Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54972.1
JCVISYN3A_0805

Uncharacterized protein.
M. mycoides homolog: NA.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 11
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 7

Total Homologs: 8
Unique PROST Homologs: 0
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 5

Literature

Danchin and Fang [1]: putative chaperone, possibly proline isomerase|similarity with Tig, possibly proline isomerase
Yang and Tsui [2]: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Antczak et al. [3]: Transcription factor
Zhang et al. [4]: GO:0018117|protein adenylylation
Bianchi et al. [5]: fic-like protein adenylation factor

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was Q8E9K5 (Protein adenylyltransferase SoFic) with a FATCAT P-Value: 1.71e-11 and RMSD of 3.02 angstrom. The sequence alignment identity is 17.0%.
Structural alignment shown in left. Query protein AVX54972.1 colored as red in alignment, homolog Q8E9K5 colored as blue. Query protein AVX54972.1 is also shown in right top, homolog Q8E9K5 showed in right bottom. They are colored based on secondary structures. 

  AVX54972.1 ---------------------------------------------MSFDYFLNNKSL--NKI-------NRKLENNIFKTPLPYSLKSK-FNY----NFI 41
      Q8E9K5 MEWQAEQAYNHLPPLPLDSKLAELAETLPILKACIPARAALAELKQAGE-LLPNQGLLINLLPLLEAQGSSEIE-NIVTT------TDKLFQYAQEDSQA 92

  AVX54972.1 DKISKDRFLSYYTKAFYDDFLESSVEKKLKTYELALLVMNETKIDLDFLSVLK-IFRDIKK--GKTPTN-------YL----ERLIFNIIYAYEYIKKPK 127
      Q8E9K5 DPMTKE-ALRYRT-ALYQGF------TQLSNRPLCVT----TA--LEICSTIKSVQMDVRKVPGTSLTNQATGEVIYTPPAGESVIRDLLSNWE-----A 173

  AVX54972.1 VLINEENLEMLISILLVGLEYD-----LDLKTNYYRTPKTKTLISNVLSSQLISKEL--ENLLDYL-KFLQANNLCTYSQTYLIFSTLVL-ISPFQKYN- 217
      Q8E9K5 FLHNQDDVDPLIKMAMAHYQFEAIHPFID--GN-GRT--GRVL--NIL--YLIDQQLLSAPIL-YLSRYIVA-----HKQDY--YR-LLLNVTTQQEWQP 255

  AVX54972.1 -LIFATLL------SQWISFQYNNSYKLVIP---ICH---FLKNQ--NEYMYELENLLNNDFNAD--KLINLFNID-----------YLKNINMYNHASC 289
      Q8E9K5 WIIF--ILNAVEQTAKW------TTHKIAAARELIAHTTEYVRQQLPKIYSHELVQVI---FEQPYCRIQNL--VESGLAKRQTASVYLKQL-------C 335

  AVX54972.1 ---IYKWVKKDKKRLFIFEDDLSFFVLILILQNTKNLSFNNIK--TLLTINKIKLFTDEQIKSTLANLIANQVLQTTSTSVVKYVLVDKYLEKSKYLVNM 384
      Q8E9K5 DIGVLEEVQSGKEKLFV---HPKFVTLM-----TKD-S-NQFSRYAL----------------------------------------------------- 372

  AVX54972.1 KGLYNGL 391
      Q8E9K5 ------- 372

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
2. PF GO:0070733 protein adenylyltransferase activity
2. PF GO:0042803 protein homodimerization activity
2. PF GO:0016779 nucleotidyltransferase activity
2. PF GO:0018117 protein adenylylation
6. F GO:0050908 detection of light stimulus involved in visual perception
6. F GO:0051087 chaperone binding
6. F GO:0044603 protein adenylylhydrolase activity
6. F GO:0007632 visual behavior
6. F GO:0034976 response to endoplasmic reticulum stress
6. F GO:0051608 histamine transport
6. F GO:0030544 Hsp70 protein binding

Uniprot GO Annotations

GO Description

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
2. PF Q9K0V1 Uncharacterized protein NMB0459 1.74e-11 2.93e-40 NA 0.5184
2. PF Q8E9K5 Protein adenylyltransferase SoFic 1.71e-11 6.58e-34 NA 0.4935
2. PF O66426 Probable protein adenylyltransferase aq_aa38 2.88e-05 7.80e-13 NA 0.4425
6. F B4KFW6 Protein adenylyltransferase Fic 4.03e-07 NA NA 0.652
6. F B3N5J3 Protein adenylyltransferase Fic 3.68e-05 NA NA 0.6443
6. F B4Q4M7 Protein adenylyltransferase Fic 5.93e-06 NA NA 0.671
6. F B4GJC1 Protein adenylyltransferase Fic 4.40e-05 NA NA 0.6623
6. F B4I1V5 Protein adenylyltransferase Fic 4.87e-06 NA NA 0.6364