642	Uracil phosphoribosyltransferase	0.00e+00	4.84e-66	4.01e-67	0.9773
1. PBF	Q5M5U5	Uracil phosphoribosyltransferase	0.00e+00	5.49e-72	1.71e-85	0.9665
1. PBF	P58998	Uracil phosphoribosyltransferase	0.00e+00	3.69e-59	1.29e-56	0.951
1. PBF	A7X4V6	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9763
1. PBF	P39149	Uracil phosphoribosyltransferase	0.00e+00	1.61e-69	1.42e-78	0.9624
1. PBF	B7V0J2	Uracil phosphoribosyltransferase	0.00e+00	6.85e-57	5.79e-67	0.9787
1. PBF	P0A8F1	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9762
1. PBF	Q9PN13	Uracil phosphoribosyltransferase	0.00e+00	8.89e-65	1.88e-63	0.9744
1. PBF	Q1JN85	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9643
1. PBF	B1HM47	Uracil phosphoribosyltransferase	0.00e+00	1.72e-71	5.18e-77	0.9578
1. PBF	A5UQV0	Uracil phosphoribosyltransferase	0.00e+00	4.36e-64	2.13e-68	0.9628
1. PBF	Q975Z7	Uracil phosphoribosyltransferase	0.00e+00	1.89e-48	1.18e-36	0.9054
1. PBF	Q5MZF4	Uracil phosphoribosyltransferase	0.00e+00	1.10e-51	2.81e-53	0.9323
1. PBF	A4TMP2	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9767
1. PBF	B2SC51	Uracil phosphoribosyltransferase	0.00e+00	2.14e-54	1.69e-70	0.9817
1. PBF	Q9RGY8	Uracil phosphoribosyltransferase	0.00e+00	2.85e-68	6.12e-76	0.9727
1. PBF	Q24MM7	Uracil phosphoribosyltransferase	0.00e+00	1.21e-72	8.80e-75	0.9726
1. PBF	C3LPM9	Uracil phosphoribosyltransferase	0.00e+00	4.84e-66	4.01e-67	0.9777
1. PBF	A4SL29	Uracil phosphoribosyltransferase	0.00e+00	1.05e-62	5.74e-65	0.9757
1. PBF	A4Y5T9	Uracil phosphoribosyltransferase	0.00e+00	5.21e-61	6.90e-64	0.9757
1. PBF	B3PM96	Uracil phosphoribosyltransferase	0.00e+00	6.31e-70	4.17e-76	0.9763
1. PBF	A8AYQ0	Uracil phosphoribosyltransferase	0.00e+00	1.16e-69	6.70e-81	0.9715
1. PBF	C3KAJ8	Uracil phosphoribosyltransferase	0.00e+00	4.19e-60	7.36e-66	0.9859
1. PBF	Q6KHA6	Uracil phosphoribosyltransferase	0.00e+00	4.56e-69	5.76e-74	0.9647
1. PBF	A0KYA2	Uracil phosphoribosyltransferase	0.00e+00	7.48e-61	4.04e-64	0.976
1. PBF	A9HZV9	Uracil phosphoribosyltransferase	0.00e+00	7.96e-60	1.08e-65	0.9848
1. PBF	A9AJK1	Uracil phosphoribosyltransferase	0.00e+00	9.72e-53	4.48e-57	0.9664
1. PBF	Q18DK8	Uracil phosphoribosyltransferase	0.00e+00	6.15e-43	2.78e-25	0.8887
1. PBF	C1FQA3	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9455
1. PBF	O27186	Uracil phosphoribosyltransferase	0.00e+00	1.47e-51	1.21e-25	0.892
1. PBF	Q8Y4B3	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	5.83e-80	0.9539
1. PBF	B3E677	Uracil phosphoribosyltransferase	0.00e+00	2.91e-66	1.75e-68	0.9813
1. PBF	B2U8Z0	Uracil phosphoribosyltransferase	0.00e+00	3.69e-53	9.10e-57	0.9644
1. PBF	A1ADZ1	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9757
1. PBF	Q8FUZ2	Uracil phosphoribosyltransferase	0.00e+00	9.05e-55	1.75e-70	0.9759
1. PBF	Q492F3	Uracil phosphoribosyltransferase	0.00e+00	5.92e-63	1.09e-60	0.977
1. PBF	A1KNZ5	Uracil phosphoribosyltransferase	0.00e+00	3.07e-62	4.25e-56	0.9479
1. PBF	Q9YEN3	Uracil phosphoribosyltransferase	0.00e+00	2.20e-50	2.72e-26	0.934
1. PBF	Q8UJ06	Uracil phosphoribosyltransferase	0.00e+00	5.09e-65	2.29e-71	0.9777
1. PBF	Q8YVB5	Uracil phosphoribosyltransferase	0.00e+00	1.30e-53	4.48e-48	0.9314
1. PBF	A8YY79	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9756
1. PBF	Q9AK76	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	7.23e-57	0.9557
1. PBF	B7JGP0	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9711
1. PBF	Q5KUI3	Uracil phosphoribosyltransferase	0.00e+00	1.44e-68	9.51e-78	0.9782
1. PBF	A6VJY4	Uracil phosphoribosyltransferase	0.00e+00	7.44e-45	3.30e-34	0.9292
1. PBF	Q7N0N9	Adenine phosphoribosyltransferase	3.64e-08	8.03e-14	0.013	0.6324
1. PBF	B0BTQ3	Uracil phosphoribosyltransferase	0.00e+00	2.03e-62	3.63e-69	0.9772
1. PBF	A6WM35	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	5.14e-64	0.9757
1. PBF	A9WW75	Uracil phosphoribosyltransferase	0.00e+00	9.05e-55	1.75e-70	0.9774
1. PBF	Q3K6Y9	Uracil phosphoribosyltransferase	0.00e+00	2.95e-58	1.34e-66	0.9858
1. PBF	Q1IEV9	Uracil phosphoribosyltransferase	0.00e+00	7.26e-62	3.39e-69	0.9855
1. PBF	Q87MH1	Uracil phosphoribosyltransferase	0.00e+00	8.00e-65	2.27e-66	0.9759
1. PBF	A5VIQ0	Uracil phosphoribosyltransferase	0.00e+00	2.15e-60	1.47e-74	0.9513
1. PBF	Q8EM74	Uracil phosphoribosyltransferase	0.00e+00	5.65e-70	1.51e-72	0.9516
1. PBF	A1U241	Uracil phosphoribosyltransferase	0.00e+00	8.73e-61	1.71e-66	0.9815
1. PBF	B5XNQ4	Uracil phosphoribosyltransferase	0.00e+00	4.71e-66	3.01e-64	0.9744
1. PBF	Q02G28	Uracil phosphoribosyltransferase	0.00e+00	6.85e-57	5.79e-67	0.9787
1. PBF	P0DH35	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9676
1. PBF	A1VN11	Uracil phosphoribosyltransferase	0.00e+00	6.38e-62	4.04e-71	0.9758
1. PBF	A5N3J1	Uracil phosphoribosyltransferase	0.00e+00	2.34e-71	1.10e-79	0.961
1. PBF	Q6FE58	Uracil phosphoribosyltransferase	0.00e+00	8.32e-59	1.09e-66	0.9849
1. PBF	C3MBH2	Uracil phosphoribosyltransferase	0.00e+00	1.77e-64	1.07e-68	0.975
1. PBF	A9KIB0	Uracil phosphoribosyltransferase	0.00e+00	1.33e-68	2.27e-68	0.9644
1. PBF	B9DMF2	Uracil phosphoribosyltransferase	0.00e+00	2.76e-65	2.85e-79	0.9713
1. PBF	Q0T222	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.976
1. PBF	Q9CPL8	Uracil phosphoribosyltransferase	0.00e+00	2.56e-62	4.05e-66	0.9761
1. PBF	P47276	Uracil phosphoribosyltransferase	0.00e+00	1.66e-65	2.09e-61	0.9669
1. PBF	Q67TC9	Uracil phosphoribosyltransferase	0.00e+00	3.87e-69	7.18e-73	0.9656
1. PBF	A3MZB6	Uracil phosphoribosyltransferase	0.00e+00	2.03e-62	3.63e-69	0.9773
1. PBF	B0UW86	Uracil phosphoribosyltransferase	0.00e+00	2.08e-62	1.32e-66	0.9758
1. PBF	P67397	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9745
1. PBF	B2GAT5	Uracil phosphoribosyltransferase	0.00e+00	7.76e-60	1.26e-75	0.9493
1. PBF	C3NFT0	Uracil phosphoribosyltransferase	0.00e+00	6.36e-50	8.13e-34	0.9005
1. PBF	A8H5Q9	Uracil phosphoribosyltransferase	0.00e+00	6.72e-62	2.44e-62	0.9756
1. PBF	B9LUM1	Uracil phosphoribosyltransferase	0.00e+00	8.51e-45	1.71e-29	0.8963
1. PBF	Q2ST42	Uracil phosphoribosyltransferase	0.00e+00	1.25e-97	1.84e-147	0.9885
1. PBF	Q6GEW3	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9778
1. PBF	A7NRA6	Uracil phosphoribosyltransferase	0.00e+00	3.59e-63	2.61e-70	0.9619
1. PBF	B7IQW8	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9708
1. PBF	Q668E6	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9767
1. PBF	A7G9P8	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9446
1. PBF	B4T0M7	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9757
1. PBF	B0S2A9	Uracil phosphoribosyltransferase	0.00e+00	4.91e-68	9.26e-76	0.9627
1. PBF	A9KY39	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	5.14e-64	0.9759
1. PBF	B8E009	Uracil phosphoribosyltransferase	0.00e+00	7.38e-68	4.14e-75	0.9537
1. PBF	A5IUQ7	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9694
1. PBF	A3QD33	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	2.63e-62	0.9747
1. PBF	Q4L7Z3	Uracil phosphoribosyltransferase	0.00e+00	3.03e-69	1.64e-77	0.9759
1. PBF	Q2SZS9	Uracil phosphoribosyltransferase	0.00e+00	8.87e-52	1.09e-56	0.9674
1. PBF	Q5PNJ7	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9758
1. PBF	Q4JAV0	Uracil phosphoribosyltransferase	0.00e+00	5.50e-49	3.88e-35	0.9034
1. PBF	Q5M1A9	Uracil phosphoribosyltransferase	0.00e+00	5.49e-72	1.71e-85	0.971
1. PBF	B0V8B1	Uracil phosphoribosyltransferase	0.00e+00	4.00e-58	7.94e-65	0.9823
1. PBF	B8EAL3	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	5.14e-64	0.9758
1. PBF	Q814V3	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9645
1. PBF	Q5UZD3	Uracil phosphoribosyltransferase	0.00e+00	8.93e-43	6.85e-33	0.9058
1. PBF	B7LCN8	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9759
1. PBF	C6DBR1	Uracil phosphoribosyltransferase	0.00e+00	2.54e-65	1.80e-64	0.9762
1. PBF	B1XAX3	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9756
1. PBF	P67402	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9661
1. PBF	B7KY35	Adenine phosphoribosyltransferase	4.23e-08	1.14e-16	0.026	0.5524
1. PBF	C1F0N8	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9705
1. PBF	A1KT34	Uracil phosphoribosyltransferase	0.00e+00	2.64e-67	6.81e-63	0.9737
1. PBF	A4WMQ7	Uracil phosphoribosyltransferase	0.00e+00	2.00e-56	2.72e-37	0.9213
1. PBF	B1JEN1	Uracil phosphoribosyltransferase	0.00e+00	1.43e-61	6.32e-69	0.9782
1. PBF	Q6LZE9	Uracil phosphoribosyltransferase	0.00e+00	2.54e-44	8.49e-33	0.9401
1. PBF	B2FLX2	Uracil phosphoribosyltransferase	0.00e+00	5.28e-54	6.52e-64	0.9799
1. PBF	B0TYR5	Uracil phosphoribosyltransferase	0.00e+00	8.82e-60	8.29e-60	0.9682
1. PBF	C4KIV1	Uracil phosphoribosyltransferase	0.00e+00	2.48e-49	7.54e-34	0.9001
1. PBF	Q89E48	Uracil phosphoribosyltransferase	0.00e+00	4.77e-58	8.54e-57	0.9709
1. PBF	B7HFL2	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9687
1. PBF	A3D3D2	Uracil phosphoribosyltransferase	0.00e+00	2.87e-61	5.14e-64	0.9761
1. PBF	A5VYH8	Uracil phosphoribosyltransferase	0.00e+00	3.00e-62	1.67e-69	0.9863
1. PBF	B6I570	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9757
1. PBF	Q4QJV5	Uracil phosphoribosyltransferase	0.00e+00	1.03e-65	4.88e-66	0.9764
1. PBF	Q0TEZ0	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9753
1. PBF	Q7MIK2	Uracil phosphoribosyltransferase	0.00e+00	1.11e-65	1.50e-65	0.9753
1. PBF	Q47W53	Uracil phosphoribosyltransferase	0.00e+00	1.86e-63	1.95e-69	0.9836
1. PBF	C3LFI9	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9711
1. PBF	Q888A0	Uracil phosphoribosyltransferase	0.00e+00	3.00e-60	2.37e-67	0.9853
1. PBF	B7LKE4	Uracil phosphoribosyltransferase	0.00e+00	5.11e-66	8.32e-66	0.9755
1. PBF	Q1WUD3	Uracil phosphoribosyltransferase	0.00e+00	3.47e-69	5.28e-85	0.9589
1. PBF	Q980Q4	Uracil phosphoribosyltransferase	0.00e+00	3.29e-50	3.11e-33	0.9048
1. PBF	Q49Z59	Uracil phosphoribosyltransferase	0.00e+00	2.48e-65	1.21e-73	0.9712
1. PBF	Q03A25	Uracil phosphoribosyltransferase	0.00e+00	1.08e-67	1.43e-79	0.9645
1. PBF	Q03M79	Uracil phosphoribosyltransferase	0.00e+00	5.49e-72	1.71e-85	0.9638
1. PBF	B5EBM3	Uracil phosphoribosyltransferase	0.00e+00	5.33e-67	6.32e-65	0.9667
1. PBF	B7UGN6	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.976
1. PBF	B9J6V7	Uracil phosphoribosyltransferase	0.00e+00	1.04e-63	1.58e-66	0.973
1. PBF	Q4ZXU7	Uracil phosphoribosyltransferase	0.00e+00	3.69e-60	2.67e-67	0.9868
1. PBF	Q1C5P3	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9767
1. PBF	Q8EDI9	Uracil phosphoribosyltransferase	0.00e+00	9.68e-61	4.18e-64	0.9759
1. PBF	A6VC42	Uracil phosphoribosyltransferase	0.00e+00	8.47e-56	6.46e-67	0.9784
1. PBF	B7NQN7	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9758
1. PBF	B1YEG7	Uracil phosphoribosyltransferase	0.00e+00	9.05e-69	9.07e-79	0.954
1. PBF	A5UF76	Uracil phosphoribosyltransferase	0.00e+00	1.90e-65	4.57e-66	0.9763
1. PBF	C1DC78	Uracil phosphoribosyltransferase	0.00e+00	1.63e-63	1.08e-65	0.9761
1. PBF	Q8DQI3	Uracil phosphoribosyltransferase	0.00e+00	4.91e-72	6.75e-84	0.9636
1. PBF	B1KIG8	Uracil phosphoribosyltransferase	0.00e+00	1.91e-63	8.66e-63	0.9753
1. PBF	Q0SK44	Uracil phosphoribosyltransferase	0.00e+00	2.49e-63	5.62e-69	0.9762
1. PBF	P43049	Uracil phosphoribosyltransferase	0.00e+00	6.16e-66	1.47e-82	0.9752
1. PBF	A8FUD4	Uracil phosphoribosyltransferase	0.00e+00	2.62e-63	6.32e-64	0.9755
1. PBF	Q63VS8	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9674
1. PBF	Q576P9	Uracil phosphoribosyltransferase	0.00e+00	2.14e-54	1.69e-70	0.9813
1. PBF	A2RG73	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9658
1. PBF	Q9RBJ3	Uracil phosphoribosyltransferase	0.00e+00	3.94e-54	1.76e-60	0.9708
1. PBF	Q1DG16	Uracil phosphoribosyltransferase	0.00e+00	1.95e-61	2.95e-68	0.9755
1. PBF	B0KNF7	Uracil phosphoribosyltransferase	0.00e+00	3.00e-62	1.67e-69	0.9837
1. PBF	Q2P2V7	Uracil phosphoribosyltransferase	0.00e+00	5.42e-56	2.15e-60	0.9703
1. PBF	P67399	Uracil phosphoribosyltransferase	0.00e+00	3.55e-71	3.39e-84	0.9671
1. PBF	B7I752	Uracil phosphoribosyltransferase	0.00e+00	4.00e-58	7.94e-65	0.9834
1. PBF	Q7M8H6	Uracil phosphoribosyltransferase	0.00e+00	1.49e-65	8.07e-78	0.9713
1. PBF	A9WLN5	Uracil phosphoribosyltransferase	0.00e+00	2.01e-57	2.04e-55	0.948
1. PBF	B4TR74	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9759
1. PBF	C5A6P6	Uracil phosphoribosyltransferase	0.00e+00	1.19e-48	2.04e-37	0.9287
1. PBF	Q311Z9	Uracil phosphoribosyltransferase	0.00e+00	2.19e-62	5.98e-63	0.9763
1. PBF	A0Q306	Uracil phosphoribosyltransferase	0.00e+00	2.47e-70	3.78e-79	0.9541
1. PBF	Q8RG35	Uracil phosphoribosyltransferase	0.00e+00	6.62e-68	7.08e-85	0.9789
1. PBF	A0ALM3	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	5.83e-80	0.9553
1. PBF	B3WDL1	Uracil phosphoribosyltransferase	0.00e+00	1.08e-67	1.43e-79	0.9639
1. PBF	B0TI63	Uracil phosphoribosyltransferase	0.00e+00	5.84e-69	5.03e-69	0.9683
1. PBF	Q38WJ8	Uracil phosphoribosyltransferase	0.00e+00	1.02e-66	1.04e-79	0.9563
1. PBF	B2RIV3	Uracil phosphoribosyltransferase	0.00e+00	2.91e-44	2.21e-22	0.9207
1. PBF	Q5XDM5	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.966
1. PBF	P67396	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9734
1. PBF	A1V2G4	Uracil phosphoribosyltransferase	0.00e+00	2.20e-51	1.69e-56	0.9642
1. PBF	A4VWM9	Uracil phosphoribosyltransferase	0.00e+00	1.20e-71	4.60e-86	0.9643
1. PBF	Q04BB0	Uracil phosphoribosyltransferase	0.00e+00	1.10e-68	6.10e-73	0.9641
1. PBF	C6DZH8	Uracil phosphoribosyltransferase	0.00e+00	2.23e-68	4.23e-67	0.9784
1. PBF	B5ZXI2	Uracil phosphoribosyltransferase	0.00e+00	1.22e-63	6.99e-68	0.974
1. PBF	Q5WB67	Uracil phosphoribosyltransferase	0.00e+00	8.09e-70	1.16e-76	0.9697
1. PBF	A2SGT8	Uracil phosphoribosyltransferase	0.00e+00	8.82e-60	4.67e-56	0.9762
1. PBF	Q71WP0	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	5.83e-80	0.9541
1. PBF	B7GMG3	Uracil phosphoribosyltransferase	0.00e+00	7.51e-71	5.01e-77	0.969
1. PBF	B2K9J9	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.977
1. PBF	Q92T49	Uracil phosphoribosyltransferase	0.00e+00	7.85e-66	2.21e-72	0.9663
1. PBF	A6U3J7	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9689
1. PBF	B8HCL2	Uracil phosphoribosyltransferase	0.00e+00	1.47e-63	1.76e-60	0.9551
1. PBF	A1RV13	Uracil phosphoribosyltransferase	0.00e+00	1.65e-55	4.79e-34	0.9079
1. PBF	A1JKZ8	Uracil phosphoribosyltransferase	0.00e+00	1.07e-64	6.13e-65	0.9768
1. PBF	Q8RD94	Uracil phosphoribosyltransferase	0.00e+00	1.40e-69	2.47e-71	0.9546
1. PBF	A1AMK6	Uracil phosphoribosyltransferase	0.00e+00	2.35e-66	6.76e-69	0.9812
1. PBF	B4TD73	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9758
1. PBF	Q39EA2	Uracil phosphoribosyltransferase	0.00e+00	1.65e-52	4.16e-57	0.9678
1. PBF	A9VSB3	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	5.19e-79	0.9728
1. PBF	B5XJZ7	Uracil phosphoribosyltransferase	0.00e+00	1.13e-66	1.71e-80	0.9651
1. PBF	C3P1G4	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9722
1. PBF	A1R2Y2	Uracil phosphoribosyltransferase	0.00e+00	1.72e-63	2.80e-62	0.9537
1. PBF	Q97RQ3	Uracil phosphoribosyltransferase	0.00e+00	1.28e-72	6.67e-84	0.968
1. PBF	Q8XIC4	Uracil phosphoribosyltransferase	0.00e+00	3.23e-73	5.94e-81	0.9598
1. PBF	C4ZX73	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9761
1. PBF	Q9K6G5	Uracil phosphoribosyltransferase	0.00e+00	2.81e-72	2.42e-76	0.9715
1. PBF	B0K1G2	Uracil phosphoribosyltransferase	0.00e+00	1.01e-71	2.46e-73	0.9536
1. PBF	A9BWD4	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	3.07e-71	0.9772
1. PBF	B8I567	Uracil phosphoribosyltransferase	0.00e+00	3.95e-68	3.10e-72	0.9586
1. PBF	C4LKC1	Uracil phosphoribosyltransferase	0.00e+00	1.86e-56	2.28e-54	0.9505
1. PBF	Q0SQY5	Uracil phosphoribosyltransferase	0.00e+00	6.46e-74	1.61e-80	0.955
1. PBF	B1MFZ1	Uracil phosphoribosyltransferase	0.00e+00	7.25e-55	1.63e-53	0.9429
1. PBF	C0Z818	Uracil phosphoribosyltransferase	0.00e+00	2.17e-68	2.07e-73	0.9695
1. PBF	Q3JZU9	Uracil phosphoribosyltransferase	0.00e+00	3.55e-71	3.39e-84	0.9723
1. PBF	B2UZI9	Uracil phosphoribosyltransferase	0.00e+00	1.08e-73	2.86e-83	0.9514
1. PBF	A6WYH9	Uracil phosphoribosyltransferase	0.00e+00	1.43e-64	1.68e-72	0.9797
1. PBF	C1DEU0	Uracil phosphoribosyltransferase	0.00e+00	2.37e-62	2.94e-67	0.983
1. PBF	Q6AQH2	Uracil phosphoribosyltransferase	0.00e+00	8.11e-63	2.82e-65	0.9845
1. PBF	B2GFU4	Uracil phosphoribosyltransferase	0.00e+00	5.46e-62	1.96e-59	0.9545
1. PBF	A7ZPU1	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9756
1. PBF	Q8FRQ5	Uracil phosphoribosyltransferase	0.00e+00	8.16e-57	3.44e-55	0.9491
1. PBF	Q74EM9	Uracil phosphoribosyltransferase	0.00e+00	2.77e-62	2.34e-55	0.9772
1. PBF	A5IYF5	Uracil phosphoribosyltransferase	0.00e+00	2.76e-63	2.61e-64	0.9673
1. PBF	Q042K8	Uracil phosphoribosyltransferase	0.00e+00	6.29e-65	5.27e-78	0.9712
1. PBF	B4U4M9	Uracil phosphoribosyltransferase	0.00e+00	1.36e-68	4.38e-85	0.9666
1. PBF	B8FZ68	Uracil phosphoribosyltransferase	0.00e+00	1.21e-72	8.80e-75	0.9714
1. PBF	P43857	Uracil phosphoribosyltransferase	0.00e+00	1.90e-65	4.57e-66	0.9762
1. PBF	Q0TNB4	Uracil phosphoribosyltransferase	0.00e+00	3.23e-73	5.94e-81	0.9581
1. PBF	B7HY75	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9672
1. PBF	B2HU54	Uracil phosphoribosyltransferase	0.00e+00	4.00e-58	7.94e-65	0.982
1. PBF	B5FQJ0	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9757
1. PBF	P75081	Uracil phosphoribosyltransferase	0.00e+00	6.10e-67	4.57e-60	0.9742
1. PBF	Q9A627	Uracil phosphoribosyltransferase	0.00e+00	1.17e-65	2.09e-74	0.9747
1. PBF	B1JSF5	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9765
1. PBF	Q8ZWV9	Uracil phosphoribosyltransferase	0.00e+00	1.25e-56	1.01e-35	0.9201
1. PBF	A5HY41	Uracil phosphoribosyltransferase	0.00e+00	3.57e-74	2.78e-82	0.9498
1. PBF	A9M3K6	Uracil phosphoribosyltransferase	0.00e+00	2.64e-67	6.81e-63	0.9753
1. PBF	A7FG38	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9768
1. PBF	B2T2A6	Uracil phosphoribosyltransferase	0.00e+00	1.89e-54	4.00e-58	0.964
1. PBF	C5BXA3	Uracil phosphoribosyltransferase	0.00e+00	2.47e-58	1.41e-52	0.9471
1. PBF	P0A2M6	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9758
1. PBF	B1ZKA1	Adenine phosphoribosyltransferase	2.56e-08	1.09e-16	0.030	0.5525
1. PBF	A6TCB0	Uracil phosphoribosyltransferase	0.00e+00	4.35e-66	1.82e-64	0.9801
1. PBF	A9MHP1	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9762
1. PBF	Q9CEC9	Uracil phosphoribosyltransferase	0.00e+00	1.50e-60	7.05e-82	0.9638
1. PBF	Q0I4P2	Uracil phosphoribosyltransferase	0.00e+00	2.08e-62	1.32e-66	0.9753
1. PBF	B5FGY4	Uracil phosphoribosyltransferase	0.00e+00	2.11e-66	3.05e-67	0.9759
1. PBF	Q5F9P0	Uracil phosphoribosyltransferase	0.00e+00	8.22e-68	8.39e-64	0.9719
1. PBF	A1SDD5	Uracil phosphoribosyltransferase	0.00e+00	1.77e-57	4.96e-61	0.9328
1. PBF	Q630T4	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9709
1. PBF	B1L7Y5	Uracil phosphoribosyltransferase	0.00e+00	2.19e-64	9.80e-69	0.9605
1. PBF	Q98QP6	Uracil phosphoribosyltransferase	0.00e+00	6.57e-61	1.05e-60	0.9734
1. PBF	Q831G0	Uracil phosphoribosyltransferase	0.00e+00	2.15e-71	3.62e-86	0.9679
1. PBF	B5Z035	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9761
1. PBF	Q2FF16	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9747
1. PBF	Q6LN74	Uracil phosphoribosyltransferase	0.00e+00	1.04e-64	5.26e-66	0.9769
1. PBF	B6YTB2	Uracil phosphoribosyltransferase	0.00e+00	4.69e-50	3.77e-44	0.9348
1. PBF	P9WFF2	Uracil phosphoribosyltransferase	0.00e+00	3.07e-62	4.25e-56	0.9515
1. PBF	Q4JTK4	Uracil phosphoribosyltransferase	0.00e+00	7.08e-55	7.77e-55	0.9535
1. PBF	Q9JV58	Uracil phosphoribosyltransferase	0.00e+00	8.66e-67	1.88e-63	0.975
1. PBF	B4E5R5	Uracil phosphoribosyltransferase	0.00e+00	4.27e-53	5.45e-57	0.9651
1. PBF	Q6MS86	Uracil phosphoribosyltransferase	0.00e+00	1.14e-102	2.96e-151	0.9895
1. PBF	Q5X340	Uracil phosphoribosyltransferase	0.00e+00	2.34e-61	1.01e-68	0.9638
1. PBF	B1VNY5	Uracil phosphoribosyltransferase	0.00e+00	7.29e-61	1.65e-56	0.9498
1. PBF	C5BHQ5	Uracil phosphoribosyltransferase	0.00e+00	4.47e-66	3.22e-65	0.9754
1. PBF	C3N7P3	Uracil phosphoribosyltransferase	0.00e+00	6.36e-50	8.13e-34	0.9028
1. PBF	B8DVI9	Uracil phosphoribosyltransferase	0.00e+00	7.76e-60	1.24e-46	0.9456
1. PBF	Q81JY5	Uracil phosphoribosyltransferase	0.00e+00	1.93e-70	2.25e-78	0.9716
1. PBF	B0RRQ3	Uracil phosphoribosyltransferase	0.00e+00	3.94e-54	1.76e-60	0.9704
1. PBF	Q5Z187	Uracil phosphoribosyltransferase	0.00e+00	1.50e-61	3.28e-53	0.9478
1. PBF	Q9RE01	Uracil phosphoribosyltransferase	0.00e+00	1.13e-69	8.68e-79	0.9573
1. PBF	Q8DST6	Uracil phosphoribosyltransferase	0.00e+00	4.69e-71	3.56e-85	0.9667
1. PBF	Q93CX7	Uracil phosphoribosyltransferase	0.00e+00	1.02e-66	1.04e-79	0.971
1. PBF	P67395	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	0.9745
1. PBF	Q72DA4	Uracil phosphoribosyltransferase	0.00e+00	2.03e-64	9.87e-63	0.9723
1. PBF	Q48V26	Uracil phosphoribosyltransferase	0.00e+00	3.65e-67	5.30e-82	0.9711
1. PBF	B3DPH5	Uracil phosphoribosyltransferase	0.00e+00	2.33e-56	5.16e-49	0.9551
1. PBF	A1RKQ4	Uracil phosphoribosyltransferase	0.00e+00	5.21e-61	6.90e-64	0.9758
1. PBF	A5IE48	Uracil phosphoribosyltransferase	0.00e+00	3.99e-62	1.51e-68	0.9687
1. PBF	A5UBP1	Uracil phosphoribosyltransferase	0.00e+00	1.90e-65	4.57e-66	0.9764
1. PBF	Q2A285	Uracil phosphoribosyltransferase	0.00e+00	1.66e-60	5.40e-59	0.9788
1. PBF	B8GYP3	Uracil phosphoribosyltransferase	0.00e+00	1.17e-65	2.09e-74	0.9737
1. PBF	B7MYC5	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	0.9757
1. PBF	A4IZ90	Uracil phosphoribosyltransferase	0.00e+00	2.26e-60	5.12e-59	0.9784
1. PBF	Q03QY1	Uracil phosphoribosyltransferase	0.00e+00	3.36e-71	2.97e-82	0.9586
1. PBF	B8IZH6	Uracil phosphoribosyltransferase	0.00e+00	2.06e-57	5.69e-61	0.975
1. PBF	B8DP34	Uracil phosphoribosyltransferase	0.00e+00	7.58e-65	1.84e-62	0.9755
1. PBF	Q7NS06	Uracil phosphoribosyltransferase	0.00e+00	3.59e-63	7.14e-67	0.9753
1. PBF	Q7WB58	Uracil phosphoribosyltransferase	0.00e+00	3.16e-60	3.42e-66	0.9769
1. PBF	A9W0A8	Adenine phosphoribosyltransferase	2.53e-08	1.14e-16	0.026	0.5522
1. PBF	Q2S320	Uracil phosphoribosyltransferase	0.00e+00	6.32e-64	1.95e-67	0.9648
1. PBF	A7ZFB7	Uracil phosphoribosyltransferase	0.00e+00	7.24e-66	4.92e-64	0.9642
1. PBF	B5BB06	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.976
1. PBF	B8CN81	Uracil phosphoribosyltransferase	0.00e+00	2.07e-63	1.72e-62	0.9746
1. PBF	C0PYQ8	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9758
1. PBF	A3M2R1	Uracil phosphoribosyltransferase	0.00e+00	3.24e-59	8.85e-65	0.9834
1. PBF	B4SS22	Uracil phosphoribosyltransferase	0.00e+00	1.50e-53	9.76e-64	0.9804
1. PBF	Q9RU32	Uracil phosphoribosyltransferase	0.00e+00	2.32e-60	4.58e-62	0.9467
1. PBF	Q2SN06	Uracil phosphoribosyltransferase	0.00e+00	2.70e-62	1.04e-63	0.9726
1. PBF	P70881	Uracil phosphoribosyltransferase	0.00e+00	2.30e-67	2.10e-76	0.967
1. PBF	Q04DP1	Uracil phosphoribosyltransferase	0.00e+00	1.54e-67	5.88e-83	0.9528
1. PBF	B6EJU2	Uracil phosphoribosyltransferase	0.00e+00	4.70e-65	1.67e-66	0.9758
1. PBF	Q98GV3	Uracil phosphoribosyltransferase	0.00e+00	1.76e-61	1.60e-64	0.9791
1. PBF	B2HDV9	Uracil phosphoribosyltransferase	0.00e+00	5.33e-63	6.77e-54	0.9541
1. PBF	C6A3U9	Uracil phosphoribosyltransferase	0.00e+00	2.13e-44	6.10e-37	0.9299
1. PBF	Q1CK39	Uracil phosphoribosyltransferase	0.00e+00	1.55e-64	9.69e-65	0.9769
1. PBF	B0T2R0	Uracil phosphoribosyltransferase	0.00e+00	2.76e-63	2.08e-68	0.9757
1. PBF	A9N2Y1	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9757
1. PBF	A3N7G1	Uracil phosphoribosyltransferase	0.00e+00	2.60e-51	2.82e-56	0.9669
1. PBF	Q1MMV8	Uracil phosphoribosyltransferase	0.00e+00	6.15e-64	1.37e-67	0.9755
1. PBF	B9DTU7	Uracil phosphoribosyltransferase	0.00e+00	3.08e-70	9.37e-86	0.9702
1. PBF	P0A2M5	Uracil phosphoribosyltransferase	0.00e+00	2.76e-66	4.72e-65	0.9757
2. PF	B4S410	Adenine phosphoribosyltransferase	4.28e-08	1.81e-15	NA	0.5802
2. PF	A0KY07	Adenine phosphoribosyltransferase	1.50e-08	1.16e-14	NA	0.6428
2. PF	C3L8M1	Xanthine phosphoribosyltransferase	9.17e-09	3.28e-19	NA	0.604
2. PF	Q83M42	Adenine phosphoribosyltransferase	2.01e-08	1.47e-14	NA	0.6448
2. PF	A0RJ16	Adenine phosphoribosyltransferase	2.09e-07	4.81e-12	NA	0.4653
2. PF	Q03W57	Adenine phosphoribosyltransferase	3.50e-08	5.93e-13	NA	0.5052
2. PF	Q2T199	Adenine phosphoribosyltransferase	9.75e-09	1.45e-12	NA	0.576
2. PF	Q6GC84	Xanthine phosphoribosyltransferase	4.76e-05	2.27e-18	NA	0.6052
2. PF	Q1WSL3	Xanthine phosphoribosyltransferase	8.77e-09	7.25e-18	NA	0.6222
2. PF	Q634D6	Adenine phosphoribosyltransferase	1.99e-07	5.40e-12	NA	0.471
2. PF	Q15RT2	Adenine phosphoribosyltransferase	7.88e-08	3.50e-16	NA	0.5522
2. PF	B0UWQ8	Adenine phosphoribosyltransferase	8.78e-08	3.13e-14	NA	0.6171
2. PF	Q2JI33	Adenine phosphoribosyltransferase	4.17e-07	3.42e-11	NA	0.6104
2. PF	Q8P469	Orotate phosphoribosyltransferase	3.98e-07	5.55e-13	NA	0.4435
2. PF	Q5YTF5	Adenine phosphoribosyltransferase	1.91e-07	2.04e-12	NA	0.483
2. PF	C9RH78	Hypoxanthine/guanine phosphoribosyltransferase	2.02e-08	1.69e-15	NA	0.6203
2. PF	Q0I3U5	Adenine phosphoribosyltransferase	8.66e-08	3.13e-14	NA	0.6171
2. PF	Q98HV0	Adenine phosphoribosyltransferase	2.23e-08	3.91e-18	NA	0.5289
2. PF	B3H0A8	Adenine phosphoribosyltransferase	5.43e-08	8.52e-16	NA	0.6275
2. PF	A5VLG9	Xanthine phosphoribosyltransferase	1.56e-08	8.16e-16	NA	0.608
2. PF	P43856	Adenine phosphoribosyltransferase	5.99e-08	1.01e-14	NA	0.5957
2. PF	A7Z5W2	Xanthine phosphoribosyltransferase	6.07e-09	2.72e-18	NA	0.6081
2. PF	Q48QC3	Xanthine phosphoribosyltransferase	7.07e-09	1.07e-17	NA	0.6186
2. PF	P0DH49	Xanthine phosphoribosyltransferase	6.06e-09	9.58e-17	NA	0.6132
2. PF	B7IIS0	Adenine phosphoribosyltransferase	2.10e-07	5.40e-12	NA	0.4844
2. PF	Q71YD1	Xanthine phosphoribosyltransferase	7.22e-09	2.23e-18	NA	0.6414
2. PF	Q38VB9	Xanthine phosphoribosyltransferase	1.34e-08	1.71e-15	NA	0.6139
2. PF	Q7VRB8	Adenine phosphoribosyltransferase	3.43e-08	3.93e-13	NA	0.4784
2. PF	Q6AQG4	Xanthine-guanine phosphoribosyltransferase	3.27e-07	7.22e-08	NA	0.5819
2. PF	A9L5S5	Adenine phosphoribosyltransferase	1.60e-08	4.06e-15	NA	0.6169
2. PF	Q8E5B5	Xanthine phosphoribosyltransferase	5.50e-09	3.30e-16	NA	0.6145
2. PF	B6EJ41	Adenine phosphoribosyltransferase	4.45e-08	9.01e-15	NA	0.6473
2. PF	Q87MQ1	Adenine phosphoribosyltransferase	3.91e-08	1.55e-15	NA	0.6461
2. PF	Q1JBS4	Xanthine phosphoribosyltransferase	5.98e-09	9.58e-17	NA	0.6132
2. PF	B1IME3	Adenine phosphoribosyltransferase	1.59e-07	3.79e-14	NA	0.6088
2. PF	A1JNC2	Adenine phosphoribosyltransferase	4.88e-08	3.68e-13	NA	0.6398
2. PF	Q8AAN7	Xanthine phosphoribosyltransferase	5.67e-09	9.87e-17	NA	0.5956
2. PF	P57841	Adenine phosphoribosyltransferase	4.32e-08	9.42e-16	NA	0.6318
2. PF	A6LC43	Xanthine phosphoribosyltransferase	1.30e-08	7.61e-14	NA	0.6267
2. PF	A1S560	Adenine phosphoribosyltransferase	2.94e-08	4.87e-16	NA	0.5453
2. PF	A7GCI1	Xanthine phosphoribosyltransferase 2	8.29e-09	3.98e-13	NA	0.6205
2. PF	A6UBS2	Adenine phosphoribosyltransferase	3.26e-08	4.87e-17	NA	0.579
2. PF	P51354	Uracil phosphoribosyltransferase homolog	1.11e-16	2.01e-09	NA	0.7811
2. PF	B2VHU9	Adenine phosphoribosyltransferase	2.40e-08	4.18e-14	NA	0.6403
2. PF	O33174	Hypoxanthine/guanine phosphoribosyltransferase	2.63e-08	1.24e-14	NA	0.5928
2. PF	Q325C7	Adenine phosphoribosyltransferase	2.38e-08	1.51e-14	NA	0.65
2. PF	Q8Q0J4	Orotate phosphoribosyltransferase	5.16e-07	8.31e-10	NA	0.4721
2. PF	A7Z756	Adenine phosphoribosyltransferase	3.21e-07	6.14e-12	NA	0.5462
2. PF	Q92N62	Adenine phosphoribosyltransferase	2.13e-08	6.93e-18	NA	0.5527
2. PF	P58859	Orotate phosphoribosyltransferase	4.58e-07	5.73e-10	NA	0.4534
2. PF	A4JHX7	Adenine phosphoribosyltransferase	2.03e-08	6.07e-12	NA	0.5722
2. PF	B4STF6	Orotate phosphoribosyltransferase	4.31e-07	3.67e-12	NA	0.4269
2. PF	B5IAJ6	Hypoxanthine/guanine phosphoribosyltransferase	1.15e-05	1.65e-13	NA	0.5954
2. PF	Q5FMD9	Xanthine phosphoribosyltransferase	8.57e-09	1.58e-19	NA	0.6172
2. PF	Q891I6	Xanthine phosphoribosyltransferase	8.19e-09	3.07e-16	NA	0.6236
2. PF	Q8XNJ8	Xanthine phosphoribosyltransferase 1	1.11e-08	1.06e-14	NA	0.6278
2. PF	B2FJX2	Orotate phosphoribosyltransferase	3.49e-07	2.43e-13	NA	0.416
2. PF	B9DNG3	Adenine phosphoribosyltransferase	2.30e-07	1.26e-12	NA	0.492
2. PF	Q1J141	Xanthine phosphoribosyltransferase	1.29e-08	1.35e-15	NA	0.5407
2. PF	B9ML31	Adenine phosphoribosyltransferase	3.52e-07	1.89e-15	NA	0.5477
2. PF	Q48TL5	Xanthine phosphoribosyltransferase	5.98e-09	9.58e-17	NA	0.6137
2. PF	B1I857	Xanthine phosphoribosyltransferase	4.94e-09	9.17e-17	NA	0.6116
2. PF	Q97GU0	Adenine phosphoribosyltransferase	2.45e-07	1.99e-14	NA	0.6139
2. PF	C1DBA1	Xanthine phosphoribosyltransferase	1.05e-08	3.40e-14	NA	0.6373
2. PF	A6VMZ1	Adenine phosphoribosyltransferase	1.31e-07	4.34e-16	NA	0.6376
2. PF	Q7MT44	Xanthine phosphoribosyltransferase	8.86e-09	1.09e-16	NA	0.5947
2. PF	A1RIP7	Adenine phosphoribosyltransferase	1.33e-08	1.21e-14	NA	0.6756
2. PF	Q9JYB4	Adenine phosphoribosyltransferase	8.56e-09	8.78e-17	NA	0.6625
2. PF	Q8DNL1	Xanthine phosphoribosyltransferase	4.94e-09	2.62e-17	NA	0.6137
2. PF	O27375	Hypoxanthine/guanine phosphoribosyltransferase	3.65e-08	2.31e-15	NA	0.544
2. PF	Q6GJQ9	Xanthine phosphoribosyltransferase	4.70e-05	1.53e-18	NA	0.5838
2. PF	Q1CL33	Adenine phosphoribosyltransferase	3.19e-08	1.42e-13	NA	0.6187
2. PF	Q1XDD3	Uracil phosphoribosyltransferase homolog	2.22e-16	4.34e-11	NA	0.7474
2. PF	A9I0U7	Adenine phosphoribosyltransferase	1.47e-08	5.25e-17	NA	0.5811
2. PF	Q4UPQ3	Orotate phosphoribosyltransferase	3.68e-07	5.55e-13	NA	0.4436
2. PF	Q8ZTG3	Orotate phosphoribosyltransferase	2.84e-07	5.00e-12	NA	0.5823
2. PF	B1LJM6	Adenine phosphoribosyltransferase	2.23e-08	1.51e-14	NA	0.6504
2. PF	Q2A1J5	Adenine phosphoribosyltransferase	1.04e-07	2.89e-13	NA	0.6137
2. PF	A7MJV7	Adenine phosphoribosyltransferase	1.89e-08	1.17e-13	NA	0.6665
2. PF	A3PGY5	Adenine phosphoribosyltransferase	5.41e-08	1.47e-15	NA	0.5857
2. PF	Q49WY6	Orotate phosphoribosyltransferase	3.28e-07	2.69e-16	NA	0.5484
2. PF	Q4QJV7	Adenine phosphoribosyltransferase	5.88e-08	1.01e-14	NA	0.5579
2. PF	C3P5T8	Xanthine phosphoribosyltransferase	8.77e-09	3.28e-19	NA	0.6099
2. PF	Q2YM57	Adenine phosphoribosyltransferase	3.17e-08	1.35e-18	NA	0.6471
2. PF	Q64VN7	Xanthine phosphoribosyltransferase	7.85e-09	1.17e-17	NA	0.6006
2. PF	Q7MIV1	Adenine phosphoribosyltransferase	4.22e-08	1.48e-13	NA	0.5403
2. PF	A7GNB6	Xanthine phosphoribosyltransferase	8.61e-09	7.25e-18	NA	0.641
2. PF	A8AXD5	Xanthine phosphoribosyltransferase	5.93e-09	1.35e-15	NA	0.6093
2. PF	Q145V4	Adenine phosphoribosyltransferase	4.30e-09	6.80e-11	NA	0.4902
2. PF	Q98AN7	Orotate phosphoribosyltransferase 1	3.02e-07	3.35e-13	NA	0.4688
2. PF	C4ZUS3	Adenine phosphoribosyltransferase	2.24e-08	1.51e-14	NA	0.6501
2. PF	Q9X1A4	Adenine phosphoribosyltransferase	2.71e-07	1.69e-13	NA	0.5514
2. PF	B4EU76	Adenine phosphoribosyltransferase	3.92e-08	1.66e-14	NA	0.5312
2. PF	B5Z3X9	Adenine phosphoribosyltransferase	1.90e-08	1.24e-14	NA	0.6452
2. PF	Q49UU6	Xanthine phosphoribosyltransferase	8.56e-09	7.20e-19	NA	0.5761
2. PF	B1KNJ9	Adenine phosphoribosyltransferase	2.48e-08	1.49e-15	NA	0.6372
2. PF	A3D5Q5	Adenine phosphoribosyltransferase	1.52e-08	4.06e-15	NA	0.6178
2. PF	Q11GC0	Adenine phosphoribosyltransferase	5.87e-08	2.66e-17	NA	0.5148
2. PF	Q13CJ6	Orotate phosphoribosyltransferase	1.34e-07	2.85e-13	NA	0.4787
2. PF	A4IN63	Xanthine phosphoribosyltransferase	8.82e-09	4.11e-20	NA	0.638
2. PF	C4L531	Adenine phosphoribosyltransferase	2.04e-07	2.55e-15	NA	0.6688
2. PF	Q0TKH2	Adenine phosphoribosyltransferase	2.26e-08	1.51e-14	NA	0.6501
2. PF	Q493A5	Adenine phosphoribosyltransferase	5.64e-08	3.22e-13	NA	0.5175
2. PF	B2GDT2	Xanthine phosphoribosyltransferase	1.45e-08	3.42e-17	NA	0.6125
2. PF	Q0SW58	Xanthine phosphoribosyltransferase 1	1.11e-08	1.06e-14	NA	0.628
2. PF	A1SX04	Adenine phosphoribosyltransferase	4.16e-08	4.47e-16	NA	0.5645
2. PF	B8CMY5	Adenine phosphoribosyltransferase	7.93e-09	7.28e-16	NA	0.6473
2. PF	Q9CL73	Xanthine-guanine phosphoribosyltransferase	1.47e-07	1.81e-05	NA	0.5364
2. PF	P63542	Adenine phosphoribosyltransferase	3.06e-08	1.35e-18	NA	0.6467
2. PF	A1UFB6	Adenine phosphoribosyltransferase	1.16e-07	1.51e-12	NA	0.5223
2. PF	Q83H88	Orotate phosphoribosyltransferase	1.83e-07	5.13e-04	NA	0.4466
2. PF	Q20WV6	Orotate phosphoribosyltransferase	1.23e-07	1.10e-12	NA	0.4647
2. PF	Q01QQ9	Adenine phosphoribosyltransferase	1.37e-07	4.20e-13	NA	0.6149
2. PF	Q8ZC94	Adenine phosphoribosyltransferase	3.10e-08	1.42e-13	NA	0.6188
2. PF	A7GHS8	Adenine phosphoribosyltransferase	1.51e-07	3.79e-14	NA	0.6083
2. PF	Q7NRK9	Adenine phosphoribosyltransferase	1.84e-08	1.07e-13	NA	0.6702
2. PF	A8YXG4	Xanthine phosphoribosyltransferase	7.86e-09	7.47e-20	NA	0.6226
2. PF	P57339	Xanthine-guanine phosphoribosyltransferase	1.40e-07	7.16e-06	NA	0.5985
2. PF	Q3K111	Xanthine phosphoribosyltransferase	5.71e-09	3.30e-16	NA	0.6148
2. PF	C5BCZ7	Adenine phosphoribosyltransferase	1.75e-08	8.14e-14	NA	0.64
2. PF	A4YPM4	Adenine phosphoribosyltransferase	3.77e-08	1.18e-15	NA	0.5213
2. PF	A4XI79	Adenine phosphoribosyltransferase	3.59e-07	2.77e-15	NA	0.5604
2. PF	Q7A1T6	Xanthine phosphoribosyltransferase	4.97e-05	2.27e-18	NA	0.595
2. PF	B4TMG1	Adenine phosphoribosyltransferase	1.91e-08	4.06e-14	NA	0.6439
2. PF	A8IEI6	Adenine phosphoribosyltransferase	9.89e-08	3.04e-17	NA	0.5222
2. PF	Q3BNB6	Orotate phosphoribosyltransferase	3.53e-07	9.55e-13	NA	0.4439
2. PF	B4SWX6	Adenine phosphoribosyltransferase	1.84e-08	4.06e-14	NA	0.6439
2. PF	Q1BTI4	Adenine phosphoribosyltransferase	2.18e-08	7.70e-11	NA	0.5716
2. PF	B7HHX2	Xanthine phosphoribosyltransferase	1.02e-08	6.24e-18	NA	0.6178
2. PF	Q1QVQ9	Adenine phosphoribosyltransferase	2.23e-08	2.73e-14	NA	0.5501
2. PF	C1B4D6	Adenine phosphoribosyltransferase	6.24e-08	4.23e-14	NA	0.5312
2. PF	C1CG72	Xanthine phosphoribosyltransferase	5.07e-09	9.17e-17	NA	0.6136
2. PF	A7FY09	Adenine phosphoribosyltransferase	1.52e-07	3.79e-14	NA	0.609
2. PF	A5EST0	Orotate phosphoribosyltransferase	2.19e-07	6.01e-13	NA	0.4292
2. PF	P99144	Orotate phosphoribosyltransferase	2.45e-07	2.36e-17	NA	0.538
2. PF	Q167V0	Adenine phosphoribosyltransferase	2.72e-08	3.25e-16	NA	0.6048
2. PF	A8GAU8	Adenine phosphoribosyltransferase	4.27e-08	1.01e-10	NA	0.5927
2. PF	Q031A0	Adenine phosphoribosyltransferase	1.64e-07	7.43e-13	NA	0.6197
2. PF	A9MLY9	Adenine phosphoribosyltransferase	1.92e-08	3.95e-14	NA	0.6439
2. PF	Q1GE59	Adenine phosphoribosyltransferase	2.94e-08	2.10e-14	NA	0.6679
2. PF	Q730C4	Adenine phosphoribosyltransferase	1.97e-07	4.81e-12	NA	0.4927
2. PF	B2SXI3	Adenine phosphoribosyltransferase	5.64e-09	3.45e-10	NA	0.4892
2. PF	A4SX83	Adenine phosphoribosyltransferase	2.97e-07	3.16e-10	NA	0.5922
2. PF	C1CMF7	Xanthine phosphoribosyltransferase	4.63e-09	1.14e-16	NA	0.612
2. PF	A1A8D5	Adenine phosphoribosyltransferase	2.16e-08	1.51e-14	NA	0.645
2. PF	B0TWU0	Adenine phosphoribosyltransferase	1.12e-07	4.43e-13	NA	0.5781
2. PF	B9IVT8	Xanthine phosphoribosyltransferase	1.12e-08	3.28e-19	NA	0.6029
2. PF	B1XUX7	Adenine phosphoribosyltransferase	2.92e-07	4.18e-10	NA	0.6024
2. PF	A1RRV2	Orotate phosphoribosyltransferase	4.38e-07	4.85e-14	NA	0.5398
2. PF	Q9RTY2	Xanthine phosphoribosyltransferase	9.41e-09	8.04e-17	NA	0.5586
2. PF	A4WLH7	Orotate phosphoribosyltransferase	9.52e-07	2.56e-13	NA	0.4485
2. PF	Q5LEQ1	Xanthine phosphoribosyltransferase	7.61e-09	1.17e-17	NA	0.6007
2. PF	Q88CB6	Xanthine phosphoribosyltransferase	6.37e-09	2.69e-16	NA	0.6156
2. PF	Q8K9R8	Xanthine-guanine phosphoribosyltransferase	1.53e-07	3.43e-07	NA	0.5704
2. PF	D7DQT8	Hypoxanthine/guanine phosphoribosyltransferase	7.03e-08	5.01e-15	NA	0.5815
2. PF	A6WZD8	Adenine phosphoribosyltransferase	4.40e-08	5.88e-18	NA	0.7447
2. PF	Q74LF9	Xanthine phosphoribosyltransferase	5.26e-09	1.16e-18	NA	0.6226
2. PF	B0CHX9	Adenine phosphoribosyltransferase	6.53e-08	3.63e-18	NA	0.6102
2. PF	F0T7W2	Hypoxanthine/guanine phosphoribosyltransferase	1.27e-05	8.03e-14	NA	0.594
2. PF	B7NIG1	Adenine phosphoribosyltransferase	2.34e-08	1.51e-14	NA	0.65
2. PF	A5IPW7	Xanthine phosphoribosyltransferase	5.01e-05	1.60e-18	NA	0.612
2. PF	P63543	Adenine phosphoribosyltransferase	2.75e-08	1.35e-18	NA	0.6659
2. PF	Q3IKN5	Adenine phosphoribosyltransferase	5.48e-08	2.48e-15	NA	0.5981
2. PF	Q20Y76	Adenine phosphoribosyltransferase	1.48e-07	9.62e-12	NA	0.4985
2. PF	Q97P00	Xanthine phosphoribosyltransferase	5.37e-09	1.23e-17	NA	0.6366
2. PF	B7V5I9	Xanthine phosphoribosyltransferase	7.23e-09	2.82e-17	NA	0.6162
2. PF	A6TYN9	Xanthine phosphoribosyltransferase	5.05e-05	1.60e-18	NA	0.6055
2. PF	Q5WI27	Xanthine phosphoribosyltransferase	7.49e-09	9.75e-20	NA	0.5442
2. PF	A1WDB0	Adenine phosphoribosyltransferase	1.67e-08	1.74e-16	NA	0.5644
2. PF	A8AJX4	Adenine phosphoribosyltransferase	1.91e-08	2.10e-14	NA	0.644
2. PF	Q817X3	Adenine phosphoribosyltransferase	2.11e-07	5.40e-12	NA	0.5215
2. PF	B2ISU6	Xanthine phosphoribosyltransferase	5.06e-09	4.33e-17	NA	0.6114
2. PF	Q64427	Adenine phosphoribosyltransferase	9.18e-08	4.09e-13	NA	0.4963
2. PF	B2HZ61	Xanthine phosphoribosyltransferase	6.04e-09	1.15e-17	NA	0.6343
2. PF	Q04R73	Orotate phosphoribosyltransferase	1.49e-06	2.18e-13	NA	0.5463
2. PF	B9LCT9	Xanthine phosphoribosyltransferase	8.86e-09	4.08e-17	NA	0.6107
2. PF	A3N5L9	Adenine phosphoribosyltransferase	1.35e-08	1.10e-13	NA	0.5674
2. PF	B7L794	Adenine phosphoribosyltransferase	2.06e-08	1.51e-14	NA	0.6496
2. PF	A5I0Y0	Xanthine phosphoribosyltransferase 2	6.51e-09	3.26e-14	NA	0.6208
2. PF	Q7VKQ4	Adenine phosphoribosyltransferase	5.25e-08	2.66e-15	NA	0.6192
2. PF	A1A190	Xanthine phosphoribosyltransferase	2.00e-08	1.97e-19	NA	0.6239
2. PF	Q9AGS1	Xanthine phosphoribosyltransferase	4.29e-09	7.25e-17	NA	0.615
2. PF	B8ZN87	Xanthine phosphoribosyltransferase	5.09e-09	9.17e-17	NA	0.6132
2. PF	C7P7L7	Hypoxanthine/guanine phosphoribosyltransferase	3.17e-08	1.24e-14	NA	0.6116
2. PF	Q8PFS5	Orotate phosphoribosyltransferase	3.47e-07	8.71e-13	NA	0.4283
2. PF	Q04IV9	Xanthine phosphoribosyltransferase	5.37e-09	2.62e-17	NA	0.6137
2. PF	B0S259	Xanthine phosphoribosyltransferase	9.50e-09	1.07e-15	NA	0.6119
2. PF	A3QF54	Adenine phosphoribosyltransferase	3.42e-08	8.06e-15	NA	0.6482
2. PF	Q32J49	Adenine phosphoribosyltransferase	2.41e-08	1.51e-14	NA	0.6496
2. PF	Q02E64	Xanthine phosphoribosyltransferase	7.31e-09	2.82e-17	NA	0.6218
2. PF	O67742	Orotate phosphoribosyltransferase	7.01e-08	1.07e-11	NA	0.5403
2. PF	P42085	Xanthine phosphoribosyltransferase	4.72e-09	1.85e-19	NA	0.6123
2. PF	A7FL92	Adenine phosphoribosyltransferase	3.48e-08	1.48e-13	NA	0.5328
2. PF	Q080R2	Adenine phosphoribosyltransferase	2.17e-08	1.09e-16	NA	0.6289
2. PF	Q834G6	Adenine phosphoribosyltransferase	1.91e-07	4.86e-13	NA	0.4759
2. PF	Q57S81	Adenine phosphoribosyltransferase	1.94e-08	4.06e-14	NA	0.644
2. PF	B5Y0N8	Adenine phosphoribosyltransferase	1.82e-08	4.48e-15	NA	0.6709
2. PF	A5HYL0	Xanthine phosphoribosyltransferase 1	9.63e-09	1.46e-16	NA	0.6179
2. PF	Q0BBS3	Adenine phosphoribosyltransferase	2.63e-08	2.49e-11	NA	0.5631
2. PF	A7FPI7	Xanthine phosphoribosyltransferase 1	8.17e-09	1.46e-16	NA	0.6209
2. PF	A1UZL8	Adenine phosphoribosyltransferase	2.83e-08	5.80e-05	NA	0.5221
2. PF	Q92AC4	Xanthine phosphoribosyltransferase	8.66e-09	5.81e-19	NA	0.6368
2. PF	Q8CQR0	Xanthine phosphoribosyltransferase	8.52e-09	6.63e-18	NA	0.5859
2. PF	A5I6E1	Adenine phosphoribosyltransferase	1.51e-07	3.79e-14	NA	0.6088
2. PF	B8FNN4	Orotate phosphoribosyltransferase	8.99e-07	6.90e-12	NA	0.5196
2. PF	A8Z0Q8	Xanthine phosphoribosyltransferase	4.94e-05	2.27e-18	NA	0.6051
2. PF	Q1RF67	Adenine phosphoribosyltransferase	2.18e-08	1.51e-14	NA	0.6503
2. PF	Q053K4	Orotate phosphoribosyltransferase	1.70e-06	2.07e-13	NA	0.5316
2. PF	Q99ZQ0	Xanthine phosphoribosyltransferase	6.03e-09	9.58e-17	NA	0.6135
2. PF	Q183I0	Adenine phosphoribosyltransferase	2.42e-07	6.26e-13	NA	0.6184
2. PF	B0KQ69	Xanthine phosphoribosyltransferase	6.17e-09	2.69e-16	NA	0.6155
2. PF	Q2FJM8	Xanthine phosphoribosyltransferase	4.73e-05	2.27e-18	NA	0.6053
2. PF	C1CT78	Xanthine phosphoribosyltransferase	5.20e-09	5.10e-17	NA	0.6166
2. PF	C3P995	Adenine phosphoribosyltransferase	2.02e-07	4.81e-12	NA	0.492
2. PF	Q7UYX5	Orotate phosphoribosyltransferase	9.92e-08	4.96e-10	NA	0.4299
2. PF	Q7RVF7	Orotate phosphoribosyltransferase	1.03e-07	2.89e-13	NA	0.5392
2. PF	Q4ZQW4	Adenine phosphoribosyltransferase	7.82e-08	7.25e-18	NA	0.6279
2. PF	Q5HRX4	Xanthine phosphoribosyltransferase	8.74e-09	6.63e-18	NA	0.5801
2. PF	A1B843	Adenine phosphoribosyltransferase	1.41e-07	4.47e-14	NA	0.4918
2. PF	Q185K4	Xanthine phosphoribosyltransferase	7.84e-09	1.36e-15	NA	0.6258
2. PF	A3M938	Xanthine phosphoribosyltransferase	5.85e-09	1.15e-17	NA	0.6264
2. PF	Q48GH3	Adenine phosphoribosyltransferase	6.80e-08	6.74e-17	NA	0.6453
2. PF	Q8RAL9	Adenine phosphoribosyltransferase	2.91e-07	1.93e-13	NA	0.6261
2. PF	A6L3C5	Xanthine phosphoribosyltransferase	1.59e-08	8.77e-16	NA	0.589
2. PF	C3L613	Adenine phosphoribosyltransferase	2.02e-07	4.81e-12	NA	0.4564
2. PF	Q89BL4	Orotate phosphoribosyltransferase	2.00e-07	4.15e-13	NA	0.4837
2. PF	A0JV33	Adenine phosphoribosyltransferase	2.16e-05	3.25e-09	NA	0.6262
2. PF	A0QLX9	Orotate phosphoribosyltransferase	2.19e-07	1.29e-14	NA	0.4229
2. PF	B9MIH9	Adenine phosphoribosyltransferase	1.13e-08	2.94e-16	NA	0.4599
2. PF	D5VT38	Hypoxanthine/guanine phosphoribosyltransferase	4.62e-08	1.54e-13	NA	0.5169
2. PF	A7GA73	Xanthine phosphoribosyltransferase 1	9.71e-09	4.53e-17	NA	0.6177
2. PF	E3GW42	Hypoxanthine/guanine phosphoribosyltransferase	3.73e-08	8.17e-15	NA	0.5011
2. PF	Q3SPC5	Adenine phosphoribosyltransferase	6.58e-08	8.28e-17	NA	0.5099
2. PF	Q8Z8T4	Adenine phosphoribosyltransferase	1.70e-08	5.34e-14	NA	0.6478
2. PF	Q0STE8	Xanthine phosphoribosyltransferase 2	1.09e-08	5.88e-14	NA	0.6422
2. PF	A4VGU2	Xanthine phosphoribosyltransferase	6.09e-09	5.02e-17	NA	0.6203
2. PF	A1TWI0	Adenine phosphoribosyltransferase	1.30e-08	1.13e-16	NA	0.4751
2. PF	Q6GA08	Orotate phosphoribosyltransferase	1.41e-07	1.68e-17	NA	0.6133
2. PF	A2SMH6	Adenine phosphoribosyltransferase	1.50e-08	3.05e-13	NA	0.4765
2. PF	B7JPZ4	Adenine phosphoribosyltransferase	2.39e-07	4.81e-12	NA	0.4652
2. PF	Q63DG7	Xanthine phosphoribosyltransferase	1.26e-08	1.46e-19	NA	0.6048
2. PF	A9M6K5	Adenine phosphoribosyltransferase	4.43e-08	1.35e-18	NA	0.6625
2. PF	Q5KWS2	Adenine phosphoribosyltransferase	2.85e-07	1.84e-11	NA	0.6505
2. PF	C4L0T7	Xanthine phosphoribosyltransferase	3.74e-09	4.47e-19	NA	0.6024
2. PF	A9WQH7	Adenine phosphoribosyltransferase	2.07e-05	5.64e-11	NA	0.6086
2. PF	B5QU72	Adenine phosphoribosyltransferase	1.84e-08	4.06e-14	NA	0.6432
2. PF	Q03UJ4	Xanthine phosphoribosyltransferase	5.01e-09	9.72e-17	NA	0.6203
2. PF	P9WHK8	Orotate phosphoribosyltransferase	1.28e-07	9.80e-15	NA	0.4191
2. PF	Q884U6	Adenine phosphoribosyltransferase	7.05e-08	1.40e-17	NA	0.6284
2. PF	A8FEE7	Xanthine phosphoribosyltransferase	5.59e-09	2.56e-18	NA	0.6155
2. PF	B3WDB0	Xanthine phosphoribosyltransferase	7.33e-09	1.38e-17	NA	0.6081
2. PF	Q046I4	Xanthine phosphoribosyltransferase	5.05e-09	6.27e-19	NA	0.6248
2. PF	B7MDZ1	Adenine phosphoribosyltransferase	2.29e-08	1.51e-14	NA	0.6501
2. PF	B7HE42	Adenine phosphoribosyltransferase	2.09e-07	5.40e-12	NA	0.5474
2. PF	Q8EFG1	Adenine phosphoribosyltransferase	1.37e-08	3.13e-13	NA	0.6172
2. PF	B2TL11	Xanthine phosphoribosyltransferase	6.67e-09	1.15e-17	NA	0.6056
2. PF	B4T9H6	Adenine phosphoribosyltransferase	1.92e-08	9.08e-14	NA	0.644
2. PF	B9E8Y3	Xanthine phosphoribosyltransferase	4.74e-09	1.09e-18	NA	0.611
2. PF	Q1GBU9	Xanthine phosphoribosyltransferase	3.75e-09	4.33e-17	NA	0.6335
2. PF	A4QHG9	Orotate phosphoribosyltransferase	2.02e-07	6.51e-13	NA	0.4321
2. PF	B5XLI3	Xanthine phosphoribosyltransferase	6.24e-09	2.73e-16	NA	0.6135
2. PF	B2K6Z1	Adenine phosphoribosyltransferase	3.46e-08	1.48e-13	NA	0.5327
2. PF	Q81LI1	Adenine phosphoribosyltransferase	2.20e-07	4.81e-12	NA	0.4653
2. PF	Q1QIH5	Adenine phosphoribosyltransferase	4.68e-08	8.16e-17	NA	0.6647
2. PF	C3K452	Xanthine phosphoribosyltransferase	6.83e-09	7.58e-17	NA	0.6142
2. PF	B1XFQ6	Adenine phosphoribosyltransferase	2.22e-08	1.51e-14	NA	0.6501
2. PF	B0SCV6	Orotate phosphoribosyltransferase	1.06e-04	5.26e-10	NA	0.5496
2. PF	P0DH48	Xanthine phosphoribosyltransferase	6.06e-09	9.58e-17	NA	0.6138
2. PF	A9VMH5	Xanthine phosphoribosyltransferase	7.69e-09	1.75e-17	NA	0.6053
2. PF	B9DM01	Xanthine phosphoribosyltransferase	5.77e-05	3.63e-18	NA	0.5885
2. PF	Q2KUE4	Adenine phosphoribosyltransferase	1.25e-08	1.69e-16	NA	0.4807
2. PF	B7VL95	Adenine phosphoribosyltransferase	4.39e-08	3.06e-15	NA	0.6458
2. PF	A4XNV9	Xanthine phosphoribosyltransferase	5.76e-09	4.27e-17	NA	0.6045
2. PF	Q831Y0	Xanthine phosphoribosyltransferase	5.95e-09	3.52e-18	NA	0.6097
2. PF	B2G8U2	Xanthine phosphoribosyltransferase	1.93e-08	8.16e-16	NA	0.608
2. PF	Q3JW68	Adenine phosphoribosyltransferase	1.39e-08	7.05e-13	NA	0.5813
2. PF	Q63XK0	Adenine phosphoribosyltransferase	1.71e-08	7.05e-13	NA	0.5769
2. PF	Q5QWS1	Adenine phosphoribosyltransferase	1.96e-08	3.22e-12	NA	0.6223
2. PF	Q6HKZ0	Xanthine phosphoribosyltransferase	1.19e-08	3.28e-19	NA	0.6041
2. PF	Q8UD91	Adenine phosphoribosyltransferase	2.05e-08	3.47e-17	NA	0.5241
2. PF	A8FX87	Adenine phosphoribosyltransferase	1.87e-08	9.15e-16	NA	0.6241
2. PF	B7MQI4	Adenine phosphoribosyltransferase	2.18e-08	1.51e-14	NA	0.65
2. PF	B5FKY7	Adenine phosphoribosyltransferase	1.84e-08	4.06e-14	NA	0.6439
2. PF	Q9PGZ3	Orotate phosphoribosyltransferase	3.01e-07	3.67e-12	NA	0.4255
2. PF	Q03EG0	Xanthine phosphoribosyltransferase	1.10e-08	2.38e-14	NA	0.6394
2. PF	Q5XC74	Xanthine phosphoribosyltransferase	6.35e-09	9.58e-17	NA	0.6135
2. PF	Q83FI4	Orotate phosphoribosyltransferase	1.49e-07	9.83e-04	NA	0.4022
2. PF	Q81SQ5	Xanthine phosphoribosyltransferase	1.21e-08	3.28e-19	NA	0.6041
2. PF	A7ZXC7	Adenine phosphoribosyltransferase	2.28e-08	1.51e-14	NA	0.65
2. PF	A9MW92	Adenine phosphoribosyltransferase	1.95e-08	4.06e-14	NA	0.6438
2. PF	Q2YVL8	Xanthine phosphoribosyltransferase	5.09e-05	8.06e-18	NA	0.6029
2. PF	A4TPB0	Adenine phosphoribosyltransferase	3.16e-08	1.42e-13	NA	0.6192
2. PF	P69504	Adenine phosphoribosyltransferase	2.31e-08	1.51e-14	NA	0.6501
2. PF	Q8G5W1	Xanthine phosphoribosyltransferase	1.92e-08	1.74e-16	NA	0.6319
2. PF	B3EMG7	Adenine phosphoribosyltransferase	3.73e-08	2.21e-15	NA	0.5415
2. PF	B2I6N0	Orotate phosphoribosyltransferase	2.05e-07	7.08e-12	NA	0.4365
2. PF	A9VIN4	Adenine phosphoribosyltransferase	2.01e-07	1.61e-12	NA	0.5475
2. PF	Q0TUB1	Xanthine phosphoribosyltransferase 1	7.55e-09	1.06e-14	NA	0.6281
2. PF	B7I9E1	Xanthine phosphoribosyltransferase	5.82e-09	1.15e-17	NA	0.6263
2. PF	B2JCQ7	Adenine phosphoribosyltransferase	1.22e-08	1.23e-11	NA	0.5553
2. PF	Q04F01	Adenine phosphoribosyltransferase	3.79e-08	1.91e-14	NA	0.575
2. PF	Q3K4P7	Xanthine phosphoribosyltransferase	6.52e-09	2.51e-16	NA	0.6065
2. PF	A8H2P5	Adenine phosphoribosyltransferase	1.72e-08	7.15e-17	NA	0.6505
2. PF	B1JHN6	Adenine phosphoribosyltransferase	3.57e-08	1.48e-13	NA	0.5327
2. PF	F6BB32	Hypoxanthine/guanine phosphoribosyltransferase	3.62e-08	1.81e-13	NA	0.537
2. PF	Q88BA5	Xanthine phosphoribosyltransferase	6.98e-09	1.49e-17	NA	0.619
2. PF	B1YHS1	Xanthine phosphoribosyltransferase	7.25e-09	2.02e-20	NA	0.5856
2. PF	Q8XKV0	Xanthine phosphoribosyltransferase 2	1.05e-08	5.88e-14	NA	0.629
2. PF	C6DB82	Adenine phosphoribosyltransferase	2.16e-08	2.46e-13	NA	0.6363
2. PF	Q5PFK3	Adenine phosphoribosyltransferase	1.90e-08	4.06e-14	NA	0.6438
2. PF	Q2NV62	Adenine phosphoribosyltransferase	3.27e-08	7.84e-13	NA	0.6422
2. PF	A7FT29	Xanthine phosphoribosyltransferase 2	7.06e-09	3.26e-14	NA	0.621
2. PF	Q8Y617	Xanthine phosphoribosyltransferase	7.23e-09	2.23e-18	NA	0.6416
2. PF	Q6HDB8	Adenine phosphoribosyltransferase	2.27e-07	4.81e-12	NA	0.4921
2. PF	A7NEG0	Adenine phosphoribosyltransferase	1.11e-07	2.89e-13	NA	0.6137
2. PF	B3DSF5	Xanthine phosphoribosyltransferase	2.03e-08	1.74e-16	NA	0.6315
2. PF	B8ZLT9	Adenine phosphoribosyltransferase	2.20e-07	2.52e-12	NA	0.5118
2. PF	A4Y7U1	Adenine phosphoribosyltransferase	1.23e-08	1.21e-14	NA	0.6158
2. PF	A5TZA9	Orotate phosphoribosyltransferase	1.32e-07	9.80e-15	NA	0.4198
2. PF	B2RH69	Xanthine phosphoribosyltransferase	8.66e-09	1.09e-16	NA	0.5947
2. PF	A0RC17	Xanthine phosphoribosyltransferase	7.88e-09	1.53e-18	NA	0.607
2. PF	B2S701	Adenine phosphoribosyltransferase	2.81e-08	1.35e-18	NA	0.6487
2. PF	A7ZIM8	Adenine phosphoribosyltransferase	2.13e-08	1.51e-14	NA	0.6499
2. PF	Q2GAK1	Adenine phosphoribosyltransferase	8.41e-08	4.99e-14	NA	0.6944
2. PF	B1L0A2	Adenine phosphoribosyltransferase	1.51e-07	2.96e-14	NA	0.6091
2. PF	Q9X8R7	Orotate phosphoribosyltransferase	1.09e-07	2.37e-13	NA	0.4573
2. PF	A9GUD3	Orotate phosphoribosyltransferase	2.54e-07	4.66e-14	NA	0.4286
2. PF	C0ZJ16	Xanthine phosphoribosyltransferase	6.71e-09	4.89e-20	NA	0.6187
2. PF	P77889	Orotate phosphoribosyltransferase	2.76e-07	1.16e-12	NA	0.4991
2. PF	B9KM05	Adenine phosphoribosyltransferase	4.05e-08	2.58e-15	NA	0.5239
2. PF	F6D512	Hypoxanthine/guanine phosphoribosyltransferase	5.34e-08	3.10e-15	NA	0.5835
2. PF	Q88F33	Adenine phosphoribosyltransferase	1.02e-07	4.66e-17	NA	0.6472
2. PF	A4YL97	Orotate phosphoribosyltransferase	2.09e-07	4.67e-13	NA	0.4367
2. PF	Q04GD7	Xanthine phosphoribosyltransferase	7.64e-09	1.13e-16	NA	0.5857
2. PF	B0UKF2	Adenine phosphoribosyltransferase	5.08e-08	1.18e-18	NA	0.4951
2. PF	Q6GHN0	Orotate phosphoribosyltransferase	1.59e-07	2.36e-17	NA	0.5447
2. PF	Q3AT37	Adenine phosphoribosyltransferase	2.88e-08	8.76e-15	NA	0.5901
2. PF	Q1GTG6	Adenine phosphoribosyltransferase	9.03e-06	2.77e-14	NA	0.7367
2. PF	Q7WEY7	Adenine phosphoribosyltransferase	1.32e-08	5.01e-16	NA	0.5755
2. PF	B0BSS1	Adenine phosphoribosyltransferase	5.36e-08	8.52e-16	NA	0.6277
2. PF	B2V327	Xanthine phosphoribosyltransferase	5.74e-09	8.06e-18	NA	0.5979
2. PF	B7M3W1	Adenine phosphoribosyltransferase	2.05e-08	1.51e-14	NA	0.6498
2. PF	Q8XD48	Adenine phosphoribosyltransferase	1.85e-08	1.24e-14	NA	0.6452
2. PF	B2IBU5	Adenine phosphoribosyltransferase	5.87e-08	2.23e-16	NA	0.5641
2. PF	P63544	Adenine phosphoribosyltransferase	2.17e-07	2.52e-12	NA	0.5131
2. PF	B5E1V8	Xanthine phosphoribosyltransferase	5.07e-09	9.17e-17	NA	0.6137
2. PF	A9KTA4	Xanthine phosphoribosyltransferase	1.57e-08	1.36e-16	NA	0.6186
2. PF	C0Q807	Adenine phosphoribosyltransferase	1.84e-08	4.06e-14	NA	0.644
2. PF	A9WA88	Xanthine phosphoribosyltransferase	2.35e-08	4.08e-17	NA	0.5359
2. PF	Q8DB25	Adenine phosphoribosyltransferase	4.32e-08	1.48e-13	NA	0.5403
2. PF	Q5HIQ9	Xanthine phosphoribosyltransferase	4.81e-05	2.27e-18	NA	0.6052
2. PF	A5VRR9	Adenine phosphoribosyltransferase	2.73e-08	1.35e-18	NA	0.6521
2. PF	P68781	Adenine phosphoribosyltransferase	2.03e-07	2.93e-13	NA	0.4899
2. PF	B8DUR4	Xanthine phosphoribosyltransferase	1.61e-08	4.74e-15	NA	0.6296
2. PF	A5IZD7	Adenine phosphoribosyltransferase	5.33e-07	8.37e-13	NA	0.6117
2. PF	B8I1G1	Xanthine phosphoribosyltransferase	5.67e-09	8.28e-16	NA	0.5825
2. PF	Q9KCQ5	Xanthine phosphoribosyltransferase	7.23e-09	6.48e-20	NA	0.5941
2. PF	Q8ZRA2	Adenine phosphoribosyltransferase	1.96e-08	4.06e-14	NA	0.6437
2. PF	A6TTD6	Xanthine phosphoribosyltransferase	1.44e-08	7.71e-16	NA	0.5997
2. PF	B1YN34	Adenine phosphoribosyltransferase	2.09e-08	2.49e-11	NA	0.5725
2. PF	Q66DQ2	Adenine phosphoribosyltransferase	2.55e-08	1.33e-13	NA	0.6317
2. PF	Q99WJ1	Xanthine phosphoribosyltransferase	4.75e-05	2.27e-18	NA	0.6051
2. PF	Q8DZL5	Xanthine phosphoribosyltransferase	5.44e-09	3.30e-16	NA	0.6146
2. PF	A3DF48	Adenine phosphoribosyltransferase	5.32e-07	8.25e-12	NA	0.5705
2. PF	B0TCJ8	Xanthine phosphoribosyltransferase	6.22e-09	1.29e-15	NA	0.5771
2. PF	Q1JGV7	Xanthine phosphoribosyltransferase	5.88e-09	9.58e-17	NA	0.614
2. PF	D3S8C7	Hypoxanthine/guanine phosphoribosyltransferase	5.48e-06	6.46e-14	NA	0.5134
2. PF	A6LW55	Xanthine phosphoribosyltransferase	6.54e-09	1.69e-15	NA	0.6211
2. PF	A7WY89	Xanthine phosphoribosyltransferase	4.78e-05	2.27e-18	NA	0.6053
2. PF	Q97KP4	Xanthine phosphoribosyltransferase	6.40e-09	2.70e-17	NA	0.596
2. PF	Q6N0N8	Orotate phosphoribosyltransferase	1.25e-07	1.70e-12	NA	0.4787
2. PF	B1LUP7	Adenine phosphoribosyltransferase	3.64e-08	2.93e-18	NA	0.5261
2. PF	A7HVC7	Adenine phosphoribosyltransferase	1.54e-07	6.63e-15	NA	0.5666
2. PF	A4J6I7	Xanthine phosphoribosyltransferase	9.18e-09	3.13e-17	NA	0.6156
2. PF	A4XVK6	Adenine phosphoribosyltransferase	7.83e-08	1.06e-15	NA	0.6289
2. PF	A3MX27	Orotate phosphoribosyltransferase	1.84e-07	2.98e-15	NA	0.6533
2. PF	A0KAK7	Adenine phosphoribosyltransferase	1.69e-08	7.70e-11	NA	0.5724
2. PF	Q57BX7	Adenine phosphoribosyltransferase	2.75e-08	1.35e-18	NA	0.6478
2. PF	B7LLQ1	Adenine phosphoribosyltransferase	1.87e-08	3.59e-14	NA	0.6451
2. PF	Q2P898	Orotate phosphoribosyltransferase	3.66e-07	1.06e-12	NA	0.3868
2. PF	A6WPL2	Adenine phosphoribosyltransferase	1.59e-08	4.06e-15	NA	0.6267
2. PF	Q82EU1	Orotate phosphoribosyltransferase	8.49e-08	3.13e-13	NA	0.4657
2. PF	A1VES8	Xanthine-guanine phosphoribosyltransferase	1.88e-07	1.34e-07	NA	0.5414
2. PF	Q03QP8	Adenine phosphoribosyltransferase	1.84e-07	2.76e-12	NA	0.5367
2. PF	C1C9B2	Xanthine phosphoribosyltransferase	4.88e-09	9.17e-17	NA	0.6111
2. PF	A3MYY8	Adenine phosphoribosyltransferase	5.27e-08	8.52e-16	NA	0.6278
2. PF	Q9RQF8	Adenine phosphoribosyltransferase	2.96e-08	1.53e-17	NA	0.5233
2. PF	B0TNZ8	Adenine phosphoribosyltransferase	1.48e-08	3.21e-16	NA	0.6424
2. PF	B5EXM5	Adenine phosphoribosyltransferase	1.83e-08	4.06e-14	NA	0.6442
2. PF	Q9KT52	Adenine phosphoribosyltransferase	5.28e-08	3.68e-15	NA	0.642
2. PF	B7JHT4	Xanthine phosphoribosyltransferase	9.04e-09	3.28e-19	NA	0.6102
2. PF	Q0HU91	Adenine phosphoribosyltransferase	1.45e-08	5.30e-15	NA	0.6425
2. PF	Q7CN84	Xanthine phosphoribosyltransferase	5.94e-09	9.58e-17	NA	0.6138
2. PF	Q0T7B5	Adenine phosphoribosyltransferase	1.97e-08	1.47e-14	NA	0.645
2. PF	Q7W3L2	Adenine phosphoribosyltransferase	1.25e-08	5.01e-16	NA	0.4992
2. PF	Q47XQ8	Adenine phosphoribosyltransferase	6.51e-08	8.77e-16	NA	0.6118
2. PF	Q21QM7	Adenine phosphoribosyltransferase	1.65e-08	7.41e-15	NA	0.526
2. PF	C0MBC1	Xanthine phosphoribosyltransferase	5.78e-09	3.96e-17	NA	0.6147
2. PF	A7MUE7	Adenine phosphoribosyltransferase	3.51e-08	2.89e-15	NA	0.6469
2. PF	Q2J1V2	Orotate phosphoribosyltransferase	1.50e-07	1.47e-12	NA	0.4759
2. PF	Q73AS5	Xanthine phosphoribosyltransferase	7.88e-09	2.56e-18	NA	0.6043
2. PF	Q6LTE9	Adenine phosphoribosyltransferase	6.50e-08	1.85e-16	NA	0.6303
2. PF	Q72D63	Xanthine-guanine phosphoribosyltransferase	1.41e-07	3.91e-07	NA	0.5391
2. PF	Q1J6M6	Xanthine phosphoribosyltransferase	5.93e-09	9.58e-17	NA	0.6133
2. PF	C4ZA66	Xanthine phosphoribosyltransferase	6.29e-09	6.15e-18	NA	0.5977
2. PF	C1DJZ2	Xanthine phosphoribosyltransferase	5.01e-09	1.27e-19	NA	0.6216
2. PF	Q7VDR1	Orotate phosphoribosyltransferase	1.83e-07	4.12e-12	NA	0.4421
2. PF	B1JYN1	Adenine phosphoribosyltransferase	2.52e-08	8.69e-12	NA	0.572
2. PF	Q9HTQ6	Xanthine phosphoribosyltransferase	7.19e-09	2.62e-17	NA	0.6194
2. PF	Q0S1C1	Adenine phosphoribosyltransferase	9.33e-08	9.53e-15	NA	0.6696
2. PF	C1KWI4	Xanthine phosphoribosyltransferase	5.55e-09	1.65e-18	NA	0.6416
2. PF	Q7A7I5	Xanthine phosphoribosyltransferase	5.01e-05	2.27e-18	NA	0.5949
2. PF	Q8CUP6	Xanthine phosphoribosyltransferase	5.31e-09	9.45e-20	NA	0.6097
2. PF	C1ENK3	Xanthine phosphoribosyltransferase	9.74e-09	1.53e-18	NA	0.6051
2. PF	Q81FL2	Xanthine phosphoribosyltransferase	1.01e-08	9.79e-18	NA	0.6046
2. PF	A5W0U8	Adenine phosphoribosyltransferase	9.86e-08	4.66e-17	NA	0.647
2. PF	A9NGG3	Adenine phosphoribosyltransferase	1.27e-07	4.47e-14	NA	0.5887
2. PF	B7N922	Adenine phosphoribosyltransferase	2.37e-08	1.51e-14	NA	0.65
2. PF	B0SL24	Orotate phosphoribosyltransferase	1.63e-06	5.26e-10	NA	0.5411
2. PF	A5F2N2	Adenine phosphoribosyltransferase	3.63e-08	3.68e-15	NA	0.642
2. PF	Q3Z4T0	Adenine phosphoribosyltransferase	2.24e-08	1.51e-14	NA	0.6503
2. PF	Q5HGM7	Orotate phosphoribosyltransferase	1.89e-07	1.28e-17	NA	0.5213
2. PF	P68779	Adenine phosphoribosyltransferase	1.92e-07	2.93e-13	NA	0.5047
2. PF	B7HQG7	Adenine phosphoribosyltransferase	2.06e-07	4.81e-12	NA	0.5157
2. PF	Q1LRM9	Adenine phosphoribosyltransferase	1.20e-08	3.78e-13	NA	0.5332
2. PF	A6KZN9	Adenine phosphoribosyltransferase	1.09e-07	6.82e-14	NA	0.6218
2. PF	A7GT90	Adenine phosphoribosyltransferase	2.29e-07	3.62e-12	NA	0.4601
2. PF	B5BD49	Adenine phosphoribosyltransferase	1.95e-08	4.06e-14	NA	0.6439
2. PF	B9IYY2	Adenine phosphoribosyltransferase	2.10e-07	4.81e-12	NA	0.5218
2. PF	Q0IAT7	Adenine phosphoribosyltransferase	4.66e-07	1.52e-11	NA	0.5055
2. PF	A3CMY9	Xanthine phosphoribosyltransferase	5.18e-09	8.69e-18	NA	0.6088
2. PF	B2U4S2	Adenine phosphoribosyltransferase	2.33e-08	1.51e-14	NA	0.6499
2. PF	Q8FPL0	Adenine phosphoribosyltransferase	1.53e-07	8.72e-08	NA	0.4904
2. PF	A0Q2P2	Xanthine phosphoribosyltransferase	8.50e-09	1.49e-14	NA	0.6113
2. PF	A9AF06	Adenine phosphoribosyltransferase	2.65e-08	1.54e-11	NA	0.5704
2. PF	Q03Q10	Xanthine phosphoribosyltransferase	9.97e-09	1.55e-16	NA	0.6276
2. PF	Q6F7W2	Xanthine phosphoribosyltransferase	5.89e-09	3.21e-18	NA	0.6274
2. PF	D3DYU7	Hypoxanthine/guanine phosphoribosyltransferase	2.83e-08	6.82e-15	NA	0.6158
2. PF	Q0ARQ1	Adenine phosphoribosyltransferase	8.67e-08	3.58e-17	NA	0.7258
2. PF	C1CZX7	Xanthine phosphoribosyltransferase	1.13e-08	5.17e-17	NA	0.6149
2. PF	Q04CA6	Xanthine phosphoribosyltransferase	3.57e-09	4.33e-17	NA	0.633
2. PF	C3LTV0	Adenine phosphoribosyltransferase	4.65e-08	3.68e-15	NA	0.6422
2. PF	A3NRB5	Adenine phosphoribosyltransferase	1.19e-08	7.05e-13	NA	0.5573
2. PF	A5URA4	Adenine phosphoribosyltransferase	2.03e-07	1.80e-11	NA	0.5796
2. PF	A6LP26	Adenine phosphoribosyltransferase	1.72e-07	1.93e-13	NA	0.5449
2. PF	Q5HPY6	Orotate phosphoribosyltransferase	2.12e-07	9.17e-17	NA	0.6234
2. PF	Q3KFA3	Adenine phosphoribosyltransferase	1.59e-07	3.10e-15	NA	0.708
2. PF	Q1JLQ7	Xanthine phosphoribosyltransferase	5.75e-09	9.58e-17	NA	0.6135
2. PF	Q8KFM9	Adenine phosphoribosyltransferase	4.23e-08	5.40e-17	NA	0.5815
2. PF	Q39CV8	Adenine phosphoribosyltransferase	2.62e-08	8.15e-12	NA	0.5718
2. PF	A6QE68	Xanthine phosphoribosyltransferase	4.78e-05	2.27e-18	NA	0.6053
2. PF	A6U2A3	Adenine phosphoribosyltransferase	2.02e-07	2.93e-13	NA	0.5894
2. PF	B7IPE6	Xanthine phosphoribosyltransferase	5.97e-09	1.34e-17	NA	0.628
2. PF	Q87F16	Orotate phosphoribosyltransferase	2.37e-07	3.76e-12	NA	0.4365
2. PF	Q8NX25	Orotate phosphoribosyltransferase	1.43e-07	1.68e-17	NA	0.6136
2. PF	Q5LNY7	Adenine phosphoribosyltransferase	2.72e-08	1.47e-15	NA	0.6551
2. PF	Q0TQZ9	Xanthine phosphoribosyltransferase 2	1.24e-08	5.88e-14	NA	0.6466
2. PF	Q12LL4	Adenine phosphoribosyltransferase	2.06e-08	9.20e-14	NA	0.5231
2. PF	A9R0Q1	Adenine phosphoribosyltransferase	3.06e-08	1.42e-13	NA	0.6192
2. PF	Q65GQ8	Adenine phosphoribosyltransferase	3.00e-07	1.09e-12	NA	0.5399
2. PF	Q4L383	Xanthine phosphoribosyltransferase	7.35e-09	1.97e-19	NA	0.5739
2. PF	B5R607	Adenine phosphoribosyltransferase	2.01e-08	2.84e-14	NA	0.6436
2. PF	Q9CB28	Orotate phosphoribosyltransferase	1.69e-07	9.97e-16	NA	0.4461
2. PF	B0U1J0	Orotate phosphoribosyltransferase	2.09e-07	7.08e-12	NA	0.4362
2. PF	A1U4H0	Adenine phosphoribosyltransferase	1.40e-08	1.57e-14	NA	0.4849
2. PF	A6T5N2	Adenine phosphoribosyltransferase	1.93e-08	2.48e-15	NA	0.671
2. PF	A4IW38	Adenine phosphoribosyltransferase	1.09e-07	9.94e-13	NA	0.6131
2. PF	A2S6D4	Adenine phosphoribosyltransferase	1.76e-08	5.80e-05	NA	0.5275
2. PF	A0AJZ0	Xanthine phosphoribosyltransferase	6.34e-09	2.94e-19	NA	0.6368
2. PF	Q88XQ4	Xanthine phosphoribosyltransferase	9.54e-09	1.23e-18	NA	0.5997
2. PF	Q2N669	Adenine phosphoribosyltransferase	1.09e-07	2.90e-16	NA	0.5403
2. PF	B3QC92	Orotate phosphoribosyltransferase	1.26e-07	4.49e-13	NA	0.4788
2. PF	B7GW49	Xanthine phosphoribosyltransferase	5.95e-09	1.15e-17	NA	0.6291
2. PF	C0MF03	Xanthine phosphoribosyltransferase	5.68e-09	1.77e-16	NA	0.6151
2. PF	A4W7F3	Adenine phosphoribosyltransferase	1.89e-08	2.69e-14	NA	0.6713
2. PF	Q6D800	Adenine phosphoribosyltransferase	1.83e-08	3.49e-13	NA	0.6367
2. PF	Q03A64	Xanthine phosphoribosyltransferase	7.16e-09	1.38e-17	NA	0.6032
2. PF	Q0HHZ1	Adenine phosphoribosyltransferase	1.51e-08	1.16e-14	NA	0.6191
2. PF	A4SMN3	Adenine phosphoribosyltransferase	4.23e-08	3.52e-15	NA	0.6209
2. PF	B7HL82	Xanthine phosphoribosyltransferase	1.12e-08	3.28e-19	NA	0.604
2. PF	B1IZC5	Adenine phosphoribosyltransferase	2.24e-08	1.51e-14	NA	0.6498
2. PF	B7GSB6	Xanthine phosphoribosyltransferase	1.89e-08	9.83e-16	NA	0.628
2. PF	Q03F39	Adenine phosphoribosyltransferase	2.46e-07	3.45e-10	NA	0.5085
2. PF	Q5E463	Adenine phosphoribosyltransferase	3.80e-08	1.02e-14	NA	0.615
2. PF	F8AJL1	Hypoxanthine/guanine phosphoribosyltransferase	2.97e-08	5.34e-14	NA	0.5895
2. PF	B1HV83	Adenine phosphoribosyltransferase	3.63e-07	6.34e-13	NA	0.5136
2. PF	A6VEA3	Xanthine phosphoribosyltransferase	7.01e-09	2.74e-17	NA	0.6147
2. PF	P65916	Orotate phosphoribosyltransferase	1.72e-07	2.36e-17	NA	0.6141
2. PF	B7UKE9	Adenine phosphoribosyltransferase	2.39e-08	1.51e-14	NA	0.6499
2. PF	B6I0C1	Adenine phosphoribosyltransferase	2.32e-08	1.51e-14	NA	0.6499
2. PF	A5UBP3	Adenine phosphoribosyltransferase	6.50e-08	1.99e-14	NA	0.5922
2. PF	Q1C4P3	Adenine phosphoribosyltransferase	3.10e-08	1.42e-13	NA	0.6308
2. PF	B8E700	Adenine phosphoribosyltransferase	1.76e-08	4.06e-15	NA	0.6117
2. PF	B3QQD1	Adenine phosphoribosyltransferase	3.71e-08	1.71e-15	NA	0.5839
2. PF	Q26997	Hypoxanthine-guanine-xanthine phosphoribosyltransferase	2.53e-05	2.17e-10	NA	0.4761
2. PF	Q97CT9	Orotate phosphoribosyltransferase	2.40e-07	8.15e-12	NA	0.5319
2. PF	B0RXL2	Orotate phosphoribosyltransferase	3.72e-07	5.55e-13	NA	0.4437
3. BF	Q5ZIJ8	Uracil phosphoribosyltransferase homolog	0.00e+00	NA	4.01e-10	0.8634
3. BF	Q95KB0	Uracil phosphoribosyltransferase homolog	0.00e+00	NA	4.33e-10	0.8472
3. BF	Q32LA4	Uracil phosphoribosyltransferase homolog	0.00e+00	NA	1.11e-10	0.8609
3. BF	O83462	Putative uracil phosphoribosyltransferase	1.54e-11	NA	1.16e-09	0.7269
3. BF	Q7UPM4	Ribose-phosphate pyrophosphokinase	6.65e-04	NA	0.011	0.5519
3. BF	Q9PJJ6	Uracil phosphoribosyltransferase	0.00e+00	NA	3.61e-62	0.964
4. PB	O13867	Uracil phosphoribosyltransferase 1	0.00e+00	5.08e-45	1.10e-32	NA
4. PB	Q9ZLQ9	Adenine phosphoribosyltransferase	1.10e-07	1.89e-12	0.021	NA
4. PB	O25296	Adenine phosphoribosyltransferase	1.31e-07	2.45e-12	0.026	NA
4. PB	Q6NYU7	Uracil phosphoribosyltransferase homolog	0.00e+00	8.02e-03	7.16e-13	NA
4. PB	B5Z6U3	Adenine phosphoribosyltransferase	1.14e-07	1.42e-12	0.043	NA
4. PB	P18562	Uracil phosphoribosyltransferase	0.00e+00	1.10e-40	1.23e-26	NA
4. PB	A8LXX3	Adenine phosphoribosyltransferase	5.18e-08	1.65e-07	0.005	NA
4. PB	Q1IKJ1	Adenine phosphoribosyltransferase	1.86e-07	1.21e-11	0.006	NA
4. PB	Q30RI5	Adenine phosphoribosyltransferase	2.03e-08	5.63e-13	0.027	NA
4. PB	B6JLF4	Adenine phosphoribosyltransferase	1.14e-07	1.57e-12	0.032	NA
4. PB	A4X5X7	Adenine phosphoribosyltransferase	4.55e-08	2.21e-08	0.006	NA
4. PB	Q9HE15	Uracil phosphoribosyltransferase 2	0.00e+00	1.68e-39	2.11e-18	NA
4. PB	Q55GQ6	Uracil phosphoribosyltransferase	0.00e+00	1.13e-46	1.72e-31	NA
4. PB	B2UTQ6	Adenine phosphoribosyltransferase	1.15e-07	1.57e-12	0.032	NA
4. PB	Q1CTV4	Adenine phosphoribosyltransferase	1.16e-07	1.57e-12	0.032	NA
4. PB	Q9US43	Putative uracil phosphoribosyltransferase urg2	0.00e+00	1.70e-50	6.88e-35	NA
4. PB	Q47N45	Adenine phosphoribosyltransferase	6.75e-08	1.62e-11	0.027	NA
4. PB	P0A8F0	Uracil phosphoribosyltransferase	0.00e+00	1.24e-65	1.73e-65	NA
4. PB	Q2FWE6	Uracil phosphoribosyltransferase	0.00e+00	7.18e-68	9.62e-78	NA
4. PB	Q67LM3	Adenine phosphoribosyltransferase	1.53e-07	3.05e-13	0.012	NA
4. PB	P9WFF3	Uracil phosphoribosyltransferase	0.00e+00	3.07e-62	4.25e-56	NA
5. P	B1ZJQ5	Orotate phosphoribosyltransferase	1.61e-06	3.93e-13	NA	NA
5. P	A9MY09	Xanthine-guanine phosphoribosyltransferase	1.64e-07	2.30e-06	NA	NA
5. P	Q9K9V4	Bifunctional protein PyrR	4.19e-09	9.22e-08	NA	NA
5. P	B2UV21	Orotate phosphoribosyltransferase	1.01e-06	1.41e-10	NA	NA
5. P	B5Y1E0	Xanthine-guanine phosphoribosyltransferase	2.01e-07	3.45e-06	NA	NA
5. P	A0AJU5	Bifunctional protein PyrR	5.86e-09	1.56e-09	NA	NA
5. P	A5UG90	Orotate phosphoribosyltransferase	2.83e-06	1.51e-12	NA	NA
5. P	Q500M2	Xanthine phosphoribosyltransferase	6.28e-09	1.06e-17	NA	NA
5. P	P0CQ41	Orotate phosphoribosyltransferase	3.64e-06	4.04e-13	NA	NA
5. P	A8AKQ0	Xanthine-guanine phosphoribosyltransferase	1.62e-07	2.84e-06	NA	NA
5. P	P52561	Adenine phosphoribosyltransferase	1.78e-08	2.77e-16	NA	NA
5. P	A9MKN3	Orotate phosphoribosyltransferase	3.06e-06	2.72e-12	NA	NA
5. P	Q7NBS4	Adenine phosphoribosyltransferase	3.21e-07	3.73e-11	NA	NA
5. P	D3S0H7	Hypoxanthine/guanine phosphoribosyltransferase	8.82e-06	1.31e-15	NA	NA
5. P	B6EIE9	Xanthine-guanine phosphoribosyltransferase	1.93e-07	2.28e-05	NA	NA
5. P	A2CCL7	Orotate phosphoribosyltransferase	3.34e-05	6.80e-11	NA	NA
5. P	Q8YV98	Bifunctional protein PyrR	9.28e-08	1.51e-09	NA	NA
5. P	Q04633	Adenine phosphoribosyltransferase	4.60e-08	2.58e-15	NA	NA
5. P	A7HX43	Orotate phosphoribosyltransferase	1.64e-07	5.48e-13	NA	NA
5. P	A7H149	Orotate phosphoribosyltransferase	5.64e-07	2.29e-09	NA	NA
5. P	B7KKQ8	Adenine phosphoribosyltransferase	2.27e-07	2.21e-13	NA	NA
5. P	Q7N7B4	Xanthine-guanine phosphoribosyltransferase	2.18e-07	1.66e-06	NA	NA
5. P	B1JQX7	Orotate phosphoribosyltransferase	3.20e-06	8.47e-12	NA	NA
5. P	Q3SQJ9	Xanthine-guanine phosphoribosyltransferase	2.04e-08	3.04e-08	NA	NA
5. P	B7IUP2	Orotate phosphoribosyltransferase	3.42e-07	2.15e-12	NA	NA
5. P	Q038P1	Adenine phosphoribosyltransferase	2.35e-07	8.48e-13	NA	NA
5. P	P9WHK2	Bifunctional protein PyrR	1.83e-08	3.30e-13	NA	NA
5. P	Q5LZD4	Adenine phosphoribosyltransferase	2.70e-07	2.82e-13	NA	NA
5. P	Q1ICH9	Adenine phosphoribosyltransferase	8.25e-08	8.78e-17	NA	NA
5. P	B1LHT4	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	A5IS83	Bifunctional protein PyrR	1.06e-07	5.07e-09	NA	NA
5. P	Q8E7Y1	Hypoxanthine-guanine phosphoribosyltransferase	7.20e-09	1.07e-06	NA	NA
5. P	A1ASM0	Adenine phosphoribosyltransferase	1.44e-07	1.41e-11	NA	NA
5. P	B9J8H7	Orotate phosphoribosyltransferase	2.85e-07	1.15e-12	NA	NA
5. P	P65828	Hypoxanthine-guanine phosphoribosyltransferase	1.67e-08	8.43e-04	NA	NA
5. P	A4QEI8	Bifunctional protein PyrR	1.65e-08	3.41e-09	NA	NA
5. P	A7I261	Adenine phosphoribosyltransferase	6.34e-08	1.21e-13	NA	NA
5. P	A9VTD1	Bifunctional protein PyrR	8.04e-09	2.25e-10	NA	NA
5. P	Q4ZZ69	Bifunctional protein PyrR	1.12e-05	6.27e-06	NA	NA
5. P	Q3AYP0	Adenine phosphoribosyltransferase	6.47e-07	6.07e-12	NA	NA
5. P	A5ULL0	PyrE-like protein	8.36e-05	2.24e-02	NA	NA
5. P	B5Z8Q2	Orotate phosphoribosyltransferase	1.14e-06	3.75e-10	NA	NA
5. P	B5XL39	Adenine phosphoribosyltransferase	2.22e-07	7.14e-13	NA	NA
5. P	P47696	Hypoxanthine-guanine phosphoribosyltransferase	8.72e-09	7.75e-03	NA	NA
5. P	Q7MUX4	Orotate phosphoribosyltransferase	2.02e-07	6.63e-15	NA	NA
5. P	A0KNR2	Xanthine-guanine phosphoribosyltransferase	2.85e-07	8.01e-06	NA	NA
5. P	Q9PIR1	Orotate phosphoribosyltransferase	7.54e-07	1.04e-08	NA	NA
5. P	B7NEU6	Orotate phosphoribosyltransferase	2.67e-06	4.12e-12	NA	NA
5. P	B5BI16	Orotate phosphoribosyltransferase	2.85e-06	1.12e-11	NA	NA
5. P	P07833	Hypoxanthine-guanine-xanthine phosphoribosyltransferase	5.42e-07	4.80e-13	NA	NA
5. P	Q59049	Hypoxanthine/guanine phosphoribosyltransferase	3.45e-08	6.72e-15	NA	NA
5. P	A7ZGD3	Orotate phosphoribosyltransferase	5.85e-07	2.12e-08	NA	NA
5. P	C4ZXN4	Orotate phosphoribosyltransferase	2.28e-06	4.12e-12	NA	NA
5. P	Q8A2N8	Adenine phosphoribosyltransferase	6.67e-08	2.18e-13	NA	NA
5. P	B2TNF7	Orotate phosphoribosyltransferase	5.88e-06	5.62e-12	NA	NA
5. P	B1MZJ0	Bifunctional protein PyrR	2.54e-07	1.19e-09	NA	NA
5. P	B2I1J9	Orotate phosphoribosyltransferase	3.91e-05	6.46e-14	NA	NA
5. P	Q9A810	Orotate phosphoribosyltransferase	2.71e-07	3.22e-13	NA	NA
5. P	Q03FM3	Bifunctional protein PyrR	2.68e-05	9.06e-09	NA	NA
5. P	C1C7Q6	Bifunctional protein PyrR	7.11e-08	3.74e-09	NA	NA
5. P	Q7VM31	Bifunctional protein PyrR	6.67e-05	7.93e-10	NA	NA
5. P	G0LH85	HGPRTase-like protein 2	9.04e-08	1.86e-12	NA	NA
5. P	A5G4S5	Adenine phosphoribosyltransferase	1.39e-07	2.02e-12	NA	NA
5. P	A2SPY9	Hypoxanthine/guanine phosphoribosyltransferase	4.67e-07	1.47e-14	NA	NA
5. P	Q5FAK5	Orotate phosphoribosyltransferase	2.25e-06	8.71e-13	NA	NA
5. P	P0A9M2	Hypoxanthine phosphoribosyltransferase	7.08e-09	3.22e-05	NA	NA
5. P	Q5GZA0	Adenine phosphoribosyltransferase	3.69e-07	6.51e-13	NA	NA
5. P	P65918	Orotate phosphoribosyltransferase	4.58e-07	1.46e-13	NA	NA
5. P	Q3SM42	Orotate phosphoribosyltransferase	2.67e-06	4.41e-14	NA	NA
5. P	B5XTG0	Orotate phosphoribosyltransferase	2.77e-06	8.71e-13	NA	NA
5. P	P07741	Adenine phosphoribosyltransferase	5.51e-08	2.97e-13	NA	NA
5. P	Q5HNR6	Adenine phosphoribosyltransferase	1.92e-07	2.74e-13	NA	NA
5. P	C0ZAP9	Adenine phosphoribosyltransferase	3.92e-07	1.42e-12	NA	NA
5. P	Q329L4	Orotate phosphoribosyltransferase	3.15e-06	2.24e-12	NA	NA
5. P	Q9CJW4	Orotate phosphoribosyltransferase	3.31e-06	2.90e-12	NA	NA
5. P	P0CZ62	Adenine phosphoribosyltransferase	2.60e-07	7.14e-13	NA	NA
5. P	Q6A910	Orotate phosphoribosyltransferase	2.00e-07	8.96e-14	NA	NA
5. P	A2RKX0	Xanthine phosphoribosyltransferase	1.14e-08	4.07e-19	NA	NA
5. P	Q9KXR1	Bifunctional protein PyrR	5.38e-08	1.36e-08	NA	NA
5. P	C1KVH1	Adenine phosphoribosyltransferase	1.20e-07	4.94e-12	NA	NA
5. P	Q9CHT5	Adenine phosphoribosyltransferase	1.52e-07	4.04e-13	NA	NA
5. P	Q130R0	Adenine phosphoribosyltransferase	3.37e-08	1.51e-17	NA	NA
5. P	D1YVK0	Hypoxanthine/guanine phosphoribosyltransferase	5.00e-08	2.48e-15	NA	NA
5. P	P65944	Bifunctional protein PyrR	1.04e-07	5.07e-09	NA	NA
5. P	A1VZR0	Adenine phosphoribosyltransferase	4.22e-08	4.66e-14	NA	NA
5. P	P58861	Orotate phosphoribosyltransferase	1.88e-07	6.72e-15	NA	NA
5. P	B5E6M0	Adenine phosphoribosyltransferase	NA	1.12e-12	NA	NA
5. P	B1GYY9	Bifunctional protein PyrR	3.56e-08	1.74e-08	NA	NA
5. P	C1KWD9	Bifunctional protein PyrR	8.42e-09	4.11e-09	NA	NA
5. P	Q17Z49	Orotate phosphoribosyltransferase	9.10e-07	1.66e-11	NA	NA
5. P	Q8EXN2	Adenine phosphoribosyltransferase	2.76e-08	3.97e-18	NA	NA
5. P	Q6KI92	Adenine phosphoribosyltransferase	1.04e-06	5.13e-12	NA	NA
5. P	B7VHJ8	Orotate phosphoribosyltransferase	2.26e-06	3.58e-13	NA	NA
5. P	Q75FP0	Adenine phosphoribosyltransferase	2.45e-08	3.97e-18	NA	NA
5. P	Q8CPJ9	Bifunctional protein PyrR	8.83e-08	6.40e-09	NA	NA
5. P	Q5FSN7	Adenine phosphoribosyltransferase	5.22e-07	3.62e-10	NA	NA
5. P	B6I018	Xanthine-guanine phosphoribosyltransferase	1.69e-07	2.01e-06	NA	NA
5. P	B3QA01	Adenine phosphoribosyltransferase	5.93e-08	1.34e-16	NA	NA
5. P	A8LRS7	Orotate phosphoribosyltransferase	6.57e-05	1.99e-14	NA	NA
5. P	P0A278	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.30e-06	NA	NA
5. P	Q9KDH2	Adenine phosphoribosyltransferase	2.45e-07	1.24e-12	NA	NA
5. P	Q93AJ8	Adenine phosphoribosyltransferase	1.91e-08	4.22e-16	NA	NA
5. P	Q0TRB3	Orotate phosphoribosyltransferase	2.65e-07	1.70e-12	NA	NA
5. P	B0R3D9	PyrE-like protein	2.42e-05	5.59e-03	NA	NA
5. P	A6LTU0	Bifunctional protein PyrR	1.65e-07	3.48e-12	NA	NA
5. P	Q81WF6	Orotate phosphoribosyltransferase	4.21e-07	7.94e-12	NA	NA
5. P	Q8DYV9	Bifunctional protein PyrR	5.11e-08	2.37e-09	NA	NA
5. P	B1J356	Bifunctional protein PyrR	1.16e-05	7.25e-05	NA	NA
5. P	Q28MD3	Adenine phosphoribosyltransferase	1.21e-07	1.46e-16	NA	NA
5. P	Q82XS2	Adenine phosphoribosyltransferase	1.61e-08	9.06e-13	NA	NA
5. P	A4VKK1	Adenine phosphoribosyltransferase	9.61e-08	2.51e-15	NA	NA
5. P	Q3AN25	Orotate phosphoribosyltransferase	4.67e-05	1.28e-12	NA	NA
5. P	B3DS55	Orotate phosphoribosyltransferase	1.25e-06	5.78e-13	NA	NA
5. P	B5ZY62	Adenine phosphoribosyltransferase	3.46e-08	2.90e-16	NA	NA
5. P	Q5FJP9	Adenine phosphoribosyltransferase	1.50e-07	4.74e-13	NA	NA
5. P	B1YJG1	Adenine phosphoribosyltransferase	5.20e-05	5.96e-14	NA	NA
5. P	B4T7Q0	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	A1VIL5	Orotate phosphoribosyltransferase	4.29e-06	8.52e-10	NA	NA
5. P	D8JA74	HGPRTase-like protein 1	2.40e-05	2.40e-13	NA	NA
5. P	A7MWU9	Xanthine-guanine phosphoribosyltransferase	2.71e-07	2.30e-05	NA	NA
5. P	Q636D5	Bifunctional protein PyrR	4.21e-08	2.60e-10	NA	NA
5. P	Q2G9W6	Orotate phosphoribosyltransferase	8.15e-07	1.89e-11	NA	NA
5. P	Q48U09	Orotate phosphoribosyltransferase	4.78e-07	5.60e-15	NA	NA
5. P	Q57IA0	Orotate phosphoribosyltransferase	2.99e-06	3.35e-12	NA	NA
5. P	A6LJP2	Orotate phosphoribosyltransferase	7.39e-07	4.96e-10	NA	NA
5. P	A7Z4G7	Bifunctional protein PyrR	5.26e-09	9.94e-09	NA	NA
5. P	A1JNY0	Xanthine-guanine phosphoribosyltransferase	1.40e-07	1.66e-05	NA	NA
5. P	B2UD27	Orotate phosphoribosyltransferase	2.52e-06	3.39e-12	NA	NA
5. P	Q6G086	Orotate phosphoribosyltransferase	3.50e-07	1.54e-13	NA	NA
5. P	Q0KEM6	Adenine phosphoribosyltransferase	1.12e-08	1.24e-14	NA	NA
5. P	Q7MN62	Xanthine-guanine phosphoribosyltransferase	2.79e-07	1.64e-05	NA	NA
5. P	Q9A076	Orotate phosphoribosyltransferase	3.55e-07	6.27e-15	NA	NA
5. P	Q5X5W4	Orotate phosphoribosyltransferase	2.75e-06	1.47e-11	NA	NA
5. P	P68778	Adenine phosphoribosyltransferase	1.98e-07	2.93e-13	NA	NA
5. P	Q044A4	Adenine phosphoribosyltransferase	2.04e-07	5.68e-15	NA	NA
5. P	B1IYV8	Orotate phosphoribosyltransferase	2.47e-06	4.12e-12	NA	NA
5. P	B2AGV9	Adenine phosphoribosyltransferase	7.03e-09	3.98e-13	NA	NA
5. P	B1WQD7	Adenine phosphoribosyltransferase	1.09e-07	3.30e-13	NA	NA
5. P	A6U117	Bifunctional protein PyrR	9.47e-08	5.07e-09	NA	NA
5. P	Q741H6	Bifunctional protein PyrR	1.81e-08	6.64e-12	NA	NA
5. P	Q0STN9	Orotate phosphoribosyltransferase	2.43e-07	1.70e-12	NA	NA
5. P	Q3JE54	Bifunctional protein PyrR	1.20e-03	2.21e-06	NA	NA
5. P	A2BJ25	Orotate phosphoribosyltransferase	1.67e-07	4.34e-16	NA	NA
5. P	Q8YH64	Xanthine-guanine phosphoribosyltransferase	5.19e-08	5.95e-07	NA	NA
5. P	B4RCV1	Orotate phosphoribosyltransferase	2.62e-07	8.59e-13	NA	NA
5. P	P00494	Hypoxanthine-guanine phosphoribosyltransferase	1.60e-07	7.18e-16	NA	NA
5. P	B7MQ74	Xanthine-guanine phosphoribosyltransferase	1.67e-07	1.31e-06	NA	NA
5. P	Q66GE0	Orotate phosphoribosyltransferase	3.41e-06	8.47e-12	NA	NA
5. P	C7P0W1	HGPRTase-like protein	1.77e-07	1.08e-13	NA	NA
5. P	P0DD68	Orotate phosphoribosyltransferase	4.72e-07	4.35e-15	NA	NA
5. P	Q163Y8	Xanthine-guanine phosphoribosyltransferase	2.54e-07	1.33e-12	NA	NA
5. P	B9IVW8	Bifunctional protein PyrR	9.08e-06	2.60e-10	NA	NA
5. P	Q46KW1	Adenine phosphoribosyltransferase	2.69e-07	2.96e-14	NA	NA
5. P	C1CLS6	Adenine phosphoribosyltransferase	2.28e-07	2.52e-12	NA	NA
5. P	Q02XW4	Bifunctional protein PyrR	1.11e-07	1.03e-09	NA	NA
5. P	Q8Y660	Bifunctional protein PyrR	8.96e-09	2.63e-09	NA	NA
5. P	Q741P3	Adenine phosphoribosyltransferase	1.51e-07	2.73e-11	NA	NA
5. P	Q1GFQ6	Orotate phosphoribosyltransferase	7.03e-05	5.84e-15	NA	NA
5. P	B8IT23	Orotate phosphoribosyltransferase	1.03e-06	1.01e-12	NA	NA
5. P	B9KBW7	Orotate phosphoribosyltransferase	5.50e-07	1.89e-11	NA	NA
5. P	A7HZX7	Orotate phosphoribosyltransferase	6.15e-07	2.01e-10	NA	NA
5. P	B9JQW1	Orotate phosphoribosyltransferase	2.53e-07	2.96e-14	NA	NA
5. P	B8DHM4	Adenine phosphoribosyltransferase	2.77e-07	4.94e-12	NA	NA
5. P	Q6CWV0	Adenine phosphoribosyltransferase	2.78e-08	3.13e-14	NA	NA
5. P	Q1JC80	Orotate phosphoribosyltransferase	5.12e-07	1.47e-14	NA	NA
5. P	P58858	Orotate phosphoribosyltransferase	5.24e-07	1.29e-12	NA	NA
5. P	Q17W08	Adenine phosphoribosyltransferase	8.91e-08	1.94e-11	NA	NA
5. P	Q5WHQ1	Adenine phosphoribosyltransferase	6.29e-05	3.02e-12	NA	NA
5. P	Q39VR8	Adenine phosphoribosyltransferase	1.36e-07	2.15e-13	NA	NA
5. P	A4XKS9	Bifunctional protein PyrR	4.77e-08	2.45e-10	NA	NA
5. P	Q1WT53	Adenine phosphoribosyltransferase	1.35e-07	1.29e-10	NA	NA
5. P	Q3Z599	Xanthine-guanine phosphoribosyltransferase	1.64e-07	2.01e-06	NA	NA
5. P	Q8DTV2	Orotate phosphoribosyltransferase	5.08e-07	6.63e-15	NA	NA
5. P	Q4A8Q0	Adenine phosphoribosyltransferase	2.23e-07	1.84e-12	NA	NA
5. P	A4WRD6	Xanthine-guanine phosphoribosyltransferase	2.10e-07	5.90e-08	NA	NA
5. P	C4XU70	Adenine phosphoribosyltransferase	2.13e-07	1.40e-13	NA	NA
5. P	Q3J5E9	Adenine phosphoribosyltransferase	3.73e-08	1.57e-15	NA	NA
5. P	Q970X1	Orotate phosphoribosyltransferase	2.98e-07	1.96e-12	NA	NA
5. P	B6JN97	Orotate phosphoribosyltransferase	8.58e-07	1.94e-10	NA	NA
5. P	B8D880	Orotate phosphoribosyltransferase	1.46e-06	1.02e-14	NA	NA
5. P	Q8DDX5	Orotate phosphoribosyltransferase	3.45e-06	7.14e-13	NA	NA
5. P	P0DD40	Hypoxanthine-guanine phosphoribosyltransferase	1.01e-08	4.96e-05	NA	NA
5. P	A9AYX1	Adenine phosphoribosyltransferase	1.33e-07	9.27e-11	NA	NA
5. P	Q6MPK7	Adenine phosphoribosyltransferase	1.73e-06	1.58e-10	NA	NA
5. P	A4TSE1	Orotate phosphoribosyltransferase	3.50e-06	8.47e-12	NA	NA
5. P	Q3A4N0	Adenine phosphoribosyltransferase	2.37e-07	7.79e-11	NA	NA
5. P	Q2INZ6	Adenine phosphoribosyltransferase	9.23e-08	1.46e-10	NA	NA
5. P	Q7MPT2	Orotate phosphoribosyltransferase	3.22e-06	7.24e-13	NA	NA
5. P	Q97TC4	Hypoxanthine-guanine phosphoribosyltransferase	8.38e-09	5.60e-06	NA	NA
5. P	B3QLE2	Orotate phosphoribosyltransferase	3.76e-07	2.15e-12	NA	NA
5. P	Q0I1C0	Xanthine-guanine phosphoribosyltransferase	1.90e-07	3.99e-06	NA	NA
5. P	Q1QK75	Xanthine-guanine phosphoribosyltransferase	7.32e-08	5.58e-08	NA	NA
5. P	Q6MTD4	Adenine phosphoribosyltransferase	8.44e-07	3.18e-12	NA	NA
5. P	Q98NH3	Xanthine-guanine phosphoribosyltransferase	6.07e-08	1.11e-06	NA	NA
5. P	Q839B2	Hypoxanthine-guanine phosphoribosyltransferase	1.24e-08	1.19e-03	NA	NA
5. P	P56162	Orotate phosphoribosyltransferase	8.86e-07	1.52e-10	NA	NA
5. P	P68780	Adenine phosphoribosyltransferase	1.96e-07	2.93e-13	NA	NA
5. P	Q2JD90	Adenine phosphoribosyltransferase	2.56e-08	1.31e-10	NA	NA
5. P	A6TQN8	Adenine phosphoribosyltransferase	1.92e-07	3.31e-12	NA	NA
5. P	Q2KU70	Orotate phosphoribosyltransferase	4.69e-06	1.75e-11	NA	NA
5. P	Q6NH12	Bifunctional protein PyrR	1.74e-08	8.31e-10	NA	NA
5. P	Q8Y668	Orotate phosphoribosyltransferase	3.68e-07	7.11e-15	NA	NA
5. P	Q3M8F0	Bifunctional protein PyrR	9.11e-08	8.22e-10	NA	NA
5. P	A4T0F4	Orotate phosphoribosyltransferase	1.18e-06	6.51e-13	NA	NA
5. P	B5FFE3	Orotate phosphoribosyltransferase	2.26e-06	2.21e-12	NA	NA
5. P	Q3IST1	HGPRTase-like protein	1.28e-07	7.41e-15	NA	NA
5. P	Q03WF7	Bifunctional protein PyrR	3.01e-07	1.31e-08	NA	NA
5. P	B5RG81	Orotate phosphoribosyltransferase	3.39e-06	3.35e-12	NA	NA
5. P	Q9PQ02	Adenine phosphoribosyltransferase	5.22e-07	4.08e-08	NA	NA
5. P	P65911	Orotate phosphoribosyltransferase	5.93e-07	3.35e-13	NA	NA
5. P	Q8EUY4	Orotate phosphoribosyltransferase	3.38e-07	2.21e-15	NA	NA
5. P	Q04NG3	Adenine phosphoribosyltransferase	2.30e-08	7.04e-18	NA	NA
5. P	Q2IV51	Xanthine-guanine phosphoribosyltransferase	7.89e-08	1.60e-09	NA	NA
5. P	C3P652	Orotate phosphoribosyltransferase	2.87e-07	7.94e-12	NA	NA
5. P	A6VLF2	Orotate phosphoribosyltransferase	2.82e-06	3.78e-13	NA	NA
5. P	Q24UQ1	Adenine phosphoribosyltransferase	4.67e-07	2.63e-13	NA	NA
5. P	B2TS13	Bifunctional protein PyrR	9.92e-09	1.02e-10	NA	NA
5. P	A4TBR2	Adenine phosphoribosyltransferase	1.13e-07	3.58e-13	NA	NA
5. P	Q5JHF4	Orotate phosphoribosyltransferase	1.11e-07	4.17e-12	NA	NA
5. P	C0ME81	Bifunctional protein PyrR	6.30e-08	1.19e-08	NA	NA
5. P	Q74CZ3	Adenine phosphoribosyltransferase	1.52e-07	7.14e-13	NA	NA
5. P	B2TMZ9	Adenine phosphoribosyltransferase	1.76e-07	2.94e-11	NA	NA
5. P	Q2RWT4	Adenine phosphoribosyltransferase	4.02e-07	7.17e-12	NA	NA
5. P	A5IK86	Orotate phosphoribosyltransferase	6.54e-07	1.89e-11	NA	NA
5. P	B1J4L6	Orotate phosphoribosyltransferase	2.98e-06	1.16e-13	NA	NA
5. P	C0QVL4	Adenine phosphoribosyltransferase	1.99e-07	5.69e-12	NA	NA
5. P	P47956	Adenine phosphoribosyltransferase	8.26e-08	6.92e-14	NA	NA
5. P	B7KKJ9	Bifunctional protein PyrR	9.01e-08	5.77e-09	NA	NA
5. P	Q1C263	Orotate phosphoribosyltransferase	3.61e-06	8.47e-12	NA	NA
5. P	Q6HET2	Orotate phosphoribosyltransferase	3.40e-07	3.35e-12	NA	NA
5. P	A2SRI7	PyrE-like protein	3.97e-05	1.04e-03	NA	NA
5. P	A8ZWU1	Adenine phosphoribosyltransferase	5.55e-08	3.35e-12	NA	NA
5. P	B5FJW9	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	Q8EUA8	Adenine phosphoribosyltransferase	7.35e-07	3.06e-12	NA	NA
5. P	Q5LQ42	Orotate phosphoribosyltransferase	7.05e-05	1.34e-13	NA	NA
5. P	Q1JMD0	Bifunctional protein PyrR	7.49e-08	2.04e-10	NA	NA
5. P	Q1JCF0	Bifunctional protein PyrR	6.65e-08	2.04e-10	NA	NA
5. P	B7ICE9	Orotate phosphoribosyltransferase	3.65e-05	8.14e-14	NA	NA
5. P	Q7MY25	Orotate phosphoribosyltransferase	2.38e-06	2.39e-12	NA	NA
5. P	A1KIG8	Bifunctional protein PyrR	1.90e-08	3.30e-13	NA	NA
5. P	B9MS28	Orotate phosphoribosyltransferase	4.21e-07	7.55e-12	NA	NA
5. P	A5IMI9	Adenine phosphoribosyltransferase	2.81e-07	5.33e-12	NA	NA
5. P	A8Z2G2	Adenine phosphoribosyltransferase	1.97e-07	2.93e-13	NA	NA
5. P	C3K476	Orotate phosphoribosyltransferase	4.06e-06	2.04e-12	NA	NA
5. P	A9MB59	Xanthine-guanine phosphoribosyltransferase	2.43e-08	8.64e-07	NA	NA
5. P	A7NG77	Adenine phosphoribosyltransferase	1.93e-07	1.41e-10	NA	NA
5. P	A8AWY0	Adenine phosphoribosyltransferase	1.18e-07	7.14e-13	NA	NA
5. P	B7V5M2	Orotate phosphoribosyltransferase	2.95e-06	2.04e-13	NA	NA
5. P	P41923	Orotate phosphoribosyltransferase	8.00e-07	4.68e-11	NA	NA
5. P	Q92SC6	Orotate phosphoribosyltransferase	3.75e-07	4.99e-13	NA	NA
5. P	A0PPE4	Adenine phosphoribosyltransferase	3.31e-07	1.31e-11	NA	NA
5. P	Q03S48	Bifunctional protein PyrR	1.16e-07	1.50e-08	NA	NA
5. P	A3M9Y5	Orotate phosphoribosyltransferase	3.68e-05	7.71e-14	NA	NA
5. P	A8ESP0	Adenine phosphoribosyltransferase	3.31e-08	8.17e-15	NA	NA
5. P	Q8NKQ2	PyrE-like protein	4.24e-05	2.56e-03	NA	NA
5. P	Q985B1	Orotate phosphoribosyltransferase 2	3.93e-07	7.31e-14	NA	NA
5. P	B7H6M7	Bifunctional protein PyrR	3.97e-08	2.60e-10	NA	NA
5. P	P0A9M7	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	P91455	Adenine phosphoribosyltransferase	5.06e-08	7.24e-13	NA	NA
5. P	C1FLB0	Orotate phosphoribosyltransferase	3.04e-07	1.80e-11	NA	NA
5. P	A4IM28	Bifunctional protein PyrR	8.37e-09	1.68e-08	NA	NA
5. P	Q5FUI1	Xanthine-guanine phosphoribosyltransferase	9.05e-08	3.04e-05	NA	NA
5. P	B2IQ70	Bifunctional protein PyrR	7.06e-08	3.74e-09	NA	NA
5. P	Q8R9R3	Bifunctional protein PyrR	3.74e-07	2.23e-09	NA	NA
5. P	P99085	Hypoxanthine-guanine phosphoribosyltransferase	1.44e-08	8.43e-04	NA	NA
5. P	A6VSX4	Orotate phosphoribosyltransferase	3.47e-06	6.73e-14	NA	NA
5. P	A5VD53	Orotate phosphoribosyltransferase	8.23e-07	7.21e-15	NA	NA
5. P	Q12W31	Hypoxanthine/guanine phosphoribosyltransferase	7.31e-08	1.53e-16	NA	NA
5. P	A6LTN5	Adenine phosphoribosyltransferase	1.03e-07	2.50e-13	NA	NA
5. P	Q6N7S7	Xanthine-guanine phosphoribosyltransferase	4.78e-08	6.46e-10	NA	NA
5. P	Q1WTX5	Bifunctional protein PyrR	9.68e-09	1.29e-09	NA	NA
5. P	Q5E6W3	Xanthine-guanine phosphoribosyltransferase	1.84e-07	3.85e-05	NA	NA
5. P	Q3Z788	Bifunctional protein PyrR	4.68e-08	6.86e-09	NA	NA
5. P	Q0KF45	Orotate phosphoribosyltransferase	1.96e-06	6.26e-13	NA	NA
5. P	Q2FG92	Adenine phosphoribosyltransferase	2.04e-07	2.93e-13	NA	NA
5. P	C1D6F5	Orotate phosphoribosyltransferase	2.32e-06	1.99e-12	NA	NA
5. P	A9AVM2	Bifunctional protein PyrR	5.90e-08	5.32e-09	NA	NA
5. P	B8GDM8	Hypoxanthine/guanine phosphoribosyltransferase	2.58e-07	3.31e-14	NA	NA
5. P	A4G043	Hypoxanthine/guanine phosphoribosyltransferase	5.22e-08	1.19e-14	NA	NA
5. P	C1CX80	Bifunctional protein PyrR	6.60e-08	2.12e-10	NA	NA
5. P	A7ZCG7	Adenine phosphoribosyltransferase	2.99e-08	3.62e-12	NA	NA
5. P	P44722	Bifunctional protein PyrR	2.97e-08	1.12e-09	NA	NA
5. P	P47958	Adenine phosphoribosyltransferase	6.54e-08	2.84e-14	NA	NA
5. P	P25972	Orotate phosphoribosyltransferase	2.76e-07	1.10e-13	NA	NA
5. P	Q5F774	Adenine phosphoribosyltransferase	6.02e-09	4.27e-17	NA	NA
5. P	Q88BD7	Orotate phosphoribosyltransferase	3.10e-06	6.73e-14	NA	NA
5. P	P69503	Adenine phosphoribosyltransferase	2.13e-08	1.51e-14	NA	NA
5. P	A8F7S9	Adenine phosphoribosyltransferase	4.06e-07	2.39e-10	NA	NA
5. P	A5N1Z4	Adenine phosphoribosyltransferase	9.45e-08	4.61e-13	NA	NA
5. P	Q7W3H5	Orotate phosphoribosyltransferase	1.91e-04	1.21e-11	NA	NA
5. P	B3DRY2	Adenine phosphoribosyltransferase	2.05e-07	1.68e-09	NA	NA
5. P	Q6L2K9	Orotate phosphoribosyltransferase	3.00e-07	6.99e-12	NA	NA
5. P	A6LS60	Orotate phosphoribosyltransferase	2.53e-06	4.23e-12	NA	NA
5. P	Q89AN2	Xanthine-guanine phosphoribosyltransferase	1.62e-07	6.14e-06	NA	NA
5. P	O08359	Orotate phosphoribosyltransferase	4.60e-07	1.02e-12	NA	NA
5. P	A8Z3N5	Bifunctional protein PyrR	1.11e-07	5.07e-09	NA	NA
5. P	Q64531	Hypoxanthine-guanine phosphoribosyltransferase (Fragment)	1.30e-07	1.26e-16	NA	NA
5. P	A8G657	Adenine phosphoribosyltransferase	2.66e-06	2.79e-09	NA	NA
5. P	A4W6X0	Xanthine-guanine phosphoribosyltransferase	1.66e-07	1.51e-05	NA	NA
5. P	B7LNG2	Xanthine-guanine phosphoribosyltransferase	1.55e-07	1.55e-06	NA	NA
5. P	Q2YQ27	Xanthine-guanine phosphoribosyltransferase	5.09e-08	5.95e-07	NA	NA
5. P	Q1I2T8	Orotate phosphoribosyltransferase	2.63e-06	1.16e-13	NA	NA
5. P	Q97N11	Orotate phosphoribosyltransferase	4.35e-06	1.84e-12	NA	NA
5. P	O51718	Adenine phosphoribosyltransferase	7.47e-08	3.62e-10	NA	NA
5. P	Q8CS95	Adenine phosphoribosyltransferase	1.88e-07	2.74e-13	NA	NA
5. P	Q7VKV3	Orotate phosphoribosyltransferase	3.34e-06	9.50e-12	NA	NA
5. P	B7UJC6	Xanthine-guanine phosphoribosyltransferase	1.68e-07	1.31e-06	NA	NA
5. P	Q2KCZ1	Orotate phosphoribosyltransferase	2.61e-07	2.56e-13	NA	NA
5. P	C1F3T2	Adenine phosphoribosyltransferase	1.69e-07	9.43e-13	NA	NA
5. P	B0KM22	Bifunctional protein PyrR	1.06e-07	2.49e-05	NA	NA
5. P	Q1B9P7	Adenine phosphoribosyltransferase	1.25e-07	1.51e-12	NA	NA
5. P	A9MVN7	Orotate phosphoribosyltransferase	3.23e-06	3.35e-12	NA	NA
5. P	A5UAL7	Orotate phosphoribosyltransferase	2.83e-06	1.38e-12	NA	NA
5. P	Q74J27	Orotate phosphoribosyltransferase	1.42e-07	6.82e-14	NA	NA
5. P	Q02ZC9	Orotate phosphoribosyltransferase	4.61e-07	8.15e-13	NA	NA
5. P	Q03NE4	Orotate phosphoribosyltransferase	2.93e-07	7.52e-15	NA	NA
5. P	Q02U09	Bifunctional protein PyrR	6.69e-08	3.29e-05	NA	NA
5. P	Q3J3Y6	Xanthine-guanine phosphoribosyltransferase	1.64e-07	8.82e-08	NA	NA
5. P	B2HNE5	Bifunctional protein PyrR	1.66e-08	1.89e-12	NA	NA
5. P	Q6GBX8	Hypoxanthine-guanine phosphoribosyltransferase	1.39e-08	8.43e-04	NA	NA
5. P	A5FVJ4	Adenine phosphoribosyltransferase	3.69e-07	3.09e-14	NA	NA
5. P	Q1J702	Adenine phosphoribosyltransferase	2.17e-07	7.14e-13	NA	NA
5. P	B4S200	Orotate phosphoribosyltransferase	4.11e-06	3.30e-13	NA	NA
5. P	Q4AAL9	Adenine phosphoribosyltransferase	2.28e-07	1.84e-12	NA	NA
5. P	Q7UR74	Adenine phosphoribosyltransferase	3.27e-07	2.29e-17	NA	NA
5. P	C1EPQ5	Bifunctional protein PyrR	7.42e-06	2.60e-10	NA	NA
5. P	Q0T7Q9	Xanthine-guanine phosphoribosyltransferase	1.69e-07	2.01e-06	NA	NA
5. P	B5BDQ2	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	B1ICZ7	Adenine phosphoribosyltransferase	2.19e-07	2.52e-12	NA	NA
5. P	P13298	Orotate phosphoribosyltransferase 1	2.58e-07	2.31e-14	NA	NA
5. P	B1JBZ0	Adenine phosphoribosyltransferase	9.85e-08	9.17e-17	NA	NA
5. P	B1IC68	Bifunctional protein PyrR	6.94e-08	3.74e-09	NA	NA
5. P	B0SIB4	Adenine phosphoribosyltransferase	1.61e-08	1.24e-13	NA	NA
5. P	Q6M0X3	Hypoxanthine/guanine phosphoribosyltransferase	8.23e-06	6.97e-16	NA	NA
5. P	Q601D6	Adenine phosphoribosyltransferase	2.16e-07	1.84e-12	NA	NA
5. P	Q03K92	Adenine phosphoribosyltransferase	2.42e-07	2.82e-13	NA	NA
5. P	Q4K3R9	Orotate phosphoribosyltransferase	4.40e-06	8.37e-13	NA	NA
5. P	A6T532	Xanthine-guanine phosphoribosyltransferase	2.02e-07	3.45e-06	NA	NA
5. P	B9DU60	Bifunctional protein PyrR	4.68e-08	1.89e-10	NA	NA
5. P	B0KA31	Orotate phosphoribosyltransferase	4.14e-07	3.01e-13	NA	NA
5. P	O42842	Adenine phosphoribosyltransferase	7.15e-08	1.16e-12	NA	NA
5. P	Q64Z17	Orotate phosphoribosyltransferase	2.69e-07	2.11e-16	NA	NA
5. P	B2V345	Adenine phosphoribosyltransferase	1.84e-07	2.28e-11	NA	NA
5. P	B0KQ92	Orotate phosphoribosyltransferase	2.89e-06	8.03e-14	NA	NA
5. P	D2RVT8	HGPRTase-like protein 3	7.22e-08	2.83e-12	NA	NA
5. P	Q8Y342	Orotate phosphoribosyltransferase	2.36e-06	1.56e-11	NA	NA
5. P	Q1DNB0	Orotate phosphoribosyltransferase	1.46e-06	3.64e-11	NA	NA
5. P	Q3SZ18	Hypoxanthine-guanine phosphoribosyltransferase	1.65e-07	9.40e-15	NA	NA
5. P	Q18IJ5	HGPRTase-like protein 2	8.83e-08	1.86e-12	NA	NA
5. P	Q3MAA1	Adenine phosphoribosyltransferase	2.05e-07	1.82e-12	NA	NA
5. P	B0K0N0	Adenine phosphoribosyltransferase	2.20e-07	9.08e-14	NA	NA
5. P	B2VHN3	Xanthine-guanine phosphoribosyltransferase	1.58e-07	5.38e-06	NA	NA
5. P	O13474	Orotate phosphoribosyltransferase	6.40e-07	3.95e-14	NA	NA
5. P	Q4QN84	Bifunctional protein PyrR	1.93e-07	2.13e-09	NA	NA
5. P	B0UWV5	Xanthine-guanine phosphoribosyltransferase	1.86e-07	3.99e-06	NA	NA
5. P	C1CEN2	Bifunctional protein PyrR	6.67e-08	3.74e-09	NA	NA
5. P	Q325P8	Xanthine-guanine phosphoribosyltransferase	1.68e-07	2.01e-06	NA	NA
5. P	A7GRK7	Orotate phosphoribosyltransferase	2.86e-07	2.18e-12	NA	NA
5. P	C0Q6T6	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.30e-06	NA	NA
5. P	A3PH80	Orotate phosphoribosyltransferase	7.55e-05	1.85e-14	NA	NA
5. P	P0A9M5	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	B0K2F0	Bifunctional protein PyrR	6.64e-04	7.37e-10	NA	NA
5. P	P0DD74	Bifunctional protein PyrR	7.52e-08	2.04e-10	NA	NA
5. P	Q6GA15	Bifunctional protein PyrR	1.00e-07	5.07e-09	NA	NA
5. P	Q1QVR0	Xanthine-guanine phosphoribosyltransferase	2.79e-07	1.65e-07	NA	NA
5. P	C3K148	Adenine phosphoribosyltransferase	1.25e-07	2.94e-16	NA	NA
5. P	Q8DUP7	Bifunctional protein PyrR	3.78e-08	5.77e-08	NA	NA
5. P	Q18FD1	Orotate phosphoribosyltransferase	1.31e-07	3.14e-12	NA	NA
5. P	A9BC43	Adenine phosphoribosyltransferase	3.59e-06	2.69e-12	NA	NA
5. P	Q5M4H9	Orotate phosphoribosyltransferase	4.81e-07	9.69e-16	NA	NA
5. P	Q1D1H1	Adenine phosphoribosyltransferase	8.56e-08	3.50e-11	NA	NA
5. P	P12426	Adenine phosphoribosyltransferase	1.02e-07	2.13e-09	NA	NA
5. P	Q732H8	Bifunctional protein PyrR	NA	3.36e-10	NA	NA
5. P	Q4FLB9	Adenine phosphoribosyltransferase	1.20e-07	1.83e-13	NA	NA
5. P	B1INE1	Orotate phosphoribosyltransferase	3.26e-07	5.30e-11	NA	NA
5. P	C0Q1X4	Orotate phosphoribosyltransferase	3.03e-06	3.35e-12	NA	NA
5. P	Q3J6V6	Orotate phosphoribosyltransferase	5.82e-07	9.26e-12	NA	NA
5. P	Q8G661	Orotate phosphoribosyltransferase	1.32e-06	3.44e-13	NA	NA
5. P	A5UGX0	Bifunctional protein PyrR	4.25e-05	2.13e-09	NA	NA
5. P	Q1AVY5	Bifunctional protein PyrR	5.30e-08	6.72e-12	NA	NA
5. P	B4TZ85	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.30e-06	NA	NA
5. P	Q3K0E8	Bifunctional protein PyrR	5.15e-08	2.37e-09	NA	NA
5. P	P45078	Hypoxanthine phosphoribosyltransferase	6.85e-09	4.61e-06	NA	NA
5. P	Q11RP3	Orotate phosphoribosyltransferase	4.44e-07	7.01e-15	NA	NA
5. P	Q5V3K1	PyrE-like protein	1.93e-04	1.20e-02	NA	NA
5. P	A7H1T2	Orotate phosphoribosyltransferase	6.66e-07	5.90e-09	NA	NA
5. P	A1BDK4	Adenine phosphoribosyltransferase	2.85e-08	7.11e-14	NA	NA
5. P	Q5UX13	HGPRTase-like protein 2	9.96e-08	2.01e-14	NA	NA
5. P	Q2FSD3	Hypoxanthine/guanine phosphoribosyltransferase	2.42e-07	1.92e-15	NA	NA
5. P	B5ZNS6	Orotate phosphoribosyltransferase	2.35e-07	2.50e-13	NA	NA
5. P	Q8XD99	Orotate phosphoribosyltransferase	3.22e-06	6.90e-12	NA	NA
5. P	A0RY85	Orotate phosphoribosyltransferase	4.05e-07	3.38e-11	NA	NA
5. P	Q1I3U3	Bifunctional protein PyrR	1.16e-05	2.54e-05	NA	NA
5. P	A0Q8C6	Adenine phosphoribosyltransferase	1.30e-07	4.99e-13	NA	NA
5. P	Q819R8	Bifunctional protein PyrR	6.44e-09	2.60e-10	NA	NA
5. P	Q32J21	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.01e-06	NA	NA
5. P	Q1GHI7	Xanthine-guanine phosphoribosyltransferase	2.27e-07	9.58e-14	NA	NA
5. P	B0R3M8	HGPRTase-like protein	1.53e-07	1.44e-13	NA	NA
5. P	B5EXE6	Orotate phosphoribosyltransferase	2.82e-06	5.40e-12	NA	NA
5. P	B9K8V0	Adenine phosphoribosyltransferase	2.87e-07	1.61e-12	NA	NA
5. P	P54363	Adenine phosphoribosyltransferase	7.80e-08	3.33e-11	NA	NA
5. P	A6TRX7	Bifunctional protein PyrR	6.71e-08	2.89e-09	NA	NA
5. P	A9WDU6	Bifunctional protein PyrR	2.73e-08	1.08e-08	NA	NA
5. P	C3L735	Bifunctional protein PyrR	7.46e-09	2.60e-10	NA	NA
5. P	Q8P8F9	Adenine phosphoribosyltransferase	6.51e-05	4.79e-11	NA	NA
5. P	Q8TXQ0	Hypoxanthine/guanine phosphoribosyltransferase	2.78e-08	3.73e-13	NA	NA
5. P	A9R2X4	Xanthine-guanine phosphoribosyltransferase	1.29e-07	1.07e-06	NA	NA
5. P	Q5HRP4	Hypoxanthine-guanine phosphoribosyltransferase	1.28e-08	6.95e-04	NA	NA
5. P	Q5XCS1	Bifunctional protein PyrR	7.45e-08	2.91e-10	NA	NA
5. P	Q8EPR5	Adenine phosphoribosyltransferase	1.90e-07	5.40e-12	NA	NA
5. P	P0DD69	Orotate phosphoribosyltransferase	4.79e-07	4.35e-15	NA	NA
5. P	A5UA30	Bifunctional protein PyrR	2.47e-04	2.13e-09	NA	NA
5. P	G0LHZ8	HGPRTase-like protein 1	1.41e-07	1.01e-14	NA	NA
5. P	P18134	Hypoxanthine phosphoribosyltransferase	7.46e-09	2.03e-06	NA	NA
5. P	A2RLC0	Orotate phosphoribosyltransferase	5.40e-07	1.06e-12	NA	NA
5. P	A8AX86	Bifunctional protein PyrR	5.53e-08	4.31e-09	NA	NA
5. P	A0QIA9	Adenine phosphoribosyltransferase	1.49e-07	9.62e-12	NA	NA
5. P	A6VXH5	Adenine phosphoribosyltransferase	9.62e-09	1.57e-12	NA	NA
5. P	Q0AJC5	Adenine phosphoribosyltransferase	1.87e-08	6.04e-14	NA	NA
5. P	Q6GHN7	Bifunctional protein PyrR	9.54e-08	5.07e-09	NA	NA
5. P	A8GLE9	Orotate phosphoribosyltransferase	2.81e-06	3.14e-12	NA	NA
5. P	P9WHK9	Orotate phosphoribosyltransferase	1.27e-07	9.80e-15	NA	NA
5. P	A7MQA9	Orotate phosphoribosyltransferase	3.33e-06	1.79e-12	NA	NA
5. P	A4IRA1	Adenine phosphoribosyltransferase	2.38e-07	2.06e-11	NA	NA
5. P	B8I3F7	Adenine phosphoribosyltransferase	4.60e-07	8.25e-12	NA	NA
5. P	P96794	Hypoxanthine-guanine phosphoribosyltransferase	1.06e-08	5.13e-12	NA	NA
5. P	A8LPV7	Adenine phosphoribosyltransferase	1.17e-07	1.57e-14	NA	NA
5. P	Q43199	Adenine phosphoribosyltransferase 1	7.54e-08	3.35e-13	NA	NA
5. P	Q252Z2	Orotate phosphoribosyltransferase	4.15e-07	5.27e-12	NA	NA
5. P	B0TDZ8	Orotate phosphoribosyltransferase	1.71e-07	7.45e-12	NA	NA
5. P	Q8E4G7	Bifunctional protein PyrR	5.12e-08	2.37e-09	NA	NA
5. P	Q0W6Q2	Orotate phosphoribosyltransferase	1.74e-07	3.90e-14	NA	NA
5. P	Q7V7D8	Adenine phosphoribosyltransferase	4.65e-07	1.84e-12	NA	NA
5. P	O34443	Adenine phosphoribosyltransferase	2.57e-07	1.61e-12	NA	NA
5. P	A6URC7	Hypoxanthine/guanine phosphoribosyltransferase	4.04e-08	6.18e-15	NA	NA
5. P	A5U281	Bifunctional protein PyrR	1.90e-08	3.30e-13	NA	NA
5. P	B0BT67	Orotate phosphoribosyltransferase	3.57e-06	9.18e-13	NA	NA
5. P	Q7V0X5	Adenine phosphoribosyltransferase	2.31e-06	7.64e-12	NA	NA
5. P	B7V3Z0	Bifunctional protein PyrR	6.78e-08	3.29e-05	NA	NA
5. P	B1LK79	Orotate phosphoribosyltransferase	3.00e-06	6.30e-12	NA	NA
5. P	P00492	Hypoxanthine-guanine phosphoribosyltransferase	1.27e-07	2.93e-15	NA	NA
5. P	Q8DWM8	Hypoxanthine-guanine phosphoribosyltransferase	8.60e-09	7.21e-07	NA	NA
5. P	A9R670	Orotate phosphoribosyltransferase	3.39e-06	8.47e-12	NA	NA
5. P	A1A7U9	Xanthine-guanine phosphoribosyltransferase	1.66e-07	1.06e-06	NA	NA
5. P	Q6GJG1	Hypoxanthine-guanine phosphoribosyltransferase	1.29e-08	8.43e-04	NA	NA
5. P	Q8DT95	Adenine phosphoribosyltransferase	1.97e-07	5.86e-13	NA	NA
5. P	P18904	Orotate phosphoribosyltransferase	3.28e-07	4.53e-14	NA	NA
5. P	B5R4S1	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.30e-06	NA	NA
5. P	C6DIC6	Orotate phosphoribosyltransferase	2.92e-06	1.45e-12	NA	NA
5. P	Q7VSN4	Orotate phosphoribosyltransferase	1.72e-04	3.83e-11	NA	NA
5. P	P0A7E3	Orotate phosphoribosyltransferase	2.40e-06	4.12e-12	NA	NA
5. P	B0CGJ6	Xanthine-guanine phosphoribosyltransferase	2.14e-08	8.11e-07	NA	NA
5. P	A8AXM7	Orotate phosphoribosyltransferase	4.36e-07	1.20e-15	NA	NA
5. P	B7JVC2	Adenine phosphoribosyltransferase	2.17e-07	3.44e-13	NA	NA
5. P	Q4QMM6	Xanthine-guanine phosphoribosyltransferase 2	1.09e-07	4.33e-05	NA	NA
5. P	P63548	Adenine phosphoribosyltransferase	2.17e-07	7.14e-13	NA	NA
5. P	O61790	Orotate phosphoribosyltransferase	1.93e-06	2.01e-07	NA	NA
5. P	B2HN75	Adenine phosphoribosyltransferase	3.83e-05	1.38e-11	NA	NA
5. P	B2TTV6	Orotate phosphoribosyltransferase	3.25e-06	6.90e-12	NA	NA
5. P	B4U3B2	Bifunctional protein PyrR	6.59e-08	1.05e-08	NA	NA
5. P	A7H8F4	Adenine phosphoribosyltransferase	8.13e-08	3.41e-09	NA	NA
5. P	P42719	Orotate phosphoribosyltransferase	2.03e-05	4.45e-12	NA	NA
5. P	Q8RDM9	Adenine phosphoribosyltransferase	1.30e-07	4.81e-12	NA	NA
5. P	Q71YI5	Orotate phosphoribosyltransferase	2.56e-07	6.72e-15	NA	NA
5. P	P0A5U1	Orotate phosphoribosyltransferase	1.21e-07	9.80e-15	NA	NA
5. P	Q1MHW9	Xanthine-guanine phosphoribosyltransferase	2.77e-08	1.01e-05	NA	NA
5. P	B1MZQ2	Adenine phosphoribosyltransferase	3.73e-08	1.12e-12	NA	NA
5. P	C3KU81	Orotate phosphoribosyltransferase	3.38e-07	5.30e-11	NA	NA
5. P	Q5SK65	Bifunctional protein PyrR	3.58e-08	1.05e-06	NA	NA
5. P	B5EHF2	Adenine phosphoribosyltransferase	3.17e-07	5.08e-10	NA	NA
5. P	B7L766	Orotate phosphoribosyltransferase	2.39e-06	4.12e-12	NA	NA
5. P	A4G1L0	Orotate phosphoribosyltransferase	1.17e-04	2.49e-11	NA	NA
5. P	Q5SHI8	Orotate phosphoribosyltransferase	6.69e-07	5.27e-12	NA	NA
5. P	A7NLW5	Bifunctional protein PyrR	3.84e-08	4.16e-09	NA	NA
5. P	P65942	Bifunctional protein PyrR	1.92e-08	3.30e-13	NA	NA
5. P	Q3K4M3	Orotate phosphoribosyltransferase	4.42e-06	3.53e-13	NA	NA
5. P	A5F5Y8	Xanthine-guanine phosphoribosyltransferase	2.06e-07	2.82e-07	NA	NA
5. P	Q8CQV4	Hypoxanthine-guanine phosphoribosyltransferase	1.38e-08	6.95e-04	NA	NA
5. P	Q3B250	Adenine phosphoribosyltransferase	3.96e-08	2.44e-15	NA	NA
5. P	Q03KS5	Orotate phosphoribosyltransferase	5.04e-07	1.49e-15	NA	NA
5. P	Q9JT95	Adenine phosphoribosyltransferase	6.52e-09	1.51e-16	NA	NA
5. P	B9KE25	Orotate phosphoribosyltransferase	6.93e-07	2.76e-09	NA	NA
5. P	P41007	Bifunctional protein PyrR	9.61e-09	8.36e-09	NA	NA
5. P	Q824L3	Orotate phosphoribosyltransferase	4.71e-07	7.23e-11	NA	NA
5. P	Q5LZW8	Orotate phosphoribosyltransferase	3.87e-07	9.69e-16	NA	NA
5. P	Q8RG90	Bifunctional protein PyrR	9.83e-08	3.24e-10	NA	NA
5. P	Q8Z2H5	Orotate phosphoribosyltransferase	3.34e-06	6.30e-12	NA	NA
5. P	B3H0G3	Orotate phosphoribosyltransferase	3.32e-06	9.18e-13	NA	NA
5. P	P65920	Orotate phosphoribosyltransferase	4.85e-07	4.35e-15	NA	NA
5. P	Q64414	Adenine phosphoribosyltransferase	9.04e-08	4.66e-14	NA	NA
5. P	B1MCI5	Adenine phosphoribosyltransferase	3.90e-08	2.30e-12	NA	NA
5. P	B7MFK3	Orotate phosphoribosyltransferase	2.83e-06	1.36e-11	NA	NA
5. P	A3DE09	Bifunctional protein PyrR	3.70e-08	5.57e-11	NA	NA
5. P	Q04LJ2	Orotate phosphoribosyltransferase	4.31e-07	4.28e-16	NA	NA
5. P	Q8FKM7	Xanthine-guanine phosphoribosyltransferase	1.67e-07	1.31e-06	NA	NA
5. P	Q8UEM6	Xanthine-guanine phosphoribosyltransferase	1.76e-08	2.76e-07	NA	NA
5. P	Q14JZ2	Adenine phosphoribosyltransferase	1.23e-07	4.99e-13	NA	NA
5. P	B1X976	Orotate phosphoribosyltransferase	2.49e-06	4.12e-12	NA	NA
5. P	A2REX9	Adenine phosphoribosyltransferase	1.97e-07	1.16e-12	NA	NA
5. P	B9MS19	Bifunctional protein PyrR	3.91e-08	6.94e-10	NA	NA
5. P	A7X1E5	Bifunctional protein PyrR	1.05e-07	5.07e-09	NA	NA
5. P	Q87T92	Orotate phosphoribosyltransferase	2.98e-06	2.65e-12	NA	NA
5. P	A5CSP7	Adenine phosphoribosyltransferase	1.08e-07	1.60e-10	NA	NA
5. P	Q8CXH9	Bifunctional protein PyrR	6.74e-09	1.60e-10	NA	NA
5. P	P65943	Bifunctional protein PyrR	9.80e-08	5.07e-09	NA	NA
5. P	Q7WEU9	Orotate phosphoribosyltransferase	2.07e-04	1.77e-11	NA	NA
5. P	A4VVY4	Adenine phosphoribosyltransferase	2.24e-07	5.48e-13	NA	NA
5. P	A2BXB1	Adenine phosphoribosyltransferase	2.63e-06	6.23e-11	NA	NA
5. P	A9A8E9	Hypoxanthine/guanine phosphoribosyltransferase	3.61e-08	5.22e-15	NA	NA
5. P	Q4L6Y0	Adenine phosphoribosyltransferase	1.93e-07	8.60e-14	NA	NA
5. P	Q9HNG2	Orotate phosphoribosyltransferase	2.96e-07	7.31e-15	NA	NA
5. P	Q2NCF5	Orotate phosphoribosyltransferase	8.18e-07	3.44e-12	NA	NA
5. P	Q4L5Q7	Orotate phosphoribosyltransferase	2.34e-07	1.14e-16	NA	NA
5. P	B8HS80	Adenine phosphoribosyltransferase	2.94e-07	4.13e-10	NA	NA
5. P	Q9KPT5	Xanthine-guanine phosphoribosyltransferase	2.17e-07	2.82e-07	NA	NA
5. P	Q1MDK6	Adenine phosphoribosyltransferase	3.17e-08	7.28e-16	NA	NA
5. P	P0A5T1	Hypoxanthine-guanine phosphoribosyltransferase	6.82e-09	7.23e-11	NA	NA
5. P	A6UYL3	Bifunctional protein PyrR	6.24e-08	1.41e-05	NA	NA
5. P	Q5XEL6	Hypoxanthine-guanine phosphoribosyltransferase	9.38e-09	4.96e-05	NA	NA
5. P	A4J563	Orotate phosphoribosyltransferase	3.63e-07	9.68e-13	NA	NA
5. P	Q6N1B4	Adenine phosphoribosyltransferase	6.07e-08	1.34e-16	NA	NA
5. P	A2C2A5	Adenine phosphoribosyltransferase	2.13e-07	1.60e-13	NA	NA
5. P	Q5QW45	Xanthine-guanine phosphoribosyltransferase	1.45e-07	2.15e-05	NA	NA
5. P	A0LH56	Bifunctional protein PyrR	9.99e-08	3.40e-07	NA	NA
5. P	A6Q639	Orotate phosphoribosyltransferase	6.55e-07	4.26e-09	NA	NA
5. P	Q28PG8	Xanthine-guanine phosphoribosyltransferase	1.81e-07	4.79e-11	NA	NA
5. P	Q2FPD8	PyrE-like protein	4.61e-05	1.19e-03	NA	NA
5. P	A9A3N4	Adenine phosphoribosyltransferase	5.23e-07	6.88e-11	NA	NA
5. P	B5XKV8	Bifunctional protein PyrR	7.32e-08	2.77e-10	NA	NA
5. P	Q8E2H3	Hypoxanthine-guanine phosphoribosyltransferase	7.22e-09	1.07e-06	NA	NA
5. P	P47518	Adenine phosphoribosyltransferase	7.49e-07	8.02e-10	NA	NA
5. P	B7GRU8	Orotate phosphoribosyltransferase	1.30e-06	5.63e-13	NA	NA
5. P	A4WPB6	Orotate phosphoribosyltransferase	3.79e-07	1.21e-13	NA	NA
5. P	Q9ZEE3	Xanthine phosphoribosyltransferase (Fragment)	4.11e-08	1.39e-07	NA	NA
5. P	A0AIX3	Adenine phosphoribosyltransferase	3.22e-07	4.94e-12	NA	NA
5. P	P0DD75	Bifunctional protein PyrR	6.73e-08	2.04e-10	NA	NA
5. P	P0A9M3	Hypoxanthine phosphoribosyltransferase	4.17e-09	3.22e-05	NA	NA
5. P	B9LUS0	PyrE-like protein	1.72e-05	1.73e-02	NA	NA
5. P	Q87RV3	Xanthine-guanine phosphoribosyltransferase	2.77e-07	5.86e-05	NA	NA
5. P	Q5LRI5	Xanthine-guanine phosphoribosyltransferase	1.31e-07	5.46e-10	NA	NA
5. P	A0RVQ8	Adenine phosphoribosyltransferase	1.55e-07	1.87e-11	NA	NA
5. P	B0UN77	Orotate phosphoribosyltransferase	1.64e-06	9.08e-14	NA	NA
5. P	A6VID5	Hypoxanthine/guanine phosphoribosyltransferase	3.47e-08	3.73e-15	NA	NA
5. P	Q1C4E3	Xanthine-guanine phosphoribosyltransferase	1.33e-07	1.07e-06	NA	NA
5. P	D7E9E7	Hypoxanthine/guanine phosphoribosyltransferase	1.32e-07	5.64e-14	NA	NA
5. P	Q6A8K3	Adenine phosphoribosyltransferase	2.37e-08	1.48e-13	NA	NA
5. P	Q8ZJP7	Orotate phosphoribosyltransferase	3.23e-06	8.47e-12	NA	NA
5. P	Q9CGM8	Orotate phosphoribosyltransferase	5.33e-07	3.62e-12	NA	NA
5. P	P0A2X6	Adenine phosphoribosyltransferase	1.27e-07	7.64e-12	NA	NA
5. P	Q0APC1	Orotate phosphoribosyltransferase	1.74e-07	1.38e-15	NA	NA
5. P	C5CIH1	Adenine phosphoribosyltransferase	5.13e-07	1.94e-11	NA	NA
5. P	Q1CS04	Orotate phosphoribosyltransferase	1.04e-06	7.29e-10	NA	NA
5. P	B7J0M3	Adenine phosphoribosyltransferase	1.12e-07	4.03e-10	NA	NA
5. P	Q9HRT1	HGPRTase-like protein	1.27e-07	1.44e-13	NA	NA
5. P	B1JIH6	Xanthine-guanine phosphoribosyltransferase	1.75e-07	1.07e-06	NA	NA
5. P	D4GVW6	HGPRTase-like protein 2	2.07e-05	3.26e-13	NA	NA
5. P	Q88VH0	Adenine phosphoribosyltransferase	1.53e-07	4.63e-12	NA	NA
5. P	Q0W496	Hypoxanthine/guanine phosphoribosyltransferase	5.42e-08	3.68e-17	NA	NA
5. P	P65910	Orotate phosphoribosyltransferase	5.35e-07	3.35e-13	NA	NA
5. P	Q8KLQ0	Adenine phosphoribosyltransferase	1.73e-08	2.62e-14	NA	NA
5. P	B0T3H5	Orotate phosphoribosyltransferase	2.93e-07	5.34e-14	NA	NA
5. P	A1TY28	Orotate phosphoribosyltransferase	1.59e-06	2.60e-13	NA	NA
5. P	O84001	Adenine phosphoribosyltransferase	2.88e-08	6.18e-13	NA	NA
5. P	Q7VGF2	Adenine phosphoribosyltransferase	8.19e-08	7.82e-14	NA	NA
5. P	A4II60	Phosphoribosyltransferase domain-containing protein 1	2.57e-07	3.63e-18	NA	NA
5. P	P65947	Bifunctional protein PyrR	6.62e-08	3.74e-09	NA	NA
5. P	Q65JU3	Orotate phosphoribosyltransferase	3.90e-07	2.01e-14	NA	NA
5. P	C5B9M4	Xanthine-guanine phosphoribosyltransferase	1.82e-07	1.24e-05	NA	NA
5. P	F2MMP6	Bifunctional protein pyrR	4.13e-08	5.66e-10	NA	NA
5. P	B0S0M3	Adenine phosphoribosyltransferase	2.12e-07	2.04e-13	NA	NA
5. P	Q18JK6	HGPRTase-like protein 1	1.40e-07	1.01e-14	NA	NA
5. P	P46534	Orotate phosphoribosyltransferase	6.15e-07	1.62e-13	NA	NA
5. P	B7GR20	Adenine phosphoribosyltransferase	2.73e-07	5.13e-09	NA	NA
5. P	A6U5N7	Orotate phosphoribosyltransferase	3.70e-07	1.91e-11	NA	NA
5. P	A9GFF3	Adenine phosphoribosyltransferase	1.58e-08	8.48e-13	NA	NA
5. P	P63545	Adenine phosphoribosyltransferase	2.29e-07	2.52e-12	NA	NA
5. P	B7MC88	Xanthine-guanine phosphoribosyltransferase	1.63e-07	1.06e-06	NA	NA
5. P	B8ILP3	Adenine phosphoribosyltransferase	3.60e-08	1.70e-18	NA	NA
5. P	B0KPW6	Adenine phosphoribosyltransferase	9.28e-08	4.66e-17	NA	NA
5. P	Q8KKS1	Adenine phosphoribosyltransferase 2	1.77e-07	6.31e-11	NA	NA
5. P	B9KMA3	Orotate phosphoribosyltransferase	6.46e-05	3.31e-14	NA	NA
5. P	Q9KVD5	Orotate phosphoribosyltransferase	3.20e-06	2.53e-13	NA	NA
5. P	D2RT08	HGPRTase-like protein 2	7.79e-08	8.17e-15	NA	NA
5. P	Q31UY4	Orotate phosphoribosyltransferase	3.10e-06	6.90e-12	NA	NA
5. P	A5GSL0	Adenine phosphoribosyltransferase	4.37e-07	8.02e-10	NA	NA
5. P	Q48Q10	Orotate phosphoribosyltransferase	2.90e-06	3.22e-14	NA	NA
5. P	Q8E4W5	Adenine phosphoribosyltransferase	2.41e-07	4.04e-13	NA	NA
5. P	Q3K0P8	Adenine phosphoribosyltransferase	2.32e-07	8.05e-13	NA	NA
5. P	Q71YH6	Bifunctional protein PyrR	8.07e-09	4.11e-09	NA	NA
5. P	A5D3H8	Adenine phosphoribosyltransferase	1.64e-07	7.33e-13	NA	NA
5. P	C6BSW0	Adenine phosphoribosyltransferase	2.70e-07	6.31e-10	NA	NA
5. P	Q6WIT9	Hypoxanthine-guanine phosphoribosyltransferase	1.07e-07	3.07e-16	NA	NA
5. P	B1AJC8	Adenine phosphoribosyltransferase	5.82e-07	4.08e-08	NA	NA
5. P	Q65UX5	Bifunctional protein PyrR	3.25e-07	1.01e-07	NA	NA
5. P	Q6F6Z6	Orotate phosphoribosyltransferase	4.82e-05	3.31e-14	NA	NA
5. P	P21846	Orotate phosphoribosyltransferase	1.76e-05	2.48e-14	NA	NA
5. P	Q02E31	Orotate phosphoribosyltransferase	2.71e-06	1.46e-13	NA	NA
5. P	P08030	Adenine phosphoribosyltransferase	7.67e-08	2.41e-14	NA	NA
5. P	Q2IS06	Adenine phosphoribosyltransferase	8.69e-08	7.25e-17	NA	NA
5. P	Q1G9R7	Adenine phosphoribosyltransferase	3.09e-07	2.13e-14	NA	NA
5. P	B1XL39	Adenine phosphoribosyltransferase	3.25e-07	2.69e-14	NA	NA
5. P	B2KCN3	Bifunctional protein PyrR	1.36e-07	3.90e-08	NA	NA
5. P	B3E683	Adenine phosphoribosyltransferase	1.09e-07	4.68e-11	NA	NA
5. P	Q72KT9	Bifunctional protein PyrR	2.43e-08	1.05e-06	NA	NA
5. P	A2RF04	Orotate phosphoribosyltransferase	4.88e-07	1.95e-15	NA	NA
5. P	Q30NT9	Orotate phosphoribosyltransferase	1.04e-06	1.74e-10	NA	NA
5. P	B8JDQ9	Adenine phosphoribosyltransferase	8.16e-08	4.29e-10	NA	NA
5. P	Q820K1	Orotate phosphoribosyltransferase	3.66e-06	1.19e-08	NA	NA
5. P	B2G552	Bifunctional protein PyrR	4.61e-08	5.25e-09	NA	NA
5. P	C3L744	Orotate phosphoribosyltransferase	4.14e-07	7.94e-12	NA	NA
5. P	B2A0H0	Adenine phosphoribosyltransferase	2.93e-07	1.64e-11	NA	NA
5. P	Q4K4E3	Bifunctional protein PyrR	1.08e-05	2.54e-05	NA	NA
5. P	Q9Z7U6	Orotate phosphoribosyltransferase	8.07e-07	3.10e-12	NA	NA
5. P	Q0SYG9	Orotate phosphoribosyltransferase	3.10e-06	2.69e-12	NA	NA
5. P	B7KVD0	Orotate phosphoribosyltransferase	9.93e-07	4.49e-13	NA	NA
5. P	B5R5R4	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.30e-06	NA	NA
5. P	Q8G6B5	Adenine phosphoribosyltransferase	1.89e-07	1.28e-09	NA	NA
5. P	P59389	Bifunctional protein PyrR 2	2.31e-07	2.06e-11	NA	NA
5. P	Q0SRX5	Bifunctional protein PyrR	9.70e-08	8.71e-11	NA	NA
5. P	B8CXF1	Adenine phosphoribosyltransferase	1.07e-07	7.14e-13	NA	NA
5. P	B2SHR3	Adenine phosphoribosyltransferase	4.49e-07	9.55e-13	NA	NA
5. P	A2RF64	Bifunctional protein PyrR	7.84e-08	2.39e-10	NA	NA
5. P	P47957	Adenine phosphoribosyltransferase	7.43e-08	2.41e-14	NA	NA
5. P	A7GXJ2	Adenine phosphoribosyltransferase	2.57e-08	1.52e-11	NA	NA
5. P	O28533	Orotate phosphoribosyltransferase	1.20e-07	1.10e-12	NA	NA
5. P	B1XSI4	Orotate phosphoribosyltransferase	1.16e-06	5.43e-11	NA	NA
5. P	Q7VKP2	Xanthine-guanine phosphoribosyltransferase	2.19e-07	5.01e-07	NA	NA
5. P	B1L1E1	Orotate phosphoribosyltransferase	3.18e-07	6.00e-11	NA	NA
5. P	Q6LX60	Orotate phosphoribosyltransferase	1.79e-07	2.46e-11	NA	NA
5. P	B7JJW9	Orotate phosphoribosyltransferase	3.41e-07	5.69e-12	NA	NA
5. P	P65914	Orotate phosphoribosyltransferase	1.84e-06	1.86e-12	NA	NA
5. P	A7ZTJ3	Orotate phosphoribosyltransferase	3.25e-06	5.20e-12	NA	NA
5. P	Q2K5T4	Adenine phosphoribosyltransferase 1	4.64e-08	7.58e-17	NA	NA
5. P	Q9SUW2	Adenine phosphoribosyltransferase 3	4.83e-08	2.18e-12	NA	NA
5. P	Q27541	Hypoxanthine-guanine phosphoribosyltransferase	1.35e-08	9.50e-12	NA	NA
5. P	P47952	Adenine phosphoribosyltransferase	1.18e-07	2.46e-13	NA	NA
5. P	Q2NVF2	Xanthine-guanine phosphoribosyltransferase	1.98e-07	1.45e-05	NA	NA
5. P	B0K2E4	Orotate phosphoribosyltransferase	4.34e-07	3.01e-13	NA	NA
5. P	Q59040	PyrE-like protein	9.56e-04	4.82e-03	NA	NA
5. P	C1C8G8	Adenine phosphoribosyltransferase	2.35e-07	2.52e-12	NA	NA
5. P	Q5ZW83	Orotate phosphoribosyltransferase	3.47e-06	1.47e-11	NA	NA
5. P	P43152	Hypoxanthine-guanine phosphoribosyltransferase	1.60e-08	1.66e-11	NA	NA
5. P	Q1LS40	Orotate phosphoribosyltransferase	1.34e-04	3.35e-12	NA	NA
5. P	A6VMA6	Bifunctional protein PyrR	7.36e-07	1.04e-07	NA	NA
5. P	A6U9A2	Xanthine-guanine phosphoribosyltransferase	6.34e-08	1.68e-06	NA	NA
5. P	Q8DQL5	Orotate phosphoribosyltransferase	4.45e-07	4.28e-16	NA	NA
5. P	A1T894	Adenine phosphoribosyltransferase	8.71e-08	3.85e-14	NA	NA
5. P	Q1JH84	Adenine phosphoribosyltransferase	2.36e-07	7.14e-13	NA	NA
5. P	Q8DF90	Xanthine-guanine phosphoribosyltransferase	2.89e-07	1.64e-05	NA	NA
5. P	B1XDY1	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	B8G8T1	Bifunctional protein PyrR	5.28e-08	3.56e-08	NA	NA
5. P	O27888	Orotate phosphoribosyltransferase	1.31e-07	1.10e-12	NA	NA
5. P	A6VJW6	Adenine phosphoribosyltransferase	1.80e-07	5.49e-14	NA	NA
5. P	Q8DGJ7	Bifunctional protein PyrR	5.36e-08	6.60e-08	NA	NA
5. P	P0CB78	Orotate phosphoribosyltransferase	4.28e-07	7.93e-16	NA	NA
5. P	Q45918	Orotate phosphoribosyltransferase	9.04e-07	2.73e-14	NA	NA
5. P	B5E302	Orotate phosphoribosyltransferase	4.40e-07	9.02e-16	NA	NA
5. P	Q5XCK7	Orotate phosphoribosyltransferase	4.76e-07	4.35e-15	NA	NA
5. P	P47202	Adenine phosphoribosyltransferase	7.38e-08	1.82e-16	NA	NA
5. P	Q5WX86	Orotate phosphoribosyltransferase	2.94e-06	5.62e-12	NA	NA
5. P	B9EB64	Bifunctional protein PyrR	1.47e-07	1.03e-08	NA	NA
5. P	A6VED8	Orotate phosphoribosyltransferase	2.85e-06	1.62e-13	NA	NA
5. P	B1L9F7	Orotate phosphoribosyltransferase	5.45e-07	1.89e-11	NA	NA
5. P	A8FFQ0	Adenine phosphoribosyltransferase	3.02e-07	1.70e-12	NA	NA
5. P	B1J0Z6	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.01e-06	NA	NA
5. P	Q1JM64	Orotate phosphoribosyltransferase	5.12e-07	1.47e-14	NA	NA
5. P	P63546	Adenine phosphoribosyltransferase	2.38e-07	7.14e-13	NA	NA
5. P	Q8XJ22	Adenine phosphoribosyltransferase	1.94e-07	6.55e-12	NA	NA
5. P	Q756E2	Adenine phosphoribosyltransferase	5.46e-08	5.48e-13	NA	NA
5. P	Q2P2B0	Adenine phosphoribosyltransferase	4.05e-07	6.51e-13	NA	NA
5. P	A5UX79	Bifunctional protein PyrR	8.59e-08	2.86e-09	NA	NA
5. P	Q88C92	Orotate phosphoribosyltransferase	3.04e-06	8.03e-14	NA	NA
5. P	B5Y8Y0	Adenine phosphoribosyltransferase	6.65e-08	2.41e-14	NA	NA
5. P	Q3B095	Orotate phosphoribosyltransferase	4.10e-07	2.06e-10	NA	NA
5. P	Q827T5	Adenine phosphoribosyltransferase	8.66e-09	2.24e-15	NA	NA
5. P	A4SJF2	Xanthine-guanine phosphoribosyltransferase	2.23e-07	4.66e-06	NA	NA
5. P	Q8ER35	Orotate phosphoribosyltransferase	1.31e-07	9.31e-17	NA	NA
5. P	A5A6I1	Hypoxanthine-guanine phosphoribosyltransferase	1.41e-07	2.77e-15	NA	NA
5. P	Q6HES3	Bifunctional protein PyrR	9.06e-09	4.29e-10	NA	NA
5. P	B4U3L7	Adenine phosphoribosyltransferase	2.38e-07	2.43e-13	NA	NA
5. P	B2K658	Xanthine-guanine phosphoribosyltransferase	1.30e-07	1.07e-06	NA	NA
5. P	P58860	Orotate phosphoribosyltransferase	1.05e-07	6.92e-14	NA	NA
5. P	Q49Y73	Adenine phosphoribosyltransferase	1.68e-07	3.13e-14	NA	NA
5. P	B9E5P8	Adenine phosphoribosyltransferase	9.71e-08	4.61e-13	NA	NA
5. P	Q18CS5	Orotate phosphoribosyltransferase	3.70e-07	2.48e-12	NA	NA
5. P	O42767	Orotate phosphoribosyltransferase	1.46e-07	2.82e-13	NA	NA
5. P	A2RIW0	Adenine phosphoribosyltransferase	2.25e-07	6.87e-13	NA	NA
5. P	B4F0W4	Orotate phosphoribosyltransferase	2.48e-06	5.13e-13	NA	NA
5. P	A3MZB9	Bifunctional protein PyrR	4.76e-07	1.18e-08	NA	NA
5. P	Q9Y9D8	Orotate phosphoribosyltransferase	1.70e-07	1.21e-14	NA	NA
5. P	Q8A1D5	Orotate phosphoribosyltransferase	2.68e-07	6.17e-17	NA	NA
5. P	B5E515	Bifunctional protein PyrR	7.99e-08	3.74e-09	NA	NA
5. P	Q28RK4	Orotate phosphoribosyltransferase	7.39e-05	1.45e-14	NA	NA
5. P	Q8K9U8	Hypoxanthine phosphoribosyltransferase	3.60e-09	2.44e-05	NA	NA
5. P	P00493	Hypoxanthine-guanine phosphoribosyltransferase	1.17e-07	3.57e-15	NA	NA
5. P	P9WHQ8	Hypoxanthine-guanine phosphoribosyltransferase	5.80e-09	7.99e-11	NA	NA
5. P	Q4A577	Adenine phosphoribosyltransferase	5.57e-07	1.57e-12	NA	NA
5. P	Q7TTW1	Adenine phosphoribosyltransferase	4.30e-07	1.82e-11	NA	NA
5. P	Q65ZZ7	Adenine phosphoribosyltransferase	1.11e-07	2.45e-10	NA	NA
5. P	B5EWK0	Xanthine-guanine phosphoribosyltransferase	1.63e-07	2.30e-06	NA	NA
5. P	A9I0G7	Orotate phosphoribosyltransferase	1.82e-04	1.12e-12	NA	NA
5. P	B2SEZ5	Adenine phosphoribosyltransferase	1.29e-07	4.99e-13	NA	NA
5. P	C0MDK3	Adenine phosphoribosyltransferase	2.40e-07	2.43e-13	NA	NA
5. P	Q04JH1	Adenine phosphoribosyltransferase	2.28e-07	2.52e-12	NA	NA
5. P	P39765	Bifunctional protein PyrR	5.62e-09	7.55e-08	NA	NA
5. P	Q48TY5	Adenine phosphoribosyltransferase	2.14e-07	7.14e-13	NA	NA
5. P	B7M267	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	Q38X29	Bifunctional protein PyrR	8.73e-09	1.20e-09	NA	NA
5. P	C5B9D0	Orotate phosphoribosyltransferase	2.60e-06	3.26e-12	NA	NA
5. P	A3MYX7	Xanthine-guanine phosphoribosyltransferase	2.29e-07	1.83e-07	NA	NA
5. P	Q3K146	Orotate phosphoribosyltransferase	4.40e-07	2.37e-13	NA	NA
5. P	Q11IP4	Xanthine-guanine phosphoribosyltransferase	4.09e-08	1.77e-06	NA	NA
5. P	Q3J555	Orotate phosphoribosyltransferase	7.84e-05	1.21e-14	NA	NA
5. P	A8YVP7	Adenine phosphoribosyltransferase	1.59e-07	3.26e-14	NA	NA
5. P	C0RHZ5	Orotate phosphoribosyltransferase	5.48e-07	3.35e-13	NA	NA
5. P	Q5LI12	Orotate phosphoribosyltransferase	2.66e-07	2.11e-16	NA	NA
5. P	Q6CA53	Adenine phosphoribosyltransferase	2.19e-08	1.29e-10	NA	NA
5. P	A0Q074	Bifunctional protein PyrR	2.27e-07	9.50e-12	NA	NA
5. P	D3SY73	HGPRTase-like protein 1	1.11e-07	1.99e-13	NA	NA
5. P	A7IAZ7	PyrE-like protein	3.47e-05	5.63e-05	NA	NA
5. P	A6VKR2	Xanthine-guanine phosphoribosyltransferase	1.38e-07	1.10e-05	NA	NA
5. P	Q9RVB9	Bifunctional protein PyrR	5.57e-08	4.18e-10	NA	NA
5. P	A9A079	Bifunctional protein PyrR	6.81e-08	6.75e-08	NA	NA
5. P	B8ZJU2	Bifunctional protein PyrR	6.69e-08	3.74e-09	NA	NA
5. P	A4FBB2	Adenine phosphoribosyltransferase	2.27e-07	1.78e-10	NA	NA
5. P	Q9RFQ2	Adenine phosphoribosyltransferase	1.20e-07	5.69e-12	NA	NA
5. P	A1A1G3	Orotate phosphoribosyltransferase	1.13e-06	1.10e-12	NA	NA
5. P	B2JYM9	Orotate phosphoribosyltransferase	3.63e-06	8.47e-12	NA	NA
5. P	Q65QN6	Xanthine-guanine phosphoribosyltransferase	1.83e-07	5.84e-06	NA	NA
5. P	Q5LIY6	Adenine phosphoribosyltransferase	2.69e-08	1.24e-15	NA	NA
5. P	B0RS13	Adenine phosphoribosyltransferase	4.30e-07	2.69e-11	NA	NA
5. P	Q8DGH9	Adenine phosphoribosyltransferase	3.44e-07	6.81e-12	NA	NA
5. P	Q5M6K8	Hypoxanthine-guanine phosphoribosyltransferase	6.90e-09	2.21e-06	NA	NA
5. P	Q8Y2B9	Adenine phosphoribosyltransferase	9.83e-09	9.26e-12	NA	NA
5. P	A8FK23	Orotate phosphoribosyltransferase	7.20e-07	1.09e-08	NA	NA
5. P	P9WHQ9	Hypoxanthine-guanine phosphoribosyltransferase	6.30e-09	7.23e-11	NA	NA
5. P	Q46C14	Hypoxanthine/guanine phosphoribosyltransferase	2.73e-05	7.62e-15	NA	NA
5. P	Q8YM41	Orotate phosphoribosyltransferase	7.27e-07	3.62e-07	NA	NA
5. P	A3PIG2	Xanthine-guanine phosphoribosyltransferase	1.98e-07	8.82e-08	NA	NA
5. P	Q2NEP2	PyrE-like protein	1.84e-05	8.88e-05	NA	NA
5. P	Q5XCH4	Adenine phosphoribosyltransferase	2.13e-07	7.14e-13	NA	NA
5. P	P0CL79	Orotate phosphoribosyltransferase	1.31e-07	6.91e-15	NA	NA
5. P	O29861	PyrE-like protein	6.29e-05	2.11e-02	NA	NA
5. P	B8DUJ6	Orotate phosphoribosyltransferase	8.54e-07	5.99e-12	NA	NA
5. P	A7GRL6	Bifunctional protein PyrR	7.02e-09	3.24e-10	NA	NA
5. P	A3CU84	Orotate phosphoribosyltransferase	8.20e-08	6.29e-14	NA	NA
5. P	B2S4S6	Adenine phosphoribosyltransferase	5.42e-08	6.18e-13	NA	NA
5. P	Q8FT38	Bifunctional protein PyrR	1.59e-08	1.61e-08	NA	NA
5. P	A4W507	Orotate phosphoribosyltransferase	2.72e-06	4.57e-12	NA	NA
5. P	Q6D1I0	Xanthine-guanine phosphoribosyltransferase	1.76e-07	3.64e-06	NA	NA
5. P	Q8E9L5	Orotate phosphoribosyltransferase	2.02e-06	1.86e-12	NA	NA
5. P	P43855	Orotate phosphoribosyltransferase	2.88e-06	1.38e-12	NA	NA
5. P	B7IUQ1	Bifunctional protein PyrR	6.61e-09	2.60e-10	NA	NA
5. P	C5BLH1	Orotate phosphoribosyltransferase	1.26e-06	3.35e-16	NA	NA
5. P	P0A7E4	Orotate phosphoribosyltransferase	2.83e-06	4.12e-12	NA	NA
5. P	Q8DHW5	Orotate phosphoribosyltransferase	4.28e-07	6.22e-12	NA	NA
5. P	C1CR28	Bifunctional protein PyrR	7.15e-08	3.74e-09	NA	NA
5. P	P0A9M6	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	Q892A7	Adenine phosphoribosyltransferase	7.78e-08	1.31e-14	NA	NA
5. P	B5Z1I2	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	B8DUE5	Adenine phosphoribosyltransferase	2.15e-07	2.99e-06	NA	NA
5. P	A5FFL9	Adenine phosphoribosyltransferase	1.53e-07	2.49e-11	NA	NA
5. P	A6SUD4	Orotate phosphoribosyltransferase	1.85e-04	2.73e-11	NA	NA
5. P	P71479	Bifunctional protein PyrR 1	1.23e-08	2.78e-08	NA	NA
5. P	Q2YT95	Adenine phosphoribosyltransferase	1.72e-07	4.80e-13	NA	NA
5. P	Q3AAI8	Adenine phosphoribosyltransferase	2.21e-07	2.28e-11	NA	NA
5. P	Q9A0D0	Bifunctional protein PyrR	6.94e-08	1.17e-10	NA	NA
5. P	A4SGB1	Adenine phosphoribosyltransferase	4.27e-08	2.10e-14	NA	NA
5. P	P9WHK3	Bifunctional protein PyrR	1.84e-08	3.30e-13	NA	NA
5. P	Q02522	Hypoxanthine-guanine phosphoribosyltransferase	1.43e-08	1.60e-06	NA	NA
5. P	Q74IU0	Adenine phosphoribosyltransferase	2.18e-07	1.42e-13	NA	NA
5. P	P35788	Orotate phosphoribosyltransferase	8.04e-08	4.29e-14	NA	NA
5. P	B7N1U3	Orotate phosphoribosyltransferase	2.89e-06	4.12e-12	NA	NA
5. P	Q04WP5	Adenine phosphoribosyltransferase	2.18e-08	7.04e-18	NA	NA
5. P	Q89IM4	Xanthine-guanine phosphoribosyltransferase	3.85e-08	2.39e-12	NA	NA
5. P	Q8DZA4	Adenine phosphoribosyltransferase	2.02e-07	4.04e-13	NA	NA
5. P	Q55758	Bifunctional protein PyrR	3.30e-08	2.43e-07	NA	NA
5. P	Q56JW4	Adenine phosphoribosyltransferase	1.09e-07	4.80e-13	NA	NA
5. P	Q57ST7	Xanthine-guanine phosphoribosyltransferase	1.63e-07	2.30e-06	NA	NA
5. P	A1SPW6	Orotate phosphoribosyltransferase	2.39e-07	4.99e-14	NA	NA
5. P	Q2YXH0	Bifunctional protein PyrR	8.11e-08	4.21e-09	NA	NA
5. P	Q2G0Y9	Xanthine phosphoribosyltransferase	4.73e-05	2.27e-18	NA	NA
5. P	A0RRR2	Orotate phosphoribosyltransferase	5.64e-07	4.41e-09	NA	NA
5. P	Q31JG9	Adenine phosphoribosyltransferase	1.01e-06	9.08e-14	NA	NA
5. P	C1CSJ8	Adenine phosphoribosyltransferase	1.97e-07	3.06e-12	NA	NA
5. P	A7HLE2	Adenine phosphoribosyltransferase	2.28e-07	7.36e-12	NA	NA
5. P	Q6F1J0	Adenine phosphoribosyltransferase	8.81e-07	9.75e-12	NA	NA
5. P	A7MEN2	Xanthine-guanine phosphoribosyltransferase	1.62e-07	3.56e-06	NA	NA
5. P	B6IT90	Adenine phosphoribosyltransferase	2.80e-07	7.17e-12	NA	NA
5. P	A1KFK3	Orotate phosphoribosyltransferase	1.29e-07	9.80e-15	NA	NA
5. P	O66821	Hypoxanthine-guanine phosphoribosyltransferase	4.08e-09	6.40e-09	NA	NA
5. P	B5EB48	Bifunctional protein PyrR	5.94e-08	1.64e-10	NA	NA
5. P	C4ZT95	Xanthine-guanine phosphoribosyltransferase	1.69e-07	2.01e-06	NA	NA
5. P	Q55C82	Probable adenine phosphoribosyltransferase	1.08e-07	3.48e-12	NA	NA
5. P	A4QEM8	Adenine phosphoribosyltransferase	1.97e-05	5.64e-11	NA	NA
5. P	A2SBW1	Orotate phosphoribosyltransferase	1.59e-04	2.31e-11	NA	NA
5. P	P58862	PyrE-like protein 1	1.49e-05	4.23e-03	NA	NA
5. P	Q5HUN2	Adenine phosphoribosyltransferase	4.99e-08	2.80e-14	NA	NA
5. P	Q0C3U2	Orotate phosphoribosyltransferase	7.04e-07	1.58e-13	NA	NA
5. P	Q4QMP2	Xanthine-guanine phosphoribosyltransferase 1	1.12e-07	2.49e-05	NA	NA
5. P	Q182T5	Bifunctional protein PyrR	7.28e-09	1.56e-10	NA	NA
5. P	B7LVK4	Orotate phosphoribosyltransferase	2.43e-06	4.12e-12	NA	NA
5. P	O58855	Orotate phosphoribosyltransferase	5.08e-08	8.06e-15	NA	NA
5. P	Q2RKK1	Xanthine phosphoribosyltransferase	2.19e-06	8.14e-14	NA	NA
5. P	C1AN24	Bifunctional protein PyrR	1.91e-08	3.30e-13	NA	NA
5. P	B0CKX9	Orotate phosphoribosyltransferase	5.89e-07	3.35e-13	NA	NA
5. P	A9VTC2	Orotate phosphoribosyltransferase	2.83e-07	5.47e-12	NA	NA
5. P	Q1JM38	Adenine phosphoribosyltransferase	2.24e-07	7.14e-13	NA	NA
5. P	Q1J796	Bifunctional protein PyrR	7.24e-08	2.04e-10	NA	NA
5. P	C1CL12	Bifunctional protein PyrR	6.73e-08	3.74e-09	NA	NA
5. P	B5EQ26	Orotate phosphoribosyltransferase	3.46e-07	1.21e-12	NA	NA
5. P	B7VJB5	Xanthine-guanine phosphoribosyltransferase	2.84e-07	2.16e-06	NA	NA
5. P	Q5PC26	Orotate phosphoribosyltransferase	2.74e-06	1.12e-11	NA	NA
5. P	B9LFU4	Bifunctional protein PyrR	2.27e-08	1.08e-08	NA	NA
5. P	P08309	Orotate phosphoribosyltransferase	5.67e-06	3.21e-11	NA	NA
5. P	Q8PVT4	Hypoxanthine/guanine phosphoribosyltransferase	1.85e-05	5.55e-13	NA	NA
5. P	C5A1Y3	Orotate phosphoribosyltransferase	6.98e-08	4.55e-13	NA	NA
5. P	P49435	Adenine phosphoribosyltransferase 1	1.80e-08	8.71e-11	NA	NA
5. P	Q2JX67	Bifunctional protein PyrR	4.37e-08	5.18e-04	NA	NA
5. P	Q163V5	Orotate phosphoribosyltransferase	6.39e-05	3.31e-14	NA	NA
5. P	P0A2X5	Adenine phosphoribosyltransferase	3.24e-07	7.64e-12	NA	NA
5. P	A8A6A4	Orotate phosphoribosyltransferase	2.39e-06	4.12e-12	NA	NA
5. P	B7M4C7	Orotate phosphoribosyltransferase	2.73e-06	4.12e-12	NA	NA
5. P	P65827	Hypoxanthine-guanine phosphoribosyltransferase	1.59e-08	8.43e-04	NA	NA
5. P	Q5V125	HGPRTase-like protein 1	3.39e-05	1.13e-15	NA	NA
5. P	B7H6L8	Orotate phosphoribosyltransferase	2.82e-07	1.43e-11	NA	NA
5. P	B3EPT5	Orotate phosphoribosyltransferase	4.48e-07	2.84e-10	NA	NA
5. P	Q476D8	Adenine phosphoribosyltransferase	5.76e-09	8.96e-14	NA	NA
5. P	Q8ZC05	Xanthine-guanine phosphoribosyltransferase	1.79e-07	1.07e-06	NA	NA
5. P	P65915	Orotate phosphoribosyltransferase	1.93e-06	1.86e-12	NA	NA
5. P	Q92PU1	Xanthine-guanine phosphoribosyltransferase	7.48e-08	2.48e-06	NA	NA
5. P	Q2JJ22	Bifunctional protein PyrR	3.88e-08	6.55e-07	NA	NA
5. P	Q9UX09	Orotate phosphoribosyltransferase	3.54e-07	1.20e-11	NA	NA
5. P	Q60AN2	Adenine phosphoribosyltransferase	1.38e-07	4.57e-12	NA	NA
5. P	Q8TSS8	Hypoxanthine/guanine phosphoribosyltransferase	2.71e-05	1.13e-13	NA	NA
5. P	B7NQ04	Orotate phosphoribosyltransferase	3.56e-06	3.48e-12	NA	NA
5. P	Q7NGZ0	Adenine phosphoribosyltransferase	3.74e-07	8.09e-11	NA	NA
5. P	C0ZG45	Bifunctional protein PyrR	2.48e-08	1.25e-08	NA	NA
5. P	A4SHC9	Orotate phosphoribosyltransferase	3.15e-06	3.69e-11	NA	NA
5. P	B2IWH8	Bifunctional protein PyrR	1.04e-07	2.33e-10	NA	NA
5. P	Q6AF89	Bifunctional protein PyrR	3.97e-08	8.02e-07	NA	NA
5. P	Q6G8T4	Adenine phosphoribosyltransferase	2.09e-07	2.93e-13	NA	NA
5. P	B7UVH9	Adenine phosphoribosyltransferase	4.78e-08	2.58e-15	NA	NA
5. P	B0KA38	Bifunctional protein PyrR	3.98e-07	7.37e-10	NA	NA
5. P	Q2K9D7	Xanthine-guanine phosphoribosyltransferase	2.23e-08	1.41e-06	NA	NA
5. P	P0CZ63	Adenine phosphoribosyltransferase	2.14e-07	7.14e-13	NA	NA
5. P	Q9SU38	Adenine phosphoribosyltransferase 4	8.32e-08	6.46e-14	NA	NA
5. P	B8GTF1	Orotate phosphoribosyltransferase	2.76e-06	5.93e-13	NA	NA
5. P	A9HEW1	Adenine phosphoribosyltransferase	3.80e-07	3.96e-12	NA	NA
5. P	P65946	Bifunctional protein PyrR	6.25e-08	3.74e-09	NA	NA
5. P	Q7NQ92	Orotate phosphoribosyltransferase	2.82e-06	6.71e-11	NA	NA
5. P	B0CBF7	Adenine phosphoribosyltransferase	4.74e-07	1.26e-11	NA	NA
5. P	B6I3L9	Orotate phosphoribosyltransferase	3.25e-06	5.20e-12	NA	NA
5. P	A6V7V8	Adenine phosphoribosyltransferase	5.42e-08	9.53e-15	NA	NA
5. P	Q5HFC8	Adenine phosphoribosyltransferase	2.01e-07	2.93e-13	NA	NA
5. P	Q9F4I7	Bifunctional protein PyrR	7.41e-06	7.53e-06	NA	NA
5. P	A5ITF9	Adenine phosphoribosyltransferase	2.00e-07	2.93e-13	NA	NA
5. P	Q65W02	Orotate phosphoribosyltransferase	2.90e-06	2.02e-12	NA	NA
5. P	Q0RNU1	Adenine phosphoribosyltransferase	1.58e-08	1.62e-09	NA	NA
5. P	A5IBA2	Orotate phosphoribosyltransferase	3.97e-06	1.47e-11	NA	NA
5. P	Q03LU2	Bifunctional protein PyrR	6.98e-08	4.41e-09	NA	NA
5. P	Q5HWM9	Orotate phosphoribosyltransferase	6.88e-07	8.85e-09	NA	NA
5. P	C6DZ53	Bifunctional protein PyrR	5.44e-08	1.76e-09	NA	NA
5. P	P51900	Hypoxanthine-guanine-xanthine phosphoribosyltransferase	2.99e-08	8.09e-06	NA	NA
5. P	Q5NII9	Adenine phosphoribosyltransferase	1.05e-07	4.99e-13	NA	NA
5. P	Q9CF77	Pyrimidine operon regulatory protein	1.19e-07	9.04e-10	NA	NA
5. P	A9KKR4	Orotate phosphoribosyltransferase	3.00e-06	2.62e-11	NA	NA
5. P	C4ZF78	Orotate phosphoribosyltransferase	5.40e-06	3.29e-11	NA	NA
5. P	A7ZWK1	Xanthine-guanine phosphoribosyltransferase	1.64e-07	2.01e-06	NA	NA
5. P	A0LUK1	Adenine phosphoribosyltransferase	3.32e-07	1.99e-12	NA	NA
5. P	Q7W089	Adenine phosphoribosyltransferase	1.34e-08	1.27e-15	NA	NA
5. P	B7NK87	Xanthine-guanine phosphoribosyltransferase	1.68e-07	2.12e-06	NA	NA
5. P	B4TZY3	Orotate phosphoribosyltransferase	2.87e-06	3.35e-12	NA	NA
5. P	A7FCT0	Orotate phosphoribosyltransferase	3.82e-06	8.47e-12	NA	NA
5. P	Q4JVE4	Adenine phosphoribosyltransferase	5.41e-07	5.40e-03	NA	NA
5. P	Q0TP22	Adenine phosphoribosyltransferase	1.92e-07	6.55e-12	NA	NA
5. P	P73935	Adenine phosphoribosyltransferase	3.40e-07	1.38e-13	NA	NA
5. P	Q0TL78	Xanthine-guanine phosphoribosyltransferase	1.66e-07	1.31e-06	NA	NA
5. P	Q3YW04	Orotate phosphoribosyltransferase	2.91e-06	4.34e-12	NA	NA
5. P	A6UX50	Hypoxanthine/guanine phosphoribosyltransferase	1.38e-05	3.00e-14	NA	NA
5. P	P37472	Hypoxanthine-guanine phosphoribosyltransferase	1.02e-08	5.38e-04	NA	NA
5. P	Q3AIK3	Adenine phosphoribosyltransferase	9.68e-07	4.85e-11	NA	NA
5. P	B4SVV9	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	Q8CSW7	Orotate phosphoribosyltransferase	2.83e-07	1.96e-16	NA	NA
5. P	P61498	Orotate phosphoribosyltransferase	6.79e-07	1.80e-11	NA	NA
5. P	B0JR14	Adenine phosphoribosyltransferase	4.09e-07	4.12e-12	NA	NA
5. P	C4L8U7	Adenine phosphoribosyltransferase	4.06e-08	1.19e-14	NA	NA
5. P	A9BDP7	Orotate phosphoribosyltransferase	9.96e-07	2.09e-11	NA	NA
5. P	O93849	Orotate phosphoribosyltransferase	2.11e-06	3.64e-11	NA	NA
5. P	A9MNR9	Xanthine-guanine phosphoribosyltransferase	1.63e-07	2.30e-06	NA	NA
5. P	P61499	Orotate phosphoribosyltransferase	6.74e-07	1.80e-11	NA	NA
5. P	C3MF81	Orotate phosphoribosyltransferase	3.77e-07	5.78e-13	NA	NA
5. P	Q6G463	Orotate phosphoribosyltransferase	3.12e-07	1.10e-12	NA	NA
5. P	A0RHR3	Bifunctional protein PyrR	7.03e-06	2.60e-10	NA	NA
5. P	B3Q0A6	Orotate phosphoribosyltransferase	2.52e-07	9.55e-13	NA	NA
5. P	Q71ZE6	Adenine phosphoribosyltransferase	1.16e-07	4.94e-12	NA	NA
5. P	Q45FY6	Hypoxanthine-guanine phosphoribosyltransferase	1.38e-07	2.12e-15	NA	NA
5. P	P37171	Hypoxanthine-guanine phosphoribosyltransferase	9.88e-09	1.16e-05	NA	NA
5. P	B9LMX4	HGPRTase-like protein	4.99e-07	1.18e-15	NA	NA
5. P	D2RXU5	HGPRTase-like protein 1	1.33e-07	1.31e-13	NA	NA
5. P	Q5M3Y6	Adenine phosphoribosyltransferase	2.50e-07	2.82e-13	NA	NA
5. P	Q2JT47	Adenine phosphoribosyltransferase	4.38e-07	5.54e-12	NA	NA
5. P	Q1GTA2	Orotate phosphoribosyltransferase	6.18e-07	4.12e-12	NA	NA
5. P	A4J2G8	Adenine phosphoribosyltransferase	1.56e-07	1.31e-10	NA	NA
5. P	C5D8P5	Bifunctional protein PyrR	9.93e-09	5.25e-09	NA	NA
5. P	C6E585	Adenine phosphoribosyltransferase	3.53e-07	3.89e-10	NA	NA
5. P	Q98QN9	Adenine phosphoribosyltransferase	8.45e-07	1.86e-12	NA	NA
5. P	A4VGS1	Orotate phosphoribosyltransferase	4.34e-06	1.42e-12	NA	NA
5. P	P59013	Bifunctional protein PyrR	7.40e-08	2.91e-10	NA	NA
5. P	B7JJX8	Bifunctional protein PyrR	7.05e-06	4.29e-10	NA	NA
5. P	Q31AA3	Adenine phosphoribosyltransferase	5.39e-06	3.91e-12	NA	NA
5. P	C7NST3	HGPRTase-like protein	1.71e-07	1.67e-13	NA	NA
5. P	Q119D0	Adenine phosphoribosyltransferase	6.18e-07	2.43e-11	NA	NA
5. P	D4GVR1	HGPRTase-like protein 1	1.44e-07	1.19e-13	NA	NA
5. P	Q0SM77	Adenine phosphoribosyltransferase	1.02e-07	8.72e-10	NA	NA
5. P	Q4K3U3	Xanthine phosphoribosyltransferase	6.32e-09	4.87e-16	NA	NA
5. P	Q1CCZ8	Orotate phosphoribosyltransferase	3.23e-06	8.47e-12	NA	NA
5. P	A1WZE3	Orotate phosphoribosyltransferase	7.87e-07	7.84e-15	NA	NA
5. P	B8D8C3	Orotate phosphoribosyltransferase	1.53e-06	1.02e-14	NA	NA
5. P	A6X294	Orotate phosphoribosyltransferase	5.84e-07	5.86e-13	NA	NA
5. P	Q58509	Orotate phosphoribosyltransferase	2.68e-07	6.01e-13	NA	NA
5. P	B2SAD1	Orotate phosphoribosyltransferase	5.74e-07	3.35e-13	NA	NA
5. P	Q1RFT3	Xanthine-guanine phosphoribosyltransferase	1.67e-07	1.06e-06	NA	NA
5. P	C0MAM5	Adenine phosphoribosyltransferase	2.02e-07	2.43e-13	NA	NA
5. P	E4NQE5	HGPRTase-like protein	1.39e-07	8.72e-14	NA	NA
5. P	P47959	Hypoxanthine-guanine phosphoribosyltransferase	1.75e-07	6.09e-15	NA	NA
5. P	A6QHH7	Adenine phosphoribosyltransferase	1.99e-07	2.93e-13	NA	NA
5. P	B1LBU1	Adenine phosphoribosyltransferase	3.19e-07	9.55e-13	NA	NA
5. P	O26962	PyrE-like protein	9.82e-05	1.02e-03	NA	NA
5. P	Q2FXU0	Adenine phosphoribosyltransferase	2.07e-07	2.93e-13	NA	NA
5. P	A1US32	Orotate phosphoribosyltransferase	2.93e-07	4.49e-13	NA	NA
5. P	Q65U83	Adenine phosphoribosyltransferase	4.39e-08	9.31e-17	NA	NA
5. P	Q5M216	Hypoxanthine-guanine phosphoribosyltransferase	7.55e-09	2.21e-06	NA	NA
5. P	B0JUG8	Bifunctional protein PyrR	8.03e-08	2.10e-09	NA	NA
5. P	Q6DCP3	Phosphoribosyltransferase domain-containing protein 1	2.80e-07	5.05e-18	NA	NA
5. P	A6X0U5	Xanthine-guanine phosphoribosyltransferase	5.98e-08	1.89e-06	NA	NA
5. P	P27605	Hypoxanthine-guanine phosphoribosyltransferase	1.52e-07	2.41e-15	NA	NA
5. P	P36973	Adenine phosphoribosyltransferase 2	9.51e-08	1.96e-09	NA	NA
5. P	Q0BVB8	Adenine phosphoribosyltransferase	2.75e-07	5.76e-12	NA	NA
5. P	Q4ZZY3	Orotate phosphoribosyltransferase	2.58e-06	5.27e-14	NA	NA
5. P	A5UF74	Adenine phosphoribosyltransferase	6.41e-08	1.01e-14	NA	NA
5. P	Q92AH7	Orotate phosphoribosyltransferase	3.34e-07	1.15e-15	NA	NA
5. P	Q311U1	Xanthine-guanine phosphoribosyltransferase	1.41e-07	1.18e-07	NA	NA
5. P	A2BUQ6	Orotate phosphoribosyltransferase	6.95e-08	1.09e-10	NA	NA
5. P	Q2W3C2	Adenine phosphoribosyltransferase	9.43e-08	5.45e-15	NA	NA
5. P	C6BW21	Orotate phosphoribosyltransferase	4.14e-07	9.01e-15	NA	NA
5. P	Q07010	Hypoxanthine-guanine phosphoribosyltransferase	4.95e-08	1.15e-04	NA	NA
5. P	A2C9I6	Adenine phosphoribosyltransferase	5.10e-07	2.93e-13	NA	NA
5. P	Q7V4S7	Orotate phosphoribosyltransferase	4.53e-07	7.79e-11	NA	NA
5. P	B4SXE3	Orotate phosphoribosyltransferase	2.99e-06	3.35e-12	NA	NA
5. P	Q2FPQ2	Orotate phosphoribosyltransferase	1.52e-07	1.28e-14	NA	NA
5. P	A1KV71	Adenine phosphoribosyltransferase	5.73e-09	1.19e-16	NA	NA
5. P	A1JHW8	Orotate phosphoribosyltransferase	3.55e-06	2.36e-12	NA	NA
5. P	Q1QSL0	Orotate phosphoribosyltransferase	2.31e-06	1.70e-09	NA	NA
5. P	Q97HA0	Bifunctional protein PyrR	1.49e-08	6.55e-11	NA	NA
5. P	Q7MAD7	Orotate phosphoribosyltransferase	1.01e-06	1.76e-09	NA	NA
5. P	Q9LFP0	Adenine phosphoribosyltransferase 5	6.87e-08	8.94e-13	NA	NA
5. P	A5I6W5	Orotate phosphoribosyltransferase	3.62e-07	5.30e-11	NA	NA
5. P	A0QWJ5	Adenine phosphoribosyltransferase	6.41e-08	3.02e-12	NA	NA
5. P	Q8PJY6	Adenine phosphoribosyltransferase	3.86e-07	1.96e-11	NA	NA
5. P	A1AXP4	Orotate phosphoribosyltransferase	3.77e-06	2.52e-12	NA	NA
5. P	B2ULR4	Bifunctional protein PyrR	4.32e-08	2.37e-08	NA	NA
5. P	P36972	Adenine phosphoribosyltransferase	1.11e-07	2.55e-15	NA	NA
5. P	Q8G0P3	Xanthine-guanine phosphoribosyltransferase	2.31e-08	8.64e-07	NA	NA
5. P	B9DPQ3	Bifunctional protein PyrR	8.73e-08	4.31e-09	NA	NA
5. P	Q2SRZ3	Adenine phosphoribosyltransferase	9.03e-07	5.91e-12	NA	NA
5. P	P0A9M4	Hypoxanthine phosphoribosyltransferase	7.00e-09	3.22e-05	NA	NA
5. P	B8FQU0	Adenine phosphoribosyltransferase	5.28e-07	1.31e-12	NA	NA
5. P	B5R5G6	Orotate phosphoribosyltransferase	2.83e-06	3.35e-12	NA	NA
5. P	P65917	Orotate phosphoribosyltransferase	4.58e-07	1.46e-13	NA	NA
5. P	Q5HGN4	Bifunctional protein PyrR	1.02e-07	5.07e-09	NA	NA
5. P	B0RGV9	Adenine phosphoribosyltransferase	3.05e-07	8.43e-08	NA	NA
5. P	Q3BSE4	Adenine phosphoribosyltransferase	4.76e-07	2.98e-12	NA	NA
5. P	Q9X6W6	Bifunctional protein PyrR	7.19e-08	3.29e-05	NA	NA
5. P	Q21EF2	Orotate phosphoribosyltransferase	1.35e-06	4.80e-15	NA	NA
5. P	Q04K45	Bifunctional protein PyrR	6.83e-08	3.74e-09	NA	NA
5. P	A7FLI5	Xanthine-guanine phosphoribosyltransferase	1.33e-07	1.07e-06	NA	NA
5. P	Q9HM15	Orotate phosphoribosyltransferase	4.27e-07	2.07e-12	NA	NA
5. P	A3PE89	Adenine phosphoribosyltransferase	2.51e-06	2.57e-10	NA	NA
5. P	Q7M8W8	Adenine phosphoribosyltransferase	2.74e-08	9.38e-12	NA	NA
5. P	P20035	Hypoxanthine-guanine-xanthine phosphoribosyltransferase	7.74e-07	5.10e-11	NA	NA
5. P	B7GV69	Orotate phosphoribosyltransferase	3.94e-05	8.14e-14	NA	NA
5. P	A3MZ36	Orotate phosphoribosyltransferase	3.29e-06	9.18e-13	NA	NA
5. P	Q5N1I0	Adenine phosphoribosyltransferase	4.25e-07	3.80e-10	NA	NA
5. P	Q138L1	Xanthine-guanine phosphoribosyltransferase	1.36e-07	1.94e-09	NA	NA
5. P	A5EY64	Orotate phosphoribosyltransferase	2.55e-07	3.05e-14	NA	NA
5. P	B2IU50	Adenine phosphoribosyltransferase	3.28e-07	6.78e-13	NA	NA
5. P	A5EE90	Adenine phosphoribosyltransferase	3.54e-08	8.90e-16	NA	NA
5. P	Q7VAL5	Adenine phosphoribosyltransferase	2.32e-06	1.99e-11	NA	NA
5. P	A1BJI2	Orotate phosphoribosyltransferase	6.23e-07	1.12e-10	NA	NA
5. P	Q5L0U8	Bifunctional protein PyrR	1.29e-08	8.36e-09	NA	NA
5. P	A4SGU2	Orotate phosphoribosyltransferase	6.60e-07	8.69e-12	NA	NA
5. P	P0CL78	Orotate phosphoribosyltransferase	1.26e-07	8.40e-15	NA	NA
5. P	Q2S8N8	Orotate phosphoribosyltransferase	3.07e-06	2.82e-13	NA	NA
5. P	B2A2U8	Bifunctional protein PyrR	4.48e-08	9.26e-10	NA	NA
5. P	A5D172	Bifunctional protein PyrR	4.68e-08	4.06e-09	NA	NA
5. P	A8FLX6	Adenine phosphoribosyltransferase	4.71e-08	2.80e-14	NA	NA
5. P	Q4KFF5	Adenine phosphoribosyltransferase	1.36e-07	5.84e-15	NA	NA
5. P	B3DXQ2	Adenine phosphoribosyltransferase	5.45e-08	2.80e-14	NA	NA
5. P	B4EUU7	Xanthine-guanine phosphoribosyltransferase	1.64e-07	9.32e-06	NA	NA
5. P	Q49WX9	Bifunctional protein PyrR	9.21e-08	9.85e-08	NA	NA
5. P	P59011	Bifunctional protein PyrR	1.63e-08	1.60e-09	NA	NA
5. P	Q3IT15	Orotate phosphoribosyltransferase	2.29e-07	2.23e-16	NA	NA
5. P	Q3AC07	Orotate phosphoribosyltransferase	4.49e-07	5.59e-10	NA	NA
5. P	A5FQE0	Bifunctional protein PyrR	2.32e-08	4.41e-09	NA	NA
5. P	B8DDR2	Bifunctional protein PyrR	5.19e-09	2.63e-09	NA	NA
5. P	A6Q687	Orotate phosphoribosyltransferase	1.05e-06	4.79e-09	NA	NA
5. P	Q1GYN9	Adenine phosphoribosyltransferase	4.00e-08	3.15e-15	NA	NA
5. P	F2MMN7	Orotate phosphoribosyltransferase	3.19e-07	4.17e-12	NA	NA
5. P	C5D514	Adenine phosphoribosyltransferase	2.85e-07	5.33e-12	NA	NA
5. P	Q5ALX8	Adenine phosphoribosyltransferase	1.23e-07	1.44e-12	NA	NA
5. P	Q48P92	Bifunctional protein PyrR	8.71e-06	6.53e-06	NA	NA
5. P	A5VPJ0	Orotate phosphoribosyltransferase	5.28e-07	3.35e-13	NA	NA
5. P	Q57E89	Orotate phosphoribosyltransferase	5.31e-07	3.35e-13	NA	NA
5. P	Q9NRG1	Phosphoribosyltransferase domain-containing protein 1	2.01e-05	2.13e-17	NA	NA
5. P	Q6LTX6	Xanthine-guanine phosphoribosyltransferase	2.02e-07	2.45e-06	NA	NA
5. P	A8MGN2	Adenine phosphoribosyltransferase	2.31e-07	8.14e-14	NA	NA
5. P	Q5M0X3	Bifunctional protein PyrR	7.30e-08	2.76e-09	NA	NA
5. P	Q6NGY0	Adenine phosphoribosyltransferase	5.64e-07	5.56e-14	NA	NA
5. P	Q1AW34	Adenine phosphoribosyltransferase	4.16e-08	6.38e-14	NA	NA
5. P	O87330	Adenine phosphoribosyltransferase	1.56e-05	3.25e-11	NA	NA
5. P	A9M1F6	Orotate phosphoribosyltransferase	2.38e-06	2.21e-12	NA	NA
5. P	A8KZE2	Adenine phosphoribosyltransferase	4.42e-08	2.34e-11	NA	NA
5. P	Q8UI98	Orotate phosphoribosyltransferase	3.10e-07	6.12e-14	NA	NA
5. P	F7XQS2	Hypoxanthine/guanine phosphoribosyltransferase	5.06e-08	3.13e-13	NA	NA
5. P	Q819S7	Orotate phosphoribosyltransferase	3.21e-07	4.07e-12	NA	NA
5. P	Q8YNI3	Adenine phosphoribosyltransferase	2.15e-07	1.72e-12	NA	NA
5. P	F4BT36	Hypoxanthine/guanine phosphoribosyltransferase	1.35e-05	6.12e-14	NA	NA
5. P	Q55574	Orotate phosphoribosyltransferase	5.30e-07	2.73e-11	NA	NA
5. P	Q8DRP8	Hypoxanthine-guanine phosphoribosyltransferase	1.07e-08	5.60e-06	NA	NA
5. P	P57291	Hypoxanthine phosphoribosyltransferase	3.86e-09	5.13e-04	NA	NA
5. P	Q5HPZ3	Bifunctional protein PyrR	8.43e-08	1.28e-08	NA	NA
5. P	A5GLQ5	Adenine phosphoribosyltransferase	4.18e-07	1.15e-12	NA	NA
5. P	A3CNI9	Bifunctional protein PyrR	4.79e-08	5.87e-10	NA	NA
5. P	A5WB07	Orotate phosphoribosyltransferase	2.92e-06	8.03e-14	NA	NA
5. P	P96078	Bifunctional protein PyrR	2.31e-08	5.70e-07	NA	NA
5. P	Q54NJ8	Hypoxanthine-guanine phosphoribosyltransferase	2.83e-08	7.69e-06	NA	NA
5. P	C1DI51	Orotate phosphoribosyltransferase	3.99e-06	3.22e-14	NA	NA
5. P	Q2FZ77	Bifunctional protein PyrR	9.44e-08	5.07e-09	NA	NA
5. P	Q3ZY75	Bifunctional protein PyrR	2.57e-08	4.41e-09	NA	NA
5. P	Q38W53	Adenine phosphoribosyltransferase	1.13e-07	3.71e-10	NA	NA
5. P	Q11TJ3	Adenine phosphoribosyltransferase	6.58e-08	3.17e-11	NA	NA
5. P	B8F557	Orotate phosphoribosyltransferase	3.84e-06	2.63e-13	NA	NA
5. P	P0DH77	Bifunctional protein pyrR	4.24e-08	5.66e-10	NA	NA
5. P	A2C0A9	Orotate phosphoribosyltransferase	3.11e-07	2.15e-09	NA	NA
5. P	Q5PF80	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	Q6LZG8	Adenine phosphoribosyltransferase	1.63e-07	1.17e-14	NA	NA
5. P	D8J663	HGPRTase-like protein 2	1.13e-07	4.59e-14	NA	NA
5. P	A2SQ87	Orotate phosphoribosyltransferase	9.91e-08	4.29e-14	NA	NA
5. P	A9KIA0	Adenine phosphoribosyltransferase	3.24e-07	9.68e-13	NA	NA
5. P	Q0SRP2	Adenine phosphoribosyltransferase	2.00e-07	6.55e-12	NA	NA
5. P	P59575	Orotate phosphoribosyltransferase	1.81e-04	4.73e-11	NA	NA
5. P	C3P661	Bifunctional protein PyrR	3.44e-08	2.60e-10	NA	NA
5. P	Q2YN10	Orotate phosphoribosyltransferase	5.33e-07	3.35e-13	NA	NA
5. P	B7UM49	Orotate phosphoribosyltransferase	2.64e-06	4.12e-12	NA	NA
5. P	A4W0Q9	Bifunctional protein PyrR	9.05e-08	1.94e-10	NA	NA
5. P	B5FM65	Orotate phosphoribosyltransferase	3.02e-06	3.35e-12	NA	NA
5. P	B2UW87	Orotate phosphoribosyltransferase	5.33e-06	3.96e-12	NA	NA
5. P	A6WCH4	Adenine phosphoribosyltransferase	1.34e-07	2.87e-11	NA	NA
5. P	C3LQ49	Xanthine-guanine phosphoribosyltransferase	2.02e-07	2.82e-07	NA	NA
5. P	A0QI38	Bifunctional protein PyrR	2.08e-08	9.62e-12	NA	NA
5. P	Q81WE7	Bifunctional protein PyrR	7.04e-09	2.60e-10	NA	NA
5. P	P75388	Adenine phosphoribosyltransferase	9.12e-07	1.66e-11	NA	NA
5. P	O69537	Hypoxanthine-guanine phosphoribosyltransferase	1.23e-08	1.37e-09	NA	NA
5. P	Q049X1	Adenine phosphoribosyltransferase	2.08e-07	2.13e-14	NA	NA
5. P	Q0TBG7	Orotate phosphoribosyltransferase	2.36e-06	4.12e-12	NA	NA
5. P	B8H621	Orotate phosphoribosyltransferase	3.13e-07	3.22e-13	NA	NA
5. P	A5WAY3	Xanthine phosphoribosyltransferase	6.42e-09	2.69e-16	NA	NA
5. P	A9WCV7	Adenine phosphoribosyltransferase	2.22e-07	6.71e-11	NA	NA
5. P	P08870	Orotate phosphoribosyltransferase	2.94e-06	3.35e-12	NA	NA
5. P	Q8VR31	Orotate phosphoribosyltransferase	1.59e-06	2.67e-13	NA	NA
5. P	A5CVN5	Orotate phosphoribosyltransferase	1.56e-06	2.94e-12	NA	NA
5. P	Q66DZ2	Xanthine-guanine phosphoribosyltransferase	1.27e-07	1.07e-06	NA	NA
5. P	Q891J4	Orotate phosphoribosyltransferase	2.86e-07	2.02e-12	NA	NA
5. P	Q6LVN7	Orotate phosphoribosyltransferase	2.82e-06	1.58e-13	NA	NA
5. P	A1A1K5	Adenine phosphoribosyltransferase	2.39e-07	1.94e-10	NA	NA
5. P	Q9HS16	PyrE-like protein	2.23e-05	5.59e-03	NA	NA
5. P	B0BTQ6	Bifunctional protein PyrR	6.80e-07	1.18e-08	NA	NA
5. P	A8GAD0	Xanthine-guanine phosphoribosyltransferase	1.51e-07	1.87e-06	NA	NA
5. P	B7IEY2	Adenine phosphoribosyltransferase	1.52e-07	4.37e-13	NA	NA
5. P	B0K969	Adenine phosphoribosyltransferase	2.69e-07	1.46e-13	NA	NA
5. P	Q7CNQ9	Hypoxanthine-guanine phosphoribosyltransferase	9.19e-09	4.96e-05	NA	NA
5. P	Q732I7	Orotate phosphoribosyltransferase	3.29e-07	3.35e-12	NA	NA
5. P	B9E711	Adenine phosphoribosyltransferase	1.75e-07	1.08e-13	NA	NA
5. P	A4TPK4	Xanthine-guanine phosphoribosyltransferase	1.28e-07	1.07e-06	NA	NA
5. P	O94331	Orotate phosphoribosyltransferase	3.12e-07	1.06e-10	NA	NA
5. P	A0RQ44	Adenine phosphoribosyltransferase	3.88e-08	2.33e-13	NA	NA
5. P	B4RNV9	Orotate phosphoribosyltransferase	2.05e-06	8.71e-13	NA	NA
5. P	A6Q809	Adenine phosphoribosyltransferase	1.45e-07	2.56e-11	NA	NA
5. P	B1XP88	Bifunctional protein PyrR	3.41e-08	3.16e-10	NA	NA
5. P	D5E7U7	Hypoxanthine/guanine phosphoribosyltransferase	1.81e-05	1.69e-13	NA	NA
5. P	Q9L4N8	Pyrimidine operon regulatory protein	1.12e-07	1.03e-09	NA	NA
5. P	A8FD21	Orotate phosphoribosyltransferase	3.73e-07	1.27e-13	NA	NA
5. P	A9BG28	Adenine phosphoribosyltransferase	6.47e-07	9.62e-12	NA	NA
5. P	Q6BZF9	Adenine phosphoribosyltransferase	8.48e-08	1.34e-12	NA	NA
5. P	B2VF77	Orotate phosphoribosyltransferase	2.42e-06	2.18e-13	NA	NA
5. P	O33799	Hypoxanthine phosphoribosyltransferase	2.86e-09	3.59e-05	NA	NA
5. P	A7H3C4	Adenine phosphoribosyltransferase	5.35e-08	2.80e-14	NA	NA
5. P	C6DCY0	Xanthine-guanine phosphoribosyltransferase	1.42e-07	2.72e-06	NA	NA
5. P	Q9K9W3	Orotate phosphoribosyltransferase	2.20e-07	2.82e-13	NA	NA
5. P	A4W292	Adenine phosphoribosyltransferase	1.94e-07	5.48e-13	NA	NA
5. P	B9DS40	Xanthine phosphoribosyltransferase	8.73e-09	1.31e-15	NA	NA
5. P	P30402	Orotate phosphoribosyltransferase 2	2.11e-06	1.13e-14	NA	NA
5. P	Q8XJB2	Bifunctional protein PyrR	6.52e-08	8.71e-11	NA	NA
5. P	Q650H6	Adenine phosphoribosyltransferase	2.30e-08	1.13e-15	NA	NA
5. P	B4T9Y5	Orotate phosphoribosyltransferase	3.11e-06	3.35e-12	NA	NA
5. P	A0B870	Hypoxanthine/guanine phosphoribosyltransferase	1.30e-05	1.74e-16	NA	NA
5. P	P0CS95	Orotate phosphoribosyltransferase	3.28e-06	4.04e-13	NA	NA
5. P	Q1CLD0	Xanthine-guanine phosphoribosyltransferase	1.26e-07	1.07e-06	NA	NA
5. P	B2U3S9	Xanthine-guanine phosphoribosyltransferase	1.72e-07	3.28e-06	NA	NA
5. P	B2GEZ3	Bifunctional protein PyrR	1.10e-08	9.06e-09	NA	NA
5. P	A9M1N3	Adenine phosphoribosyltransferase	5.54e-09	4.27e-17	NA	NA
5. P	Q4L5Q0	Bifunctional protein PyrR	1.82e-05	1.91e-09	NA	NA
5. P	A3CNR3	Adenine phosphoribosyltransferase	1.21e-07	9.94e-13	NA	NA
5. P	A2BRV3	Adenine phosphoribosyltransferase	4.75e-06	4.96e-09	NA	NA
5. P	Q1MM09	Orotate phosphoribosyltransferase	2.59e-07	1.60e-13	NA	NA
5. P	A3PYX7	Adenine phosphoribosyltransferase	1.26e-07	1.51e-12	NA	NA
5. P	Q9WYG6	Orotate phosphoribosyltransferase	5.89e-07	1.24e-11	NA	NA
5. P	A9IRL8	Orotate phosphoribosyltransferase	2.24e-07	5.78e-13	NA	NA
5. P	A0PPI7	Bifunctional protein PyrR	1.85e-08	3.71e-12	NA	NA
5. P	A5EVW7	Adenine phosphoribosyltransferase	2.54e-07	1.89e-12	NA	NA
5. P	B3EFG3	Adenine phosphoribosyltransferase	3.43e-08	1.68e-14	NA	NA
5. P	A6Q2W2	Adenine phosphoribosyltransferase	3.23e-08	7.74e-12	NA	NA
5. P	P50587	Orotate phosphoribosyltransferase	2.83e-06	1.46e-13	NA	NA
5. P	Q9CLL7	Bifunctional protein PyrR	8.70e-07	1.08e-07	NA	NA
5. P	B4SCV2	Adenine phosphoribosyltransferase	2.95e-08	4.34e-16	NA	NA
5. P	A7ZHZ7	Xanthine-guanine phosphoribosyltransferase	1.66e-07	2.01e-06	NA	NA
5. P	Q4QNR7	Orotate phosphoribosyltransferase	2.76e-06	1.51e-12	NA	NA
5. P	B3PG74	Orotate phosphoribosyltransferase	1.80e-06	5.55e-13	NA	NA
5. P	Q0TPA8	Bifunctional protein PyrR	1.56e-07	8.71e-11	NA	NA
5. P	Q4UVM8	Adenine phosphoribosyltransferase	5.48e-07	4.79e-11	NA	NA
5. P	Q89SB5	Adenine phosphoribosyltransferase	5.31e-08	8.40e-16	NA	NA
5. P	Q3JEP4	Adenine phosphoribosyltransferase	9.02e-08	1.11e-11	NA	NA
5. P	B3H0R5	Bifunctional protein PyrR	2.31e-07	1.18e-08	NA	NA
5. P	Q212I9	Xanthine-guanine phosphoribosyltransferase	3.61e-08	1.75e-11	NA	NA
5. P	Q9RX68	Orotate phosphoribosyltransferase	6.69e-07	1.24e-15	NA	NA
5. P	P43859	Xanthine-guanine phosphoribosyltransferase	1.16e-07	2.49e-05	NA	NA
5. P	Q3IJI1	Orotate phosphoribosyltransferase	2.47e-06	8.91e-12	NA	NA
5. P	A4XKT8	Orotate phosphoribosyltransferase	3.95e-07	9.62e-12	NA	NA
5. P	Q9ZJX0	Orotate phosphoribosyltransferase	7.72e-07	3.84e-10	NA	NA
5. P	C4LIX2	Adenine phosphoribosyltransferase	3.63e-07	3.63e-13	NA	NA
5. P	B4S5W8	Orotate phosphoribosyltransferase	6.94e-07	7.51e-11	NA	NA
5. P	A0PZW4	Adenine phosphoribosyltransferase	1.04e-07	2.10e-13	NA	NA
5. P	C0M760	Bifunctional protein PyrR	6.39e-08	1.19e-08	NA	NA
5. P	Q2FHP0	Bifunctional protein PyrR	1.06e-07	5.07e-09	NA	NA
5. P	A4VUG6	Bifunctional protein PyrR	9.27e-08	1.94e-10	NA	NA
5. P	A7X350	Adenine phosphoribosyltransferase	2.05e-07	2.93e-13	NA	NA
5. P	A8FD12	Bifunctional protein PyrR	1.07e-08	2.12e-10	NA	NA
5. P	A0KKD3	Adenine phosphoribosyltransferase	3.83e-08	5.45e-15	NA	NA
5. P	Q48U73	Bifunctional protein PyrR	6.46e-08	2.04e-10	NA	NA
5. P	Q9CGF0	Xanthine phosphoribosyltransferase	1.14e-08	1.92e-17	NA	NA
5. P	A4FYD7	Adenine phosphoribosyltransferase	1.86e-07	1.76e-15	NA	NA
5. P	A9VYY9	Orotate phosphoribosyltransferase	9.98e-07	2.33e-12	NA	NA
5. P	A6USF2	Adenine phosphoribosyltransferase	1.96e-07	2.00e-15	NA	NA
5. P	Q1J728	Orotate phosphoribosyltransferase	4.76e-07	4.35e-15	NA	NA
5. P	Q42563	Adenine phosphoribosyltransferase 2	7.29e-08	9.72e-14	NA	NA
5. P	A6QG99	Bifunctional protein PyrR	9.50e-08	5.07e-09	NA	NA
5. P	Q0BK98	Adenine phosphoribosyltransferase	1.06e-07	2.89e-13	NA	NA
5. P	A5D197	Orotate phosphoribosyltransferase	3.03e-07	1.77e-12	NA	NA
5. P	Q48AN2	Orotate phosphoribosyltransferase	3.63e-06	2.94e-10	NA	NA
5. P	A1VXV5	Orotate phosphoribosyltransferase	7.30e-07	1.37e-08	NA	NA
5. P	P0DD41	Hypoxanthine-guanine phosphoribosyltransferase	9.58e-09	4.96e-05	NA	NA
5. P	A3CS56	PyrE-like protein	6.02e-05	3.88e-03	NA	NA
5. P	A9MA28	Orotate phosphoribosyltransferase	5.49e-07	4.04e-13	NA	NA
5. P	B4UE87	Adenine phosphoribosyltransferase	5.99e-08	4.29e-10	NA	NA
5. P	Q1JC56	Adenine phosphoribosyltransferase	2.22e-07	7.14e-13	NA	NA
5. P	A7FYI6	Orotate phosphoribosyltransferase	3.37e-07	5.30e-11	NA	NA
5. P	A6TFN4	Orotate phosphoribosyltransferase	2.60e-06	5.27e-12	NA	NA
5. P	Q6GG69	Adenine phosphoribosyltransferase	2.06e-07	2.93e-13	NA	NA
5. P	D3SRA6	HGPRTase-like protein 2	8.99e-08	9.93e-15	NA	NA
5. P	B7N8G9	Xanthine-guanine phosphoribosyltransferase	1.68e-07	2.01e-06	NA	NA
5. P	Q74DP6	Bifunctional protein PyrR	4.27e-08	7.27e-09	NA	NA
5. P	Q2NFI3	Orotate phosphoribosyltransferase	1.05e-07	1.40e-15	NA	NA
5. P	Q0W2K2	PyrE-like protein	8.39e-06	1.30e-02	NA	NA
5. P	B5YWE0	Orotate phosphoribosyltransferase	3.44e-06	6.90e-12	NA	NA
5. P	B7HLM5	Bifunctional protein PyrR	5.11e-08	2.60e-10	NA	NA
5. P	Q8Y1L3	Bifunctional protein PyrR	3.66e-07	4.24e-05	NA	NA
5. P	Q2YAI3	Adenine phosphoribosyltransferase	2.61e-08	1.91e-12	NA	NA
5. P	Q65I86	Xanthine phosphoribosyltransferase	7.51e-09	8.27e-19	NA	NA
5. P	Q8XL65	Orotate phosphoribosyltransferase	2.61e-07	1.70e-12	NA	NA
5. P	Q5HIG5	Hypoxanthine-guanine phosphoribosyltransferase	1.43e-08	8.43e-04	NA	NA
5. P	A4WQ67	Adenine phosphoribosyltransferase	2.75e-08	4.53e-14	NA	NA
5. P	P0A277	Xanthine-guanine phosphoribosyltransferase	1.65e-07	2.30e-06	NA	NA
5. P	Q9PP06	Adenine phosphoribosyltransferase	4.15e-08	2.41e-14	NA	NA
5. P	P65945	Bifunctional protein PyrR	9.54e-08	5.07e-09	NA	NA
5. P	C4ZF43	Adenine phosphoribosyltransferase	1.31e-07	3.06e-12	NA	NA
5. P	J9VQB3	Orotate phosphoribosyltransferase	3.56e-06	2.82e-13	NA	NA
5. P	Q1I2W1	Xanthine phosphoribosyltransferase	5.95e-09	1.64e-16	NA	NA
5. P	A0LYK2	Adenine phosphoribosyltransferase	2.30e-07	5.13e-12	NA	NA
5. P	Q02Z29	Xanthine phosphoribosyltransferase	1.14e-08	2.07e-18	NA	NA
5. P	Q9Z441	Bifunctional protein PyrR	9.23e-08	2.02e-05	NA	NA
5. P	D4GZW2	Orotate phosphoribosyltransferase	2.96e-07	1.74e-13	NA	NA
5. P	Q8NM11	Orotate phosphoribosyltransferase	1.92e-07	7.05e-13	NA	NA
5. P	C4K3W9	Orotate phosphoribosyltransferase	2.22e-06	1.85e-10	NA	NA
5. P	O31060	Adenine phosphoribosyltransferase	4.74e-07	3.73e-15	NA	NA
5. P	Q9W719	Hypoxanthine-guanine phosphoribosyltransferase	1.22e-07	2.81e-16	NA	NA
5. P	Q92AG8	Bifunctional protein PyrR	6.25e-09	3.83e-09	NA	NA
5. P	A5N7G2	Bifunctional protein PyrR	2.49e-05	3.24e-10	NA	NA
5. P	Q18JL4	PyrE-like protein	2.22e-05	1.19e-02	NA	NA
5. P	Q6LDD9	Hypoxanthine-guanine phosphoribosyltransferase	1.29e-07	2.93e-15	NA	NA
5. P	P58856	Orotate phosphoribosyltransferase	5.33e-07	4.48e-18	NA	NA
5. P	B9M4Z1	Adenine phosphoribosyltransferase	1.27e-07	1.19e-12	NA	NA
5. P	Q73M27	Adenine phosphoribosyltransferase	6.01e-08	1.96e-11	NA	NA
5. P	A1KS25	Orotate phosphoribosyltransferase	1.87e-06	1.86e-12	NA	NA
5. P	A7GIH6	Orotate phosphoribosyltransferase	3.15e-07	5.50e-11	NA	NA
5. P	Q1JHA9	Orotate phosphoribosyltransferase	4.85e-07	2.77e-15	NA	NA
5. P	O13917	Hypoxanthine-guanine phosphoribosyltransferase	6.27e-08	6.39e-05	NA	NA
5. P	A3CN88	Orotate phosphoribosyltransferase	4.31e-07	6.31e-16	NA	NA
5. P	P47165	Xanthine phosphoribosyltransferase 1	1.33e-07	3.85e-05	NA	NA
5. P	Q87VA0	Bifunctional protein PyrR	1.23e-05	4.12e-06	NA	NA
5. P	P57622	Orotate phosphoribosyltransferase	1.61e-06	1.02e-14	NA	NA
5. P	A8MH75	Bifunctional protein PyrR	6.44e-09	3.41e-09	NA	NA
5. P	P0DH75	Orotate phosphoribosyltransferase	3.23e-07	4.17e-12	NA	NA
5. P	B9DUP2	Adenine phosphoribosyltransferase	2.78e-07	7.93e-14	NA	NA
5. P	Q02K26	Adenine phosphoribosyltransferase	4.49e-08	2.58e-15	NA	NA
5. P	Q83J15	Orotate phosphoribosyltransferase	2.85e-06	6.64e-12	NA	NA
5. P	Q2YCI8	Orotate phosphoribosyltransferase	4.50e-06	5.01e-09	NA	NA
5. P	A3DM49	Orotate phosphoribosyltransferase	1.30e-07	6.92e-14	NA	NA
5. P	B7L3Z0	Xanthine-guanine phosphoribosyltransferase	1.67e-07	2.01e-06	NA	NA
5. P	B2V4U3	Bifunctional protein PyrR	1.02e-08	7.14e-11	NA	NA
5. P	A2REI4	Xanthine phosphoribosyltransferase	6.59e-09	1.42e-16	NA	NA
5. P	A6KYP1	Orotate phosphoribosyltransferase	3.91e-07	4.87e-16	NA	NA
7. B	Q9UY08	Ribose-phosphate pyrophosphokinase	2.16e-03	NA	0.032	NA
7. B	Q8PUX3	Ribose-phosphate pyrophosphokinase	2.60e-03	NA	0.019	NA
7. B	Q7VFY9	Ribose-phosphate pyrophosphokinase	1.25e-03	NA	0.036	NA
7. B	Q91YL3	Uridine-cytidine kinase-like 1	1.55e-15	NA	1.72e-13	NA
7. B	Q96BW1	Uracil phosphoribosyltransferase homolog	0.00e+00	NA	3.53e-10	NA
7. B	Q9NWZ5	Uridine-cytidine kinase-like 1	2.66e-15	NA	2.23e-13	NA
7. B	Q9FKS0	Uridine kinase-like protein 1, chloroplastic	4.27e-14	NA	3.43e-19	NA
7. B	Q9LTY6	Uridine kinase-like protein 5	3.33e-15	NA	5.42e-19	NA
7. B	Q8VYB2	Uridine kinase-like protein 3	2.89e-15	NA	1.01e-15	NA
7. B	Q9LK34	Uridine kinase-like protein 2, chloroplastic	1.64e-14	NA	5.27e-19	NA
7. B	O65583	Uridine kinase-like protein 4	2.89e-15	NA	2.24e-17	NA
7. B	B1AVZ0	Uracil phosphoribosyltransferase homolog	0.00e+00	NA	2.98e-10	NA
7. B	Q9M336	Uracil phosphoribosyltransferase, chloroplastic	0.00e+00	NA	1.35e-44	NA
7. B	Q55EL3	Uridine-cytidine kinase A	3.33e-15	NA	1.13e-17	NA